mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-02-04 07:04:46 +01:00
14359 lines
450 KiB
Plaintext
14359 lines
450 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "Загальне"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right mouse includes caret move"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectalt
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
|
||
msgid "Ctrl Left Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
|
||
msgid "jumps to implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
|
||
msgid "jumps to implementation/other block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
|
||
msgid "nothing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
|
||
msgid "Double Click selects line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
msgid "Drag Selection (copy/paste)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
|
||
msgid "jumps to implementation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
|
||
msgid "nothing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
|
||
msgid "paste selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Нижній регістр, з великої букви"
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
msgid "Brackets highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
msgid "Folded code marker"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
msgid "Incremental others"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
msgid "Incremental search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
msgid "Current line highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
msgid "Mouse link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
msgid "Selected Area"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "Додаткові шляхи до коду для всіх проектів (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Додавати символ 'крапка з комою'"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Вирівняти верхній рядок за рахунок коментаря попереду"
|
||
|
||
#: lazarusidestrconsts.dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Всі файли"
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "За алфавітом"
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Двозначна дія з файлом:"
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Попередж. при компіляції"
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "Параметри додатку"
|
||
|
||
#: lazarusidestrconsts.dlgassemblerdefault
|
||
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
|
||
msgid "Default"
|
||
msgstr "Типовий"
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr "Включити код Assert"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Автостворювані форми:"
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "При створенні нових форм додати їх до автостворюваних"
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Автовидалення файлу"
|
||
|
||
#: lazarusidestrconsts.dlgautoform
|
||
msgid "Auto create form when opening unit"
|
||
msgstr "Автостворювання форми при відкритті модуля"
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse when typing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgid "Auto indent"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Автоперейменування в нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "Автозбереження"
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Доступні форми:"
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Тло"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(немає підтеки)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Та ж сама назва (в підтеці)"
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Після методів"
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
msgid "Selection:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr "Зсунути блок вправо"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttype
|
||
msgid "Indent method"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr "Сумісність з TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbrowsemsgfilter
|
||
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Застосувати"
|
||
|
||
#: lazarusidestrconsts.dlgcancel
|
||
msgctxt "lazarusidestrconsts.dlgcancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "Тест"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Порядок класів"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Остання"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr "Попередній перегляд (max довжина=1)"
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Префікс READ"
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Префікс STORED"
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "ВЕРХНІЙ РЕГІСТР"
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Префікс змінної"
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Префікс WRITE"
|
||
|
||
#: lazarusidestrconsts.dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr "Курсор в центрі"
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Зберегти як - автоперейменування в нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Перевірити сумісність"
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Виберіть файл шаблонів коду (*.dci)"
|
||
|
||
#: lazarusidestrconsts.dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Політика вставки частин класу"
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Кнопки закриття в записнику"
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Кольорова схема"
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr "Макроси стилю C (глобально)"
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr "Використовувати рядки Ansi"
|
||
|
||
#: lazarusidestrconsts.dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Як є"
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr "Перевірки:"
|
||
|
||
#: lazarusidestrconsts.dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Компіляція"
|
||
|
||
#: lazarusidestrconsts.dlgcoconditionals
|
||
msgid "Conditionals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr "Оператори стилю C (*=, +=, /= and -=)"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatechildnode
|
||
msgid "Create child node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Створити Makefile"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodeabove
|
||
msgid "Create node above"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcocreatenodebelow
|
||
msgid "Create node below"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr "Створити інформацію для DBX (уповільнює зборку)"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr "Налагоджування:"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Додавання до шляхів налагоджувача (порожньо):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Створення коду"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldingmouse
|
||
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
|
||
msgid "Mouse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr "Код"
|
||
|
||
#: lazarusidestrconsts.dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Параметри Інструметів Коду"
|
||
|
||
#: lazarusidestrconsts.dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr "Швидкий код"
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr "Створити інформацію для GDB (уповільнює зборку)"
|
||
|
||
#: lazarusidestrconsts.dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr "Створити:"
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr "Використовувати модуль Heaprc"
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr "Додані файли (-Fi):"
|
||
|
||
#: lazarusidestrconsts.dlgcoinherited
|
||
msgctxt "lazarusidestrconsts.dlgcoinherited"
|
||
msgid "Inherited"
|
||
msgstr "Наслідуваний"
|
||
|
||
#: lazarusidestrconsts.dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Бібліотеки (-F1)"
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Створення посилань"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Завант./Зберегти"
|
||
|
||
#: lazarusidestrconsts.dlgcolor
|
||
msgid "Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Параметри командного рядка (без назви програми)"
|
||
|
||
#: lazarusidestrconsts.dlgcomovedown
|
||
msgid "Move down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcomoveleveldown
|
||
msgid "Move level down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcomovelevelup
|
||
msgid "Move level up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcomoveup
|
||
msgid "Move up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
msgid "Compiler Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Завершити властивості"
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr "Файли налаштувань:"
|
||
|
||
#: lazarusidestrconsts.dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr "Нормальний Код"
|
||
|
||
#: lazarusidestrconsts.dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts.dlgcoother
|
||
msgctxt "lazarusidestrconsts.dlgcoother"
|
||
msgid "Other"
|
||
msgstr "Інше"
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Переповн."
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Обробка"
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgid "Range"
|
||
msgstr "Діапазон"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr "Показувати помилки"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
#, fuzzy
|
||
#| msgid "Show Options"
|
||
msgid "&Show Options"
|
||
msgstr "Показувати Параметри"
|
||
|
||
#: lazarusidestrconsts.dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr "Менший код"
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr "Розумна комп."
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Відкрити коди (.pp/.pas-файли, що використовуються тільки IDE , але не компілятором)"
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Стек"
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr "Вирізати символи з виконуваного"
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr "Стиль модуля:"
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Створити код для valgrind"
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr "INLINE стилю C++"
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Курсор за межею рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcursorgroupoptions
|
||
msgid "Cursor:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Cursor skips tabs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Розширення користувача (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Тип налагоджувача і шлях"
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Типовий шрифт редактора"
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr "Типове значення"
|
||
|
||
#: lazarusidestrconsts.dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr "Розширення Delphi 2"
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Видалити шаблон "
|
||
|
||
#: lazarusidestrconsts.dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr "Сумісне з Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Стільниця"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr "Файли стільниці"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopglyphsfor
|
||
msgid "Glyphs for:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmisc
|
||
msgid "Misc Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Напрямок"
|
||
|
||
#: lazarusidestrconsts.dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "Теки не існує"
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
msgid "Draw divider level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivideronoff
|
||
msgid "Draw divider"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgdoesnotexist
|
||
msgid "\" does not exist."
|
||
msgstr "\" не існує."
|
||
|
||
#: lazarusidestrconsts.dlgdownword
|
||
msgctxt "lazarusidestrconsts.dlgdownword"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: lazarusidestrconsts.dlgedadd
|
||
msgid "Add..."
|
||
msgstr "Додати..."
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr "Назад"
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Жирний"
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Підтека"
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr "Кодові шаблони"
|
||
|
||
#: lazarusidestrconsts.dlgedcolor
|
||
#, fuzzy
|
||
#| msgid "Syntax highlight"
|
||
msgctxt "lazarusidestrconsts.dlgedcolor"
|
||
msgid "Colors"
|
||
msgstr "Колір"
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
msgid "Complete blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Користувацьке розширення"
|
||
|
||
#: lazarusidestrconsts.dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Затримка"
|
||
|
||
#: lazarusidestrconsts.dlgeddelete
|
||
msgctxt "lazarusidestrconsts.dlgeddelete"
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Показувати"
|
||
|
||
#: lazarusidestrconsts.dlgededit
|
||
msgid "Edit..."
|
||
msgstr "Редагувати..."
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr "Файли редактора"
|
||
|
||
#: lazarusidestrconsts.dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr "Довідка: клацніть за команді, яку треба редагувати"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr "Завершення ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "Курсив"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Шрифт редактора"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr "Висота шрифту"
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Налаштування редактора"
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
msgid "Misc"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Помилок в схемі розташування клавіш не знайдено"
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Підкреслений"
|
||
|
||
#: lazarusidestrconsts.dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr "Колір за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgentirescope
|
||
msgid "&Entire Scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Запитати"
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "ЗАУВАЖЕННЯ: Файлами проектів вважаються всі файли в теці проектів"
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Резервування"
|
||
|
||
#: lazarusidestrconsts.dlgenvcolors
|
||
msgctxt "lazarusidestrconsts.dlgenvcolors"
|
||
msgid "Colors"
|
||
msgstr "Кольори"
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Файли"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Сітка"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Лінійки допомоги"
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr "Інші файли"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Проект"
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Міжрядковий інтервал"
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external gdb debug symbols file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Файлові розширення"
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Знайти текст над курсором"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Процедура"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgid "Record"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgid "Repeat"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr "Колір переднього плану"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Політика вставки процедур"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Залишати порядок процедур"
|
||
|
||
#: lazarusidestrconsts.dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Шлях до компілятора (%s)"
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Тека кодів FPC"
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
msgid "Frame color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Редактор форм"
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
msgid "&From Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgfropts
|
||
msgctxt "lazarusidestrconsts.dlgfropts"
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts.dlggeneratedwarf
|
||
msgid "Generate dwarf debug information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Задіяти позицію"
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgglyphshowalways
|
||
msgid "Show Always"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgglyphshownever
|
||
msgid "Show Never"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgglyphshowsystem
|
||
msgid "Use System Defaults"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr "Сумісність з GPC (GNU Pascal Compiler)"
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Створити код для gprof"
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Колір виділення"
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Колір сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Розмір X сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Крок сітки по горизонталі"
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Розмір Y сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Вертикальний крок сітки"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgid "Debugger"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "Середовище"
|
||
|
||
#: lazarusidestrconsts.dlggrouphelp
|
||
msgctxt "lazarusidestrconsts.dlggrouphelp"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Ґруповий відкат"
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Показувати лінійки"
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr "Колір поля "
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Ширина поля"
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Прокрутка на півсторінки"
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr "Розмір купи"
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Висота:"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Приховати вікна IDE при пуску"
|
||
|
||
#: lazarusidestrconsts.dlghidemessagesicons
|
||
msgid "Hide Messages Icons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr "Показ Порад до параметру \"Sender\" не використаний"
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr "Довідки для непотрібних модулів в головному коді"
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "Home - до найближчого старту"
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Основна програма"
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier completion"
|
||
msgstr "Завершення ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Політика ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ігнорувати"
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Включити системні змінні"
|
||
|
||
#: lazarusidestrconsts.dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Зсунути вправо код за"
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
msgid "Indent and Tabs:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Перед методами"
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Конструктор має бути 'init' (деструктор має бути 'done')"
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Вставляти пробіл після"
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Вставляти пробіл перед"
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Інтервал в сек"
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Перехід (напр. Метод Переходу)"
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Клавіші"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Помилки комбінацій клавіш"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Схема розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Політика ключових слів"
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Дозволити LABEL і GOTO"
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Останній (напр. в кінці коду)"
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Тека Lazarus (за замовчуванням для всіх проектів)"
|
||
|
||
#: lazarusidestrconsts.dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Ліворуч:"
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
msgid "color for left, top"
|
||
msgstr "колір зліва зверху"
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr "Рівень 0 (без екстра-оптимізації)"
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Розчіплювання рядка"
|
||
|
||
#: lazarusidestrconsts.dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr "Стиль компонування"
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr "Розумне компонування"
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr "Вивести номери рядків в помилках часу виконання"
|
||
|
||
#: lazarusidestrconsts.dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Завантаження налаштувань робочого столу з файлу"
|
||
|
||
#: lazarusidestrconsts.dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Головне меню"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr "Показувати форми проекту"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
msgid "View project frames"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr "Показувати модулі проекту"
|
||
|
||
#: lazarusidestrconsts.dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Шлях до Make"
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Додатковий відступ зліва на сторінці для палітурки"
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Колір Maker"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
msgid "Word under Caret Highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
msgid "Match word boundaries for words up to this length:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
msgid "Ignore Keywords"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
msgid "Disable Timer for Markup Current Word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
msgid "Trim Spaces (when highlighting current selection)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Максимум лічильника"
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Максимальна довжина рядка"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Максимум останніх файлів"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Максимум останніх файлів проектів"
|
||
|
||
#: lazarusidestrconsts.dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Метод вставки"
|
||
|
||
#: lazarusidestrconsts.dlgminimizeallonminimizemain
|
||
msgid "Minimize all on minimize main"
|
||
msgstr "Мінімізувати все при мінімізації головної програми"
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Змішування методів і властивостей"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbutton
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
|
||
msgid "Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonleft
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
|
||
msgid "Middle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldbuttonright
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldall
|
||
msgid "Fold All (Some Colapsed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolfoldone
|
||
msgid "Fold One (Some Colapsed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
|
||
msgid "Unfold All (Some Colapsed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
|
||
msgid "Unfold One (Some Colapsed)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldenabled
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
|
||
msgid "Enabled"
|
||
msgstr "Доступний"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldall
|
||
msgid "Fold All (All Expanded)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldexpfoldone
|
||
msgid "Fold One (All Expanded)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup1
|
||
msgid "Setting 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldgroup2
|
||
msgid "Setting 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifieralt
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmousefoldmodifiershift
|
||
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmousegroupoptions
|
||
msgid "Mouse:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgid "Single"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgid "Double"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgid "Triple"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgid "Quad"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnadd
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
|
||
msgid "Add"
|
||
msgstr "Додати"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtncancel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtndown
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnexport
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
|
||
msgid "Export"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgid "Extra 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgid "Extra 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnimport
|
||
msgid "Import"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
msgid "Make Fallback"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnok
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnudp
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
|
||
msgid "Change"
|
||
msgstr "Змінити"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnup
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgid "Caret"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr "Порядок"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
msgid "Filter Mod-Keys"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmsgs
|
||
msgctxt "lazarusidestrconsts.dlgmsgs"
|
||
msgid "Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Множинний Вибір"
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Надання назви"
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
#, fuzzy
|
||
#| msgid "no automatic renaming"
|
||
msgid "No automatic renaming"
|
||
msgstr "без автоперейменування"
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr "Не розривати рядок після:"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr "Не розривати рядок перед:"
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Висота елемента"
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgoioptions
|
||
msgctxt "lazarusidestrconsts.dlgoioptions"
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr "Оптимізації:"
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr "Інші модулі файли (-Fu) (роздільником є двокрапка)"
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
msgid "Overwrite Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpackagegraph
|
||
msgid "Package Graph"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Довідки до палітри компонентів"
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Стандартне розширення паскаля"
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr "Передати параметри компонувальнику (відділяти пробілами)"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
msgid "Persistent Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
msgid "Clear Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Форми"
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
msgid "Load Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr "Вихідні налаштування"
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
msgid "Save Icon"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Сесія"
|
||
|
||
#: lazarusidestrconsts.dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Назва виконуваного файлу:"
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Заголовок:"
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
msgid "Use manifest file to enable themes (windows only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Параметри проекту"
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr "Файли проекту"
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
msgid "&Prompt On Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Розширення властивості"
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr "Назва властивості"
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "При старті відкрити останній проект"
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Показувати ширину бордюру"
|
||
|
||
#: lazarusidestrconsts.dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Показувати сітку"
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Вирівнювати по сітці"
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Посилання"
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
msgid "&Regular Expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Замінити &Всі"
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "&Замінити на"
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr "Звіт"
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
msgid "color for right, bottom"
|
||
msgstr "колір справа знизу"
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr "Вибір правим клацанням"
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Праве поле"
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Робоча тека"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandgroup
|
||
msgid "Rubber band"
|
||
msgstr "Поле приміток"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchilds
|
||
msgid "Select grand childs"
|
||
msgstr "Виділити головних нащадків"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
msgid "Creation"
|
||
msgstr "Створення"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "Середовище"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Місцевий"
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Системні змінні"
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Використовувати дисплей"
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Overrides користувача"
|
||
|
||
#: lazarusidestrconsts.dlgrunovalue
|
||
msgctxt "lazarusidestrconsts.dlgrunovalue"
|
||
msgid "Value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Змінна"
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr "Параметри виконання"
|
||
|
||
#: lazarusidestrconsts.dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Збер. робочий стіл у файл"
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Зберігати відомості про закриті файли"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Зберігати відомості тільки про файли проекту"
|
||
|
||
#: lazarusidestrconsts.dlgscope
|
||
msgid "Scope"
|
||
msgstr "Контекст"
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Прокрутити на один вниз"
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
msgid "Scrolling:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Прокрутити до кінця файлу"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
#, fuzzy
|
||
#| msgid "Scroll past end of line"
|
||
msgid "Caret past end of line"
|
||
msgstr "Прокрутити до кінця рядка"
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Пошук перервано користувачем."
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr "Пошук..."
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Шляхи"
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
msgid "&Selected Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Встановити всі елементи за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Встановити елемент за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Встановити змінну властивості"
|
||
|
||
#: lazarusidestrconsts.dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Назви компонентів"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Показувати компільовані процедури"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Показувати умови"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Показувати налагоджувальну інф-ю"
|
||
|
||
#: lazarusidestrconsts.dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Показувати означені макроси"
|
||
|
||
#: lazarusidestrconsts.dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Довідки редактора"
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Показ. викон. інф. (для Win32)"
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Показувати загальні відомості"
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Показувати додаткові довідки"
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr "Показувати довідки"
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Показувати номери рядків"
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr "Показувати зауваження"
|
||
|
||
#: lazarusidestrconsts.dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Показувати тільки помилки"
|
||
|
||
#: lazarusidestrconsts.dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Всі процеси при помилках"
|
||
|
||
#: lazarusidestrconsts.dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr "Показувати пораду з прокрут."
|
||
|
||
#: lazarusidestrconsts.dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Показувати підсумкове"
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Показувати випробувальні файли"
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Показувати використані файли"
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr "Показувати попередження"
|
||
|
||
#: lazarusidestrconsts.dlgskipforwarddeclarations
|
||
msgid "Skip forward declarations"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Розумна табуляція"
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Символ позаду (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Лічильник (.pp;1)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Символ попереду (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Защіпнутись за лінійками"
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr "Пробіл"
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Довідки до командних кнопок (відкрити, зберегти і т.д.)"
|
||
|
||
#: lazarusidestrconsts.dlgsrcedit
|
||
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
||
msgid "Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Походження"
|
||
|
||
#: lazarusidestrconsts.dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr "Ключове слово Static в об'єктах"
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Завершити після купи помилок"
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Параметри синтаксису"
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "ТАБ зсуває блоки вправо"
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "ТАБ в пробіли"
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr "Платформа"
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Тека для побудови пробних проектів"
|
||
|
||
#: lazarusidestrconsts.dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "&Текст не знайдено"
|
||
|
||
#: lazarusidestrconsts.dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "Тека \""
|
||
|
||
#: lazarusidestrconsts.dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "сек"
|
||
|
||
#: lazarusidestrconsts.dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Обчислення виразу"
|
||
|
||
#: lazarusidestrconsts.dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Символьні інструменти"
|
||
|
||
#: lazarusidestrconsts.dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Верх:"
|
||
|
||
#: lazarusidestrconsts.dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Назва файлу шаблону"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
msgid "Trim Spaces Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Обрізати кінцеві пробіли"
|
||
|
||
#: lazarusidestrconsts.dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr "Нестандартна оптимізація"
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Скасування після збереження"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
msgid "Undo / Redo:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Межа скасувань:"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepbrowse
|
||
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
|
||
msgid "Open"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Залежності модуля"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr "Оновити"
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Вихідна тека модулів (-FU):"
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgupword
|
||
msgctxt "lazarusidestrconsts.dlgupword"
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr "Згортання коду"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
msgid "Use additional Compiler Config File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
msgid "Divider drawing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr "Використовувати стандартний файл налаштувань (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Використовувати програму для запуску"
|
||
|
||
#: lazarusidestrconsts.dlgusemsgfile
|
||
msgid "Use messages file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Підсвітка синтаксису"
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Подробиці при компіляції:"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Видиме поле (лів)"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Права видима границя"
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
msgid "&Whole Words Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Ширина:"
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "Вікно"
|
||
|
||
#: lazarusidestrconsts.dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr "Позиції вікна"
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr "Слова"
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr "Вивести логотип FPC"
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Виділені компоненти мають належати одній формі"
|
||
|
||
#: lazarusidestrconsts.fdmalignword
|
||
msgid "Align"
|
||
msgstr "Вирівняти"
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
#, fuzzy
|
||
#| msgid "Delete selection"
|
||
msgid "Delete Selection"
|
||
msgstr "Стерти виділення"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
#, fuzzy
|
||
#| msgid "Mirror horizontal"
|
||
msgid "Mirror Horizontal"
|
||
msgstr "Горизонтальне дзеркало"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
#, fuzzy
|
||
#| msgid "Mirror vertical"
|
||
msgid "Mirror Vertical"
|
||
msgstr "Вертикальне дзеркало"
|
||
|
||
#: lazarusidestrconsts.fdmorder
|
||
msgctxt "lazarusidestrconsts.fdmorder"
|
||
msgid "Order"
|
||
msgstr "Порядок"
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
#, fuzzy
|
||
#| msgid "Back one"
|
||
msgid "Back One"
|
||
msgstr "Назад на один"
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
#, fuzzy
|
||
#| msgid "Forward one"
|
||
msgid "Forward One"
|
||
msgstr "Вперед на одну"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
#, fuzzy
|
||
#| msgid "Move to back"
|
||
msgid "Move to Back"
|
||
msgstr "До попереднього"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
#, fuzzy
|
||
#| msgid "Move to front"
|
||
msgid "Move to Front"
|
||
msgstr "Пересунути наперед"
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
#, fuzzy
|
||
#| msgid "Save form as xml"
|
||
msgid "Save form as XML"
|
||
msgstr "Зберегти файл як xml"
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Масштаб"
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Параметр:Кинути на решітку"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Параметр:Прикріпити до лінійок"
|
||
|
||
#: lazarusidestrconsts.fdmtaborder
|
||
#, fuzzy
|
||
#| msgid "Tab order..."
|
||
msgid "Tab Order..."
|
||
msgstr "Чергування ..."
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Додати файл"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Додати файли"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Додати файли до пакунку"
|
||
|
||
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "Додати LFM, LRS файли, якщо вони існують"
|
||
|
||
#: lazarusidestrconsts.lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Додати до пакунку"
|
||
|
||
#: lazarusidestrconsts.lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Додати модуль"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Двозначний тип предка"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Двозначна назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Двозначна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Тип Предок"
|
||
|
||
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Порушення залежностей"
|
||
|
||
#: lazarusidestrconsts.lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Назва класу вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Створити новий файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Залежність"
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%sІснуючий файл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Файл вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr "Файл %s%s%s вже є в проекті."
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Файл вже є в пакунку"
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Файл вже використовується"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Назва файлу:"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Файл не є модулем"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Неправильний тип предка"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr "Неправильний цикл"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Неправильна назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Неправильний файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Неправильна назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s є некоректною назвою модуля"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Нова назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Новий компонент"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Новий файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Не знайдено пакунку для залежності %s%s%s.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Задовга назва сторінки"
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Сторінка палітри:"
|
||
|
||
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Модулі паскаля повинні мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Зберегти файл діалогу"
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Скоротити або розширити назву файла"
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Перемкнути шляхи"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Назва типа предка %s%s%s збігається з%sмодулем %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "Тип предка %s%s%s є неправильним ідентифікатором паскаля"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "Назва класу %s%s%s і його предка %s%s%s збігаються."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "Назва класу %s%s%s вже є в%sПакунок %s%sФайл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Назва класу %s%s%s збігається з %s назвою модуля %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва класу %s%s%s є неприпустимим ідентифікатором паскаля"
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "Файл %s%s%s вже в пакунку."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Файл %s%s%s є частиною поточного проекту.%sНе краща ідея ділити файли між проектами і пакунками."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Файл %s%s%s виглядає як подвійний, тому що пакунок не має теки за замовчуванням.%sВкажіть будь ласка назву файлу з повним шляхом."
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "Пакунок вже має залежність від пакунку %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "Назва пакунку %s%s%s занадто довга (до 100 симв.)."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "Така назва модуля %s%s%s вже є в цьому пакунку."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "Назва модулю %s%s%s%sі назва файлу %s%s%s різні."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "Назва модуля %s%s%s не відповідає назві файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Назва модуля збігається із зареєстрованим компонентом.%sЦе може призвести до непередбачуваних повідомлень про помилки."
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Назва файлу модуля:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Назва файлу модуля:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Назва модуля:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Назва модуля є неприпустимою"
|
||
|
||
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Шукати в модулі назву і процедуру Register"
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Прервати все"
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Прервати всі завантаження"
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Перервати завантаження проекту"
|
||
|
||
#: lazarusidestrconsts.lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Повністю перевати завантаження"
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Про проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Не можу знайти список авторів"
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "%s не може вміщувати компоненти TControl.%sВ ньому можна розміщувати тільки невізуальні компоненти."
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactions
|
||
msgid "Actions:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Активувати синтаксис регулярних виразів для тексту і заміни (майже як в perl)"
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadddirectory
|
||
msgid "Add directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddfilesofdirectory
|
||
msgid "Add files of directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Додаткові параметри компілятора, наслідувані від пакунків"
|
||
|
||
#: lazarusidestrconsts.lisadditionalinformation
|
||
msgid "Additional Information"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Додати %s до проекту?"
|
||
|
||
#: lazarusidestrconsts.lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaddvalue
|
||
msgid "Add value:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "Додати файл до пакунку"
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr "Пакунок призначення"
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr "Тип файлу"
|
||
|
||
#: lazarusidestrconsts.lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "Має процедуру Register"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Неправильний пакунок"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "Неправильний ідентифікатор пакунку: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Віртуальний модуль (код не в пакункові)"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Пакунок тільки для читання"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Пакунк %s%s%s не знайдений."
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Пакунок %s тільки для читання."
|
||
|
||
#: lazarusidestrconsts.lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr "Назва модуля: "
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Файл %s%s%s вже існує.%s Замінити?"
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Вирівнювання"
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr "Додати блоки, що виглядають правильними"
|
||
|
||
#: lazarusidestrconsts.lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Всі файли"
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Дозволити пошук для декількох рядків"
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalways
|
||
msgid "Always"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Знайдено двозначний файл"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Знайдено двозначний файл: %s%s%s%sЙого може бути переплутано з %s%s%s%s%sВидалити цей файл?"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Знайдено двозначні файли"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Знайдено двозначний модуль"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "При останньому запуску виникла помилка при завантаженні %s!%s%sЗавантажити цей проект знову?"
|
||
|
||
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
|
||
msgid "Append short description to long description"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Програма%sГрафічна програма на lcl/freepascal. Програмний файл автоматично підтримується lazarus."
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "Ширина бордюру навколо контролу. Інші чотири бордюри додані до цієї величини."
|
||
|
||
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Простий програманий файл на Паскалі.%sМоже бути використаний для швидкого і чорнового тестування.%sА краще створіть новий проект."
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Запитати перед заміною кожного фрагменту"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautocontinue
|
||
msgid "Auto Continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautocontinueafter
|
||
msgid "Auto continue after:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr "Автоматичні ознаки"
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Доступні пакунки"
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Резервування не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Зміна назви пакунку або версії порушить залежності. Змінити ці залежності як правило?%sВиберіть Так для заміни всіх перерахованих залежностей.%sВиберіть Ігнорувати для розриву залежностей і продовження."
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr "починається"
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
msgid "Behind related"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
msgid "Always Build before Run"
|
||
msgstr "Завжди Будувати перед Виконанням"
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Побудувати Команду"
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Замість виконання після побудови проекту використовуйте коменду Побудувати Файл"
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Замість виконання після побудови проекту використовуйте коменду Виконати Файл"
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Виконати Команду"
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor ..."
|
||
msgstr "Коли цей файл активний в редакторі коду ..."
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (Leave empty for file path)"
|
||
msgstr "Робоча тека (залишити порожньою для файлового шляху)"
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
|
||
msgid "Working Directory (Leave empty for file path)"
|
||
msgstr "Робоча Тека (Залишити порожньою для файлового шляху)"
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr "Ширина бордюру"
|
||
|
||
#: lazarusidestrconsts.lisbottom
|
||
msgid "Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "Ширина бордюру навколо кнопки. Ця величина додана до базової ширини бордюру і використовується для відступів навколо контролу."
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Зафіксувати кнопку"
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого нижня сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Вниз з еквівалентим відступом"
|
||
|
||
#: lazarusidestrconsts.lisbreak
|
||
msgctxt "lazarusidestrconsts.lisbreak"
|
||
msgid "Break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbreakpointproperties
|
||
msgid "Breakpoint Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Перегляд (пошук компілятора) (%s)"
|
||
|
||
#: lazarusidestrconsts.lisbtnbreak
|
||
msgctxt "lazarusidestrconsts.lisbtnbreak"
|
||
msgid "Break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtncontinue
|
||
msgctxt "lazarusidestrconsts.lisbtncontinue"
|
||
msgid "Continue"
|
||
msgstr "Продовжити"
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Побудувати новий проект"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr "Номер побудови"
|
||
|
||
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Скасувати завантаження цього компонету"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Скасувати завантаження модуля"
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Скасувати зміну назви"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Не можу скопіювати компонент верхнього рівня."
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Не можу створити файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Не можу знайти пускач lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Можу змінити тільки клас TComponetns"
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgid "Skip"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Фільтр)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Слідувати за курсором"
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
msgid "%s in %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
msgid "Is a root control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
msgid "Parameters count treating as \"many\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
msgid "Nested procedures count treating as \"many\""
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr "Відцентрувати контрол по горизонталі відносно заданого рівня"
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr "Відцентрувати контрол по вертикалі відносно заданого рівня"
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
msgid "Center form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Центр вікна"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr "Центри"
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
msgid "Preferred Exhibition Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgid "Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Ніколи, тільки вручну"
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "В паузах"
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Оновлювати автоматично"
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "Інше"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Поновити"
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Коли перемикається файл в редакторі коду"
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
msgid "Show observerations about"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Змінити клас"
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
#, fuzzy
|
||
#| msgid "Change parent ..."
|
||
msgid "Change Parent..."
|
||
msgstr "Змінити предка ..."
|
||
|
||
#: lazarusidestrconsts.lischaracter
|
||
msgid "Character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Таблиця символів"
|
||
|
||
#: lazarusidestrconsts.lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr "Перевірити зміни на диску із завантаженням"
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Виберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Виберіть файл компілятора (%s)"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Виберіть файл налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Виберіть модуль Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Виберіть теку коду FPC"
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Виберіть теку Lazarus"
|
||
|
||
#: lazarusidestrconsts.lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Виберіть шлях make"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Виберіть один із цих пунктів для створення нового файлу"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Виберіть один із цих пунктів для створення нового пакунку"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Виберіть один із цих пунктів для створення нового проекту"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Виберіть код програми (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Виберіть структуру для включення в неї виділення"
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "Клас %s%s%s не є зареєстрованим класом компонента.%sНе можу вставити."
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Клас не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Очистити теку"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Очистити підтеки"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Залишати всі текстові файли"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Залишати файли, що відпов. фільтру"
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Видалити файли за фільтром"
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Простий синтаксис (напр., * замість .*)"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Очистити коди Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "Очистити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Параметри LCL, що залежать від інтерфейсу:"
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Параметр"
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Знайдено двозначний файл налаштування компілятора"
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Виклик:"
|
||
|
||
#: lazarusidestrconsts.liscocallonbuild
|
||
msgctxt "lazarusidestrconsts.liscocallonbuild"
|
||
msgid "Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscocalloncompile
|
||
msgctxt "lazarusidestrconsts.liscocalloncompile"
|
||
msgid "Compile"
|
||
msgstr "Компіл."
|
||
|
||
#: lazarusidestrconsts.liscocallonrun
|
||
msgctxt "lazarusidestrconsts.liscocallonrun"
|
||
msgid "Run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sКлацніть ОК, ящко Ви впевнені це зробити"
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
msgid "Code browser"
|
||
msgstr "Браузер коду"
|
||
|
||
#: lazarusidestrconsts.liscodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "за замочуванням (%s)"
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Додати зв'язок"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Додати шлях"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Видалити посилання"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Видалити шлях"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Приклад"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Вставити тег форматування тексту програми"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Вставити тег форматування курсивом"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Вставити тег ремарок"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Вставити тег форматування підкресленням"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Вставити тег форматування для змінних"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr "Наслідуваний"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
msgid "FPDoc editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpnodocumentation
|
||
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
|
||
msgid "(none)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<НІЧОГО>"
|
||
|
||
#: lazarusidestrconsts.liscodehelppathsgroupbox
|
||
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
|
||
msgid "FPDoc files path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpreplacebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
|
||
msgid "Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpsavebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
|
||
msgid "Save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Дивись також"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Короткий"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshowemptymethods
|
||
msgid "Show empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodehelpshowunusedunits
|
||
msgid "Show unused units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add"
|
||
msgstr "Додати"
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Додати шаблон коду"
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Елемент %s%s%s вже існує! "
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
msgid "Auto complete on ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetemplchange
|
||
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
||
msgid "Change"
|
||
msgstr "Змінити"
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Коментар:"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Редагувати шаблони коду"
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Мітка:"
|
||
|
||
#: lazarusidestrconsts.liscodetools
|
||
msgid "CodeTools"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Дія: %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Автостворювані елементи не можуть ані редагуватись,%s ані вміщувати неавтостворювані дочірні елементи"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, автоматично створене"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "Автостворювані елементи не можуть редагуватись."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Заблокувати"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Редактор Визначень Інструменів Коду"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Перегляд налаштувань Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr "шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Перетворення елементу"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Створити означення для %s Теки"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Створити означення для компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Створити визначення для текстів програми Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Створити означення для теки Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Створити означення для %s Проекту"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Створити макроси FPC і шляхи до тек проекту FPC"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Визначає рекурсивно"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Видалити вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s, %sде Borland встановив всі коди %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s, %sде Borland встановив всі коди %s,використані проектом %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Опис:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "тека %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsedit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Інакше"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Помилка читання %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Помилка читання файлу відомостей проекту %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Помилка запису %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Помилка запису проекту в файл %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexit
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Вихід без збереження"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Тека програм FPC SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Тека"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Вставити шаблон компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Вставити шаблон проекту FreePascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Вставте шаблон Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Вставити шаблон з теки Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Вставити шаблон проекту Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Вставити шаблон з теки Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Вставити елемент як дочірній"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Вставити елемент нижче"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Вставити шаблон"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Неправильний предок"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Неправильний елемент предка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Неправильний попередній елемент"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив всі %s коди.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив %s коди,%sякі використовують цей %s проект.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Тека Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Пересунути вузол вниз"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Пересунути вузол на один рівень нижче"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Пересунути вузол на один рівень вище"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Пересунути вузол вверх"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Новий вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Вузол і його нащадки правильні лише для поточного проекту"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Вузол лише для читання"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "нічого не вибрано"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Елемент предка не може вміщувати дочірніх."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Попередній елемент не може вміщувати дочірніх."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "Тека проекту %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Зберегти і вийти"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Виділити елемент:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr "Тека текстів Free Pascal SVN. Не обов'язково. Це покращить пошук декларацій при налагоджуванні."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Тека проекту FreePascal."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "Тека текстів Free Pascal SVN."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "Головна тека Lazarus."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Шлях до компілятора FreePascal.%s Наприклад, %s/usr/bin%s -n%s або %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Шлях до компілятора проекту free pascal. Потрібно лише, якщо Ви встановлюєте нижче програму FPC SVN. Використовується для автостворювання макросів."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "Тека %s проекту,%sщо вміщує файли .dpr, dpk."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Зняти визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Зняти визначення зі всіх"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Рекурсивно зняти визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Значення як текст"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Змінна:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "Біля"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Колонка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Кома"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Ключове слово"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "Новий рядок"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Номер"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsok
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Крапка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Крапка з комою"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr "Пробіл"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Рядкова конст."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Виконати після"
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Виконати перед"
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Колапс всіх класів"
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Колапс всіх пакетів"
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Колапс всіх модулів"
|
||
|
||
#: lazarusidestrconsts.liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Команда після"
|
||
|
||
#: lazarusidestrconsts.liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Некоректна команда \"після\" "
|
||
|
||
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Команда після установки модуля"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Параметри командного рядка програми"
|
||
|
||
#: lazarusidestrconsts.liscomments
|
||
msgid "Comments:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompany
|
||
msgid "Company:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr "Компіляція IDE (без побудови)"
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Компілятор"
|
||
|
||
#: lazarusidestrconsts.liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Помилка компілятора"
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Помилка: неправильний компілятор:%s"
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr "Довідка: Ви можете задати шлях до компілятора в Оточенні->Параметри оточення->Файли->Шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "ЗАУВАЖЕННЯ:не знайдено конфігураційного файлу до codetools - працюю за замовчуванням "
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "ЗАУВАЖЕННЯ:завантажую старий файл з налаштуваннями codetools"
|
||
|
||
#: lazarusidestrconsts.liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Параметри компілятора для проекту: %s"
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (компілюю ...)"
|
||
|
||
#: lazarusidestrconsts.liscomponent
|
||
msgid "Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Назву компонента %s%s%s зарезервовано"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Назва компонента %s%s%s є некоректним ідентифікатором"
|
||
|
||
#: lazarusidestrconsts.liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Знайти компонент"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Відкриття пакунку"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Відкрити модуль"
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
#, fuzzy
|
||
#| msgid "Test"
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr "Тест"
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Тека конфігурації Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Налаштувати Побудову %s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Підтвердити зміни"
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr "Перебудувати Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr "вміщує"
|
||
|
||
#: lazarusidestrconsts.liscontinue
|
||
msgctxt "lazarusidestrconsts.liscontinue"
|
||
msgid "Continue"
|
||
msgstr "Продовжити"
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Продовжити без завантаження форми"
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Учасники"
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Елемент управління вимагає \"предка\""
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Помилка перетворення"
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
msgid "Convert encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyall
|
||
msgid "Copy All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr "Копіювати всі і приховані повідомлення в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr "Копіювати всі повідомлення в буфер"
|
||
|
||
#: lazarusidestrconsts.liscopyalloutputclipboard
|
||
msgid "Copy all output to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Помилка при копіюванні"
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Помилка копіювання"
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
msgid "Copy %s%s%s to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "Копіювання всієї форми не реалізоване."
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Пошук повідомлень FPC"
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Пошук повідомлень Make"
|
||
|
||
#: lazarusidestrconsts.liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Показувати всі повідомлення"
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr "Пропустити виклик компілятора"
|
||
|
||
#: lazarusidestrconsts.liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Специфічні параметри ОС"
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
msgid "Could not add %s{$I %s%s} to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
msgid "Could not add %s{$R %s%s} to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
msgid "Could not add %s%s%s to main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
||
msgid "Could not remove %s%s%s from main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
msgid "Could not remove %s{$I %s%s} from main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
msgid "Could not remove %s{$R %s%s} from main source!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscovarious
|
||
msgid "%s (various)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Увага: додатковий файл налаштувань компілятора має ту ж саму назву, як може називатись один із стандартних файлів налаштувань компілятора FreePascal. Це призведе до використання додаткового файлу і пропуску стандартного."
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Відкрити Пакунок %s"
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Відкрити Модуль %s"
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Спочатку створіть проект!"
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscreatenewproject
|
||
msgid "Create new project"
|
||
msgstr "Створити новий проект"
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Параметри тек Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Визначення шаблонів"
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<Не вибрано змінних>"
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Відкрити попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Інструменти"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Змінна: %s"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Назва змінної"
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Шаблони"
|
||
|
||
#: lazarusidestrconsts.lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr "Вставити макрос"
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "виберіть будь-ласка макрос"
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Вибрати Код Макросу"
|
||
|
||
#: lazarusidestrconsts.liscurrent
|
||
msgid "Current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Колонка курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Рядок курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "параметри користувача"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Спеціальні параметри"
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Спеціальна програма"
|
||
|
||
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr "Спеціальна програма%sПрограма мовою FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Налагоджувач не визначений"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Встановити точку зупину за будь-яких обставин"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Не вказаний Debugger.%sВстановлені точки зупину не будуть задіяні до тих пір поки не буде встановлений Debugger в меню опцій діалогу з debugger."
|
||
|
||
#: lazarusidestrconsts.lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Помилка налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Помилка налагоджувача%sОпа! Налагоджувач знаходиться в неробочому стані%sЗбережіть работу!%sНатисніть Стоп і сподівайтесь на краще!"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Неправильний налагоджувач"
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (йде налагодження ...)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Додатковий пошуковий шлях"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Точка зупину"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Очищувати log при виконанні"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Загальні опції налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Специфічні опції налагоджувача (залежить від його типу)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgid "Event Log"
|
||
msgstr "Лог-файл подій"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Належить "
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Належить Налагоджувачу"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Належить Програмі"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ігнорувати ці вирази"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrminterface
|
||
msgid "Interface"
|
||
msgstr "Інтерфейс"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Мовні розширення"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr "Обмеження лічильнику рядків до"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Lazarus Exceptions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Розширення ОС"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Виведення"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Процес"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Відновити"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Відновити за Handler`ом"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Відновити Unhandled"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Показувати повідомлення зверху"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Сигнали"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Програмний канал"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
|
||
msgid "Window"
|
||
msgstr "Вікно"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Не можу завантажити файл"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Не можу завантажити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdecimal
|
||
msgid "Decimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdefaultvalue
|
||
msgid "Default value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Видалити всі ці файли?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Видалити файл з неоднозначною назвою?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpoint
|
||
msgid "Delete Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletebuildvar
|
||
msgid "Delete build variable %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Видалення файлу не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Видалити старий файл %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
msgid "Delete value %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "Видалення файлу %s%s%s не вдалося."
|
||
|
||
#: lazarusidestrconsts.lisdelphi
|
||
msgid "Delphi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Проект Delphi"
|
||
|
||
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Вже є інший компонент з такою назвою %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Тека призначення"
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "Тека %s%s%s є некоректною %sВиберіть шлях до компілятора."
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Без урахування регістру"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ігнорувати дод./видал. порожніх рядків"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ігнор. різні заверш. рядків (напр., #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ігнорувати кількість пробілів"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ігнор. пробіли (без CR)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ігнорувати пробіли в кінці рядка"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ігнорувати пробіли на початку рядка"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Тільки вибране"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Відкрити різницю в редакторі"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Текст1"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Текст2"
|
||
|
||
#: lazarusidestrconsts.lisdigits
|
||
msgid "Digits:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
msgid "Directory %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisablebreakpoint
|
||
msgid "Disable Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisabled
|
||
msgid "Disabled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdisablegroup
|
||
msgid "Disable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Відкинути зміни"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "Змінені файли:"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Виберіть один з елементів вище, щоб побачити різницю"
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Помилка читання файлу: %s"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ігнорувати зміни на диску"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Перезавантажити з диска"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Деякі файли змінені на диску:"
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Розрізняти регістр букв, наприклад, А і а"
|
||
|
||
#: lazarusidestrconsts.lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Редактор документації"
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
msgid "%s does not exists: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Не закривати IDE"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Не закривати проект"
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Не показувати заставки"
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Копіювати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Вирізати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Пересунути на один компонент назад"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Пересунути на один компонент вперед"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Пересунути компонент в кінець"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Пересунути компонент наперед"
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Вставити вибрані компоненти з буфера"
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Виділити компонент-предок"
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
msgid "Duplicate found of value %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Дублювання назви: Компонет з назвою %s%s%s вже існує і в успадкованому компоненті %s"
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr "Вибрати схему"
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Всі пакунки"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Поточний проект"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Тека поточного проекту"
|
||
|
||
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Додавання загального шляху до текстів програм"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Шлях до файлів проекту"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "Шлях до кодів проекту"
|
||
|
||
#: lazarusidestrconsts.lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "Шлях до модулів проекту"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Всі проекти"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "встановити режим FPC в DELPHI"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "встановити режим FPC в GPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "встановити режим FPC в TP"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "ввімкнути IOCHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "ввімкнути OVERFLOWCHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "ввімкнути RANGECHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "використовувати модуль HeapTrc"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "використовувати LineInfo"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolalt
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Нормальний інструмент обов'язково має мати заголовок і назву файлу."
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolctrl
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Інструмент правки"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolinsert
|
||
msgid "Insert"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgid "Key"
|
||
msgstr "Ключ"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Макроси"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Назва файлу програми:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Пошук повідомлень компілятора FreePascal в виведенні"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Пошук повідомлень make в виведенні"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolshift
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Необхідний заголовок і назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Робоча тека:"
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgid "All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableall
|
||
msgid "&Enable All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenablebreakpoint
|
||
msgid "Enable Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenabled
|
||
msgctxt "lazarusidestrconsts.lisenabled"
|
||
msgid "Enabled"
|
||
msgstr "Доступний"
|
||
|
||
#: lazarusidestrconsts.lisenablegroup
|
||
msgid "Enable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Макрос доступний"
|
||
|
||
#: lazarusidestrconsts.lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Задужкувати"
|
||
|
||
#: lazarusidestrconsts.lisencloseselection
|
||
msgctxt "lazarusidestrconsts.lisencloseselection"
|
||
msgid "Enclose Selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Введіть мову перекладу"
|
||
|
||
#: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr "Перехід за подвійним клацанням на повідомленнях (інакше - за одинарним)"
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Теки не існує"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Не знайдена тека кодів FPC \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Некоректна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "Файл компілятора \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Некоректна назва файлу налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Файл налагоджувача \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "Тека lazarus \"%s\" виглядає некоректною. Як правило вона вміщує теки lcl, debugger, designer, components, ... ."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Неправильна назва файлу make"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "Файл make \"%s\" не є виконуваним файлом."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Не знайдена тека Lazarus \"%s\" "
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Теки проб \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "Нотатка: наразі підтримуються тільки абсолютні шляхи"
|
||
|
||
#: lazarusidestrconsts.liseotabwidths
|
||
msgctxt "lazarusidestrconsts.liseotabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Ширина табулятора"
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Направильна опція в позиції %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "Опція в позиції %d на дозволяє використовувати аргумент %s"
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "Опція в позиції %d потребує аргумент %s"
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr "Помилка: "
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Помилка створення файлу"
|
||
|
||
#: lazarusidestrconsts.liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Помилка створення lrs"
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Помилка видалення файлу"
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Помилка в %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Помилка ініціалізації програми %s%s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Помилка переміщення компонента"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Помилка переміщення компонента %s:%s"
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Помилка аналізу потоку lfm компонента"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Помилка читання списку пакунків з файлу%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Помилка перейменування файлу"
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "Помилки"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Помилка запису списку пакунків в файл%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisevalexpression
|
||
msgid "Eval expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisevaluate
|
||
msgid "E&valuate"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
msgid "Every n-th line number:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexamples
|
||
msgid "Examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexceptiondialog
|
||
msgid "Debugger Exception Notification"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr "Фільтр для виключення"
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter2
|
||
msgid "Exclude filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Виконати команду після"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Виконати команду до"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Виконання зупинене"
|
||
|
||
#: lazarusidestrconsts.lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Виконання зупинене%s Адреса: %s%s Процедура: %s%s Файл: %s%s(Коли-небудь тут з'явиться вікно асемблера :)%s"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Виконання завершене"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstoppedon
|
||
msgid "Execution stopped%s"
|
||
msgstr "Виконання завершене %s"
|
||
|
||
#: lazarusidestrconsts.lisexeprograms
|
||
msgid "Programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Розширити всі класи"
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Розширити всі пакети"
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Розширити всі модулі"
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Повна назва файлу в поточному редакторі"
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
msgid "Export ..."
|
||
msgstr "Експорт ..."
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Список експорту"
|
||
|
||
#: lazarusidestrconsts.lisexpression
|
||
msgid "Expression:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Розширити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "Здобути"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr "Зовнішні інстументи"
|
||
|
||
#: lazarusidestrconsts.lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "Не вдалося запустити інструмент"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Досягнуто максимуму інструментів"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmovedown
|
||
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmoveup
|
||
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: lazarusidestrconsts.lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Припускається максимум %s інструментів."
|
||
|
||
#: lazarusidestrconsts.lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Не можу запустити інструмент %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Обмежити мал. дизайнера"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Малювати елементи дизайну тільки в паузах (зменшує навантаження на повільних машинах)"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Файл %s%s%s%sне схожий на текстовий.%sВсе одно відкрити?"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Файл %s%s%s%sне схожий на текстовий.%sВсе одно відкрити?"
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "У файл не можна писати"
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Файл %s%s%s є віртуальним."
|
||
|
||
#: lazarusidestrconsts.lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Файл не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "Не знайдений файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "Не знайдений файл %s%s%s.%sСтворити його?%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Файл не в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Не текстовий файл"
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
msgid "File Settings ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "файл, куди буде записуватись налагоджувальна інформація. Якщо не вказан., налагоджувальна інформація виводиться в консоль."
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr "Фільтр"
|
||
|
||
#: lazarusidestrconsts.lisfilter2
|
||
msgid "(filter)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilecasesensitive
|
||
msgid "&Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Параметри тек"
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr "Маска файлу (*;*.*;*.bak?)"
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr "Включити підтеки"
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Тільки текстові файли"
|
||
|
||
#: lazarusidestrconsts.lisfindfileregularexpressions
|
||
msgid "&Regular expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr "Шукати текст:"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Де"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Виправити файл LFM"
|
||
|
||
#: lazarusidestrconsts.lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Розпочати зміну назв"
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Помилка формату"
|
||
|
||
#: lazarusidestrconsts.lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Помилка завантаження форми"
|
||
|
||
#: lazarusidestrconsts.lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcomponents
|
||
msgctxt "lazarusidestrconsts.lisfpcomponents"
|
||
msgid "Components"
|
||
msgstr "Коментарі"
|
||
|
||
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Помилка теки кодів FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr "Знайти компонент палітри"
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Компілятор FreePascal не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr "Тека кодів FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr "Файл коду Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Не знайдено коди FreePascal"
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Додаткові файли для пошуку (напр. /path/*.pas;/path2/*.pp)"
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Знайти або змінити назву ID"
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Знайти посилання"
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Ідентифікатор: %s"
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "у всіх відкритих пакунках і проектах"
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "в поточному модулі"
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "в головному проекті"
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "в проекті/пакунку, що вміщує цей модуль"
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Некоректний ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisfrirename
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Перейменувати всі посилання"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Перейменувати в"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Шукати також і в коментарях"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Шукати де"
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgid "Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Коментар заголовка для класу"
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Селектор довідки"
|
||
|
||
#: lazarusidestrconsts.lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr "Довідка до повідомлень Компілятора FreePascal"
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintopen
|
||
msgctxt "lazarusidestrconsts.lishintopen"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: lazarusidestrconsts.lishintpause
|
||
msgctxt "lazarusidestrconsts.lishintpause"
|
||
msgid "Pause"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintrun
|
||
msgctxt "lazarusidestrconsts.lishintrun"
|
||
msgid "Run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintsave
|
||
msgctxt "lazarusidestrconsts.lishintsave"
|
||
msgid "Save"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts.lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "На крок із входом"
|
||
|
||
#: lazarusidestrconsts.lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "На крок в обхід"
|
||
|
||
#: lazarusidestrconsts.lishintstop
|
||
msgctxt "lazarusidestrconsts.lishintstop"
|
||
msgid "Stop"
|
||
msgstr "Завершити"
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть вираз і спробуйте спочатку."
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть тільки рядковий вираз і спробуйте спочатку."
|
||
|
||
#: lazarusidestrconsts.lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.lishitcount
|
||
msgid "Hitcount"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Бази даних"
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Параметри довідки"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Властивості:"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Переглядачі"
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "HTML шлях до FPC документації"
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Горизонтальний"
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisideintf
|
||
msgid "IDE Interface"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "Ідентифікатор починається з ..."
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "Ідентифікатор вміщує ..."
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Параметри IDE:"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Помилка доступу до xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Помилка доступу до xml-файлу %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Помилка завантаження xml"
|
||
|
||
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Помилка завантаження xlm-файлу %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Експортований файл існує"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Експортований файл %s%s%s існує.%sВідкрити файл і замінити тільки налаштування компілятора?%s(Решта налаштувань буде збережена.)"
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Завантажити з файла"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Відкрити або Завантажити Опції Компілятора"
|
||
|
||
#: lazarusidestrconsts.lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Відкрити нещодавні"
|
||
|
||
#: lazarusidestrconsts.lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Недавні файли"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Зберегти в файл"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Зберегти в нещодавні"
|
||
|
||
#: lazarusidestrconsts.lisifdok
|
||
msgctxt "lazarusidestrconsts.lisifdok"
|
||
msgid "OK"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ігнорувати двійкові"
|
||
|
||
#: lazarusidestrconsts.lisignoreexceptiontype
|
||
msgid "Ignore this exception type"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ігнорувати пропущений файл"
|
||
|
||
#: lazarusidestrconsts.lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ігнорувати, використовувати TForm як предка"
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Список імпорту"
|
||
|
||
#: lazarusidestrconsts.lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr "Фільтр для вибору"
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr "шлях доданих файлів"
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Шляхи до під'єднуваних файлів"
|
||
|
||
#: lazarusidestrconsts.lisindex
|
||
msgid "Index"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildabort
|
||
msgid "Aborted..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildbuild
|
||
msgctxt "lazarusidestrconsts.lisinfobuildbuild"
|
||
msgid "Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildcomplile
|
||
msgid "Compiling..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderror
|
||
msgid "Error..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildlines
|
||
msgctxt "lazarusidestrconsts.lisinfobuildlines"
|
||
msgid "Lines:"
|
||
msgstr "Рядків"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildmakeabort
|
||
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
|
||
msgid "Abort"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts.lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildsuccess
|
||
msgid "Success..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Інформація про %s"
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
msgid "In front of related"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheritedcomponent
|
||
msgid "Inherited Component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag
|
||
msgid "Insert PrintShort tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
msgid "Insert time. Optional: format string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspect
|
||
msgid "&Inspect"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectdata
|
||
msgid "Data"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectdialog
|
||
msgid "Debug Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectmethods
|
||
msgid "Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinspectproperties
|
||
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
||
msgid "Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Встановлення не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr "Встановлені пакунки"
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Встановити вибране"
|
||
|
||
#: lazarusidestrconsts.lisinternalname
|
||
msgid "Internal Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidbuildvarthebuildvarmustbeapascalidentifie
|
||
msgid "Invalid build variable %s%s%s. The build variable must be a pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidcircle
|
||
msgid "Invalid circle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Неправильна команда"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Неприпустиме видалення"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Неправильна тека призначення"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Неправильний вираз.%sДовідка: функція \"Створити Рядок Ресурсів\" вимагає рядкової константи в одному файлі. Виділіть вираз і спробуйте ще."
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Неправильна тека кодів FPC"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Неправильний множинний вибір"
|
||
|
||
#: lazarusidestrconsts.lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Некоректний ідентифікатор паскаля"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "Слово \"%s\" є неправильним ідентифікатором мови паскаль."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Неправильна назва проц."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Неправильна назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Неправильне виділення"
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s вже є частиною проекту."
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s є некоректною назвою проекту.%s Виберіть іншу (напр., project1.lpi)"
|
||
|
||
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisjitform
|
||
msgid "JIT Form"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Залишати назву"
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Залишити їх і продовжити"
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Спеціальні команди"
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Команди дизайнера"
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Команди Інспектора об'єктів"
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Перервати побудову"
|
||
|
||
#: lazarusidestrconsts.liskmaddactiveunittoproject
|
||
msgid "Add active unit to project"
|
||
msgstr "Додати активний модуль до проекту"
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Додати спостереження"
|
||
|
||
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
|
||
msgid "Build all files of project/program"
|
||
msgstr "Побудувати всі файли проекту/програми"
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Побудувати проект/програму"
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Класичний"
|
||
|
||
#: lazarusidestrconsts.liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Очистити Все"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Закрити проект"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsoptions
|
||
msgid "CodeTools options"
|
||
msgstr "Опції інструментів коду"
|
||
|
||
#: lazarusidestrconsts.liskmcompileroptions
|
||
msgid "Compiler options"
|
||
msgstr "Опції компілятора"
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Налаштувати %sBuild File%s"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
msgid "Configure custom components"
|
||
msgstr "Налаштувати нетипові компонети"
|
||
|
||
#: lazarusidestrconsts.liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Налаштувати Поміч"
|
||
|
||
#: lazarusidestrconsts.liskmconfigureinstalledpackages
|
||
msgid "Configure installed packages"
|
||
msgstr "Налаштувати встановлені пакети"
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Чутліва до тексту допомога"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Перетворення пакунку Delphi в пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi project to Lazarus project"
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi unit to Lazarus unit"
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM file to LFM"
|
||
msgstr "Перетворення файлу DFM в LFM"
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Копіювати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Вирізати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Видалення останнього символу"
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
msgid "Diff editor files"
|
||
msgstr "Порівняти файли кодів"
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Редагувати Коди Шаблонів"
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Редагувати контекстно-чутливої Допомоги"
|
||
|
||
#: lazarusidestrconsts.liskmeditoroptions
|
||
msgctxt "lazarusidestrconsts.liskmeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Налаштування редактора"
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
msgid "Enclose selection"
|
||
msgstr "Задужкувати віділене"
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Обчислити/Змінити"
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Налаштування Зовнішніх інструментів"
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
msgid "Find incremental"
|
||
msgstr "Знайти за зростанням"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Перейти до маркера 0"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Перейти до маркера 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Перейти до маркера 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Перейти до маркера 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Перейти до маркера 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Перейти до маркера 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Перейти до маркера 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Перейти до маркера 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Перейти до маркера 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Перейти до маркера 9"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Перейти до редактора коду 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Перейти до редактора коду 10"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Перейти до редактора коду 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Перейти до редактора коду 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Перейти до редактора коду 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Перейти до редактора коду 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Перейти до редактора коду 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Перейти до редактора коду 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Перейти до редактора коду 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Перейти до редактора коду 9"
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Вставити дату і час"
|
||
|
||
#: lazarusidestrconsts.liskminsertifdef
|
||
msgid "Insert $IFDEF"
|
||
msgstr "Вставити $IFDEF"
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Вставити назву користувача"
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Перевірити"
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Схема розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus (default)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "Mac OS X (Apple style)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "Mac OS X (Lazarus style)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Новий проект"
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Новий проект з файлу"
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Відкриття файлу пакунку"
|
||
|
||
#: lazarusidestrconsts.liskmpackagegraph
|
||
msgid "Package graph"
|
||
msgstr "Пакунок графіки"
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Вставити Компоненти з буферу обміну"
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Зупинити програму"
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Опублікувати проект"
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
|
||
msgid "Remove active unit from project"
|
||
msgstr "Видалити активний модуль з проекту"
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Виконати програму"
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "ЗберегтиВсе"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "ЗберегтиЯк"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Зберегти проект як"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
msgid "Select line end"
|
||
msgstr "Виділити до кінця стрічки"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
msgid "Select line start"
|
||
msgstr "Виділити до початку стрічки"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
msgid "Select page bottom"
|
||
msgstr "Виділити до кінця сторінки"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
msgid "Select page top"
|
||
msgstr "Виділити до початку стрінки"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
msgid "Select word left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
msgid "Select word right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Встановити Закладку на дереві"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Встановити маркер 0"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Встановити маркер 1"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Встановити маркер 2"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Встановити маркер 3"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Встановити маркер 4"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Встановити маркер 5"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Встановити маркер 6"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Встановити маркер 7"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Встановити маркер 8"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Встановити маркер 9"
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
msgid "Stop program"
|
||
msgstr "Завершити програму"
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Перемкнути між модулем і формою"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle marker 0"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle marker 1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle marker 2"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle marker 3"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle marker 4"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle marker 5"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle marker 6"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle marker 7"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle marker 8"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle marker 9"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr "Перемкнути до перегляду Точок Зупину"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr "Перемкнути до перегляду Стеку"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Перемкнути до перегляду Коду Explorer"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
msgid "Toggle view component palette"
|
||
msgstr "Перемкнути до перегляду палітри компонетів"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr "Перемкнути до перегляду повідомлень Налагоджувача"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Перемкнути до перегляду Документації Редактора"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Перемкнути до перегляду гарячих клавіш графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr "Перемкнути до перегляду Локальних Змінних"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Перемкнути до перегляду Повідомлень"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Перемкнути до перегляду Інспектора Об'єктів"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Перемкнути до перегляду Результатів Пошуку"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Перемкнути до перегляду Редактора програмного Коду"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr "Перемкнути до перегляду Спостережень"
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Переглянути історію переходів"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Переглядання опцій проекту"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
msgid "View project source"
|
||
msgstr "Переглядання тексту проекту"
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Переглянути Інформацію про Модулі"
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Виконувана програма є неправильною"
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Командний рядок виконуваної програми"
|
||
|
||
#: lazarusidestrconsts.lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Налаштування стільниці Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Тека Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Не знайдена тека Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr "Файл Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "Форма Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "Графічна оболонка Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Lazarus-файли, що включаються"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Мова графічної оболонки Lazarus (напр. en, uk, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Назва мови для Lazarus (напр. english, deutsch, ukrainain)"
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [параметри] <назва файлу проекту>"
|
||
|
||
#: lazarusidestrconsts.lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "Пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "Проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "Файл Info проекту Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "Текст проекту Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "Модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusversionstring
|
||
msgid "%s beta"
|
||
msgstr "%s бета"
|
||
|
||
#: lazarusidestrconsts.lislazbuildaboaction
|
||
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildabopart
|
||
msgid "Part"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
|
||
msgid "Advanced Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuild
|
||
msgctxt "lazarusidestrconsts.lislazbuildbuild"
|
||
msgid "Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Побудувати CodeTools"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildexamples
|
||
msgid "Build examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Побудувати IDE"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Побудувати JITForm"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildoptions
|
||
msgid "Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Побудувати SynEdit"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcancel
|
||
msgctxt "lazarusidestrconsts.lislazbuildcancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr "Очистити всі"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr "Очистити+Побудувати"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
msgid "Confirm before rebuilding Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Помилка запису файлу"
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr "Інтерфейс LCL"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnone
|
||
msgctxt "lazarusidestrconsts.lislazbuildnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.lislazbuildok
|
||
msgctxt "lazarusidestrconsts.lislazbuildok"
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqboapplcltarget
|
||
msgid "Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildall
|
||
msgid "Build All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
|
||
msgid "Build IDE without Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
|
||
msgid "Build IDE with Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildlcl
|
||
msgid "Build LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbobuildother
|
||
msgctxt "lazarusidestrconsts.lislazbuildqbobuildother"
|
||
msgid "Other"
|
||
msgstr "Інше"
|
||
|
||
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
|
||
msgid "Clean Up + Build all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildquickbuildoptions
|
||
msgid "Quick Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
msgid "Restart after successful Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr "Зберегти налаштування"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "Для ЦП"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "Для ОС:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislazbuildwithstaticpackages
|
||
msgid "With packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislcl
|
||
msgid "LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr "Втрачено шлях до LCL-модуля"
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr "Тип LCL Widget"
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Копіювати з усадкованого"
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Пересунути включення до успадкованого"
|
||
|
||
#: lazarusidestrconsts.lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Залишаю порожнім для po-файлу за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого ліва сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Ліві сторони"
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Лівий простір еквівалентно"
|
||
|
||
#: lazarusidestrconsts.lislegaltrademarks
|
||
msgid "Legal Trademarks:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgid "Levels"
|
||
msgstr "Рівні"
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "LFM файл"
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Зламався файл LFM"
|
||
|
||
#: lazarusidestrconsts.lislfmfilenotfound
|
||
msgid "LFM file not found"
|
||
msgstr "Не знайдено LFM файлу"
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr "шлях до бібліотек"
|
||
|
||
#: lazarusidestrconsts.lisline
|
||
msgid "Line:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislinelength
|
||
msgid "Line/Length"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "параметри компонувальника"
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislocals
|
||
msgid "Locals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgname
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgname"
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgvalue
|
||
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: lazarusidestrconsts.lislogmessage
|
||
msgid "Log message"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislogo
|
||
msgid "Logo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Введіть дані"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Введіть параметри запуску"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr "Головний модуль має програму. Створити оператори форми "
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr "Головний модуль має програму. Заголовні оператори"
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr "Головний модуль має секцію Uses, що вміщує всі модулі проекту."
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Створити виконуваний"
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "Make не знайдений"
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Додати до розділу"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "Рядок ресурсів %s%s%s вже існує. %sВиберіть іншу назву. %s Використовуйте Пропуск, щоб додати в будь-якому випадку."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Параметри перетворення"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Спеціальний індентифікатор"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Довжина ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Префікс ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Вставити за алфавітом"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Вставити з врахуванням контексту"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Неправильна секція Resourcestring"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Рядок ресурсів вже існує"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Секція Resourcestring:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Переглядання коду"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Рядкова константа в коді"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Рядки з тим же значенням:"
|
||
|
||
#: lazarusidestrconsts.lismaxs
|
||
msgid "Max %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Перервати збирання"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr "Точка зупину в коді"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr "Додати точку зупину"
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "Додати активний модуль до проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "Додати точку переходу до історії"
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "Додати файл редактора до проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr "Додати спостереження..."
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenubuild
|
||
msgctxt "lazarusidestrconsts.lismenubuild"
|
||
msgid "Build"
|
||
msgstr "Побудувати"
|
||
|
||
#: lazarusidestrconsts.lismenubuildall
|
||
msgid "Build all"
|
||
msgstr "Побудувати всі"
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Побудувати файл"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Побудувати Lazarus"
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr "Перевірити файл LFM в редакторі"
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr "Очистити теку ..."
|
||
|
||
#: lazarusidestrconsts.lismenuclose
|
||
msgctxt "lazarusidestrconsts.lismenuclose"
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
#, fuzzy
|
||
#| msgid "Close all editor files"
|
||
msgid "Close a&ll editor files"
|
||
msgstr "Закрити всі файли редактора"
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Закрити Проект"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr "Редактор визначень Інструментів Коду ..."
|
||
|
||
#: lazarusidestrconsts.lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Зібрати .po файли"
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr "Перевести в коментар"
|
||
|
||
#: lazarusidestrconsts.lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Параметри компілятора ..."
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts.lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr "Вставити $IFDEF..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Налаштувати Побудову+Виконання Файлу ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr "Налаштувати компоненти користувача ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
msgid "Configure external tools ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Налаштувати \"Побудову Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Налаштувати Довідку ..."
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Довідка, що залежить від контексту"
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr "Перетворення пакунку Delphi в пакунок Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
msgid "Convert DFM file to LFM ..."
|
||
msgstr "Перетворення DFM в LFM ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
msgid "Convert encoding of projects/packages ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucopy
|
||
msgctxt "lazarusidestrconsts.lismenucopy"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts.lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Створити файли .po"
|
||
|
||
#: lazarusidestrconsts.lismenucut
|
||
msgctxt "lazarusidestrconsts.lismenucut"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr "Вікно налагоджувача..."
|
||
|
||
#: lazarusidestrconsts.lismenudiff
|
||
msgctxt "lazarusidestrconsts.lismenudiff"
|
||
msgid "Diff"
|
||
msgstr "Порівнянти"
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Правка"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Кодові шаблони ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Редагувати контекстно-чутливої Допомоги"
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr "Налаштувати встановлені пакунки ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorcancel
|
||
msgctxt "lazarusidestrconsts.lismenueditorcancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Створити підменю"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr "Видалити шаблон форми"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Вилучити елемент"
|
||
|
||
#: lazarusidestrconsts.lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr "Вставити шаблон форми..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Вставити новий пункт (після)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Вставити новий пункт (перед)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Редактор меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Пересунути вниз (або вправо)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Пересунути вгору (або вліво)"
|
||
|
||
#: lazarusidestrconsts.lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr "Новий опис шаблону "
|
||
|
||
#: lazarusidestrconsts.lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr "Зберегти як шаблон..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Вибрати меню:"
|
||
|
||
#: lazarusidestrconsts.lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Вибрати шаблон:"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Переглядання шаблону"
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr "Задужкувати виділення в ..."
|
||
|
||
#: lazarusidestrconsts.lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr "&Оточення"
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr "Обчислити/Змінити..."
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr "Здобути процедуру ..."
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr "Знайти інший кінець блоку коду"
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr "Знайти початок блоку коду"
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr "Знайти опис під курсором"
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Знайти посилання на ідентифікатор ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr "&Пошук у файлах ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Шукати &далі"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Знайти &попередній"
|
||
|
||
#: lazarusidestrconsts.lismenufpdoceditor
|
||
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr "Перейти за директивою $I"
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr "Перейти до рядка ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr "Виправити невідповідність IFDEF/ENDIF"
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr "Виправити незакінчений блок"
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Довідка"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
msgid "IDE internals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Пошук за зростанням"
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr "Зсунути вправо виділене"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr "Елемент ChangeLog"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr "Вставити з таблиці символів"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr "Ключ CVS"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr "Поточні дата і час"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "General"
|
||
msgstr "Загальне"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr "Примітки GPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr "Зауваження LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL notice"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr "Вставити текст"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr "Поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr "Слідкувати за ..."
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr "Перейти назад"
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr "Перейти вперед"
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Перейти до"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr "Перейти до наст. закладки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr "Перехід до наст. помилки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr "Перейти до попер. закладки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr "Перейти до попер. помилки"
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr "Вибір в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Створити рядок ресурсу ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Нова форма"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Новий..."
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
msgid "New package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Новий проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr "Новий проект з файлу ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "Новий модуль"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Мережева довідка"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
#, fuzzy
|
||
#| msgid "Open ..."
|
||
msgid "&Open ..."
|
||
msgstr "Відкрити ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr "Відкрити назву файлу над курсором"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr "Відкриваю завантажений пакунок ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr "Відкриття файлу пакунку (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr "Відкрити пакунок поточного модуля"
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Відкрити проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
#, fuzzy
|
||
#| msgid "Open Recent ..."
|
||
msgid "Open &Recent ..."
|
||
msgstr "Відкрити нещодавні ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr "Відкрити попередній пакунок ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr "Відкрити останній проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
msgid "&Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr "Пакунок Graph ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
msgid "Package links ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenupaste
|
||
msgctxt "lazarusidestrconsts.lismenupaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lismenupause
|
||
msgctxt "lazarusidestrconsts.lismenupause"
|
||
msgid "Pause"
|
||
msgstr "Пауза"
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Проект"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Параметри проекту ..."
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "Run"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Опублікувати проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr "Швидка компіляція"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr "Швидка перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuquit
|
||
#, fuzzy
|
||
#| msgid "Quit"
|
||
msgid "&Quit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts.lismenuredo
|
||
msgctxt "lazarusidestrconsts.lismenuredo"
|
||
msgid "Redo"
|
||
msgstr "Повернути"
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Прибрати з проекту ..."
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Перейменувати ID ..."
|
||
|
||
#: lazarusidestrconsts.lismenureplace
|
||
msgctxt "lazarusidestrconsts.lismenureplace"
|
||
msgid "Replace"
|
||
msgstr "Заміна"
|
||
|
||
#: lazarusidestrconsts.lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
msgid "Reporting a bug..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr "Переглянути теку кодів FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr "Скидання налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Перезапуск"
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Зворотній експорт"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgid "&Run"
|
||
msgstr "&Виконати"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Виконати файл"
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr "Параметри виконання ..."
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr "Виконати до курсора"
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
#, fuzzy
|
||
#| msgid "Save"
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: lazarusidestrconsts.lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
#, fuzzy
|
||
#| msgid "Save As ..."
|
||
msgid "Save &As ..."
|
||
msgstr "Зберегти як ..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Зберегти проект як ..."
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "П&ошук"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "Виділити"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
msgid "Select all"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr "Виділити блок коду"
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
msgid "Select line"
|
||
msgstr "Виділити рядок"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr "Виділити абзац"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr "Виділити до дужки"
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
msgid "Select word"
|
||
msgstr "Виділити слово"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr "Встановити вільну закладку"
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr "Сортування вибраного ..."
|
||
|
||
#: lazarusidestrconsts.lismenustepinto
|
||
msgid "Step into"
|
||
msgstr "На крок із входом"
|
||
|
||
#: lazarusidestrconsts.lismenustepover
|
||
msgid "Step over"
|
||
msgstr "На крок в обхід"
|
||
|
||
#: lazarusidestrconsts.lismenustop
|
||
msgctxt "lazarusidestrconsts.lismenustop"
|
||
msgid "Stop"
|
||
msgstr "Завершити"
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr "ТАБ зробити пробілами в виділеному"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "Про"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateclose
|
||
msgctxt "lazarusidestrconsts.lismenutemplateclose"
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Зміст"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecopy
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecut
|
||
msgctxt "lazarusidestrconsts.lismenutemplatecut"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Стандартне меню Правка"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Стандартне меню Файл"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Стандартне меню Довідка"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateedit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateedit"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateexit
|
||
msgctxt "lazarusidestrconsts.lismenutemplateexit"
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefile
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefind
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr "Шукати далі"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatehelp
|
||
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Новий"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopen
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopen"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopenrecent
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr "Відкрити нещодавні"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatepaste
|
||
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateredo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateredo"
|
||
msgid "Redo"
|
||
msgstr "Повернути"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesave
|
||
msgctxt "lazarusidestrconsts.lismenutemplatesave"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Зберегти як"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Посібник"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateundo
|
||
msgctxt "lazarusidestrconsts.lismenutemplateundo"
|
||
msgid "Undo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
msgid "Toggle comment"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Інструменти"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr "Розкоментувати"
|
||
|
||
#: lazarusidestrconsts.lismenuundo
|
||
msgctxt "lazarusidestrconsts.lismenuundo"
|
||
msgid "Undo"
|
||
msgstr "Відмінити"
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr "Відмінити зсув блоку вправо"
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr "Верхний регістр виділення"
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "&Вигляд"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
#, fuzzy
|
||
#| msgid "View Anchor Editor"
|
||
msgid "Anchor Editor"
|
||
msgstr "Показувати редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts.lismenuviewassembler
|
||
msgid "Assembler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Точки зупину"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Стек викликів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgid "Code Browser"
|
||
msgstr "Браузер Коду"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Оглядач коду"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
#, fuzzy
|
||
#| msgid "View Component Palette"
|
||
msgid "Component Palette"
|
||
msgstr "Переглянути Палітру Компонетів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Компоненти"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr "Повідомлення налагоджувача"
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr "Форми..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewidespeedbuttons
|
||
#, fuzzy
|
||
#| msgid "View IDE speed buttons"
|
||
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
|
||
msgid "IDE speed buttons"
|
||
msgstr "Переглянути швидкі клавіші графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
#, fuzzy
|
||
#| msgid "View Jump-History ..."
|
||
msgid "Jump-History ..."
|
||
msgstr "Переглядання історії переходів ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Місцеві змінні"
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr "Інспектор об'єкту"
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Результати пошуку"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsource
|
||
msgid "&View Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор тексту"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtodolist
|
||
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
|
||
msgid "ToDo List"
|
||
msgstr "Список ToDo"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
#, fuzzy
|
||
#| msgid "View Unit Dependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Показувати залежності модулів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
#, fuzzy
|
||
#| msgid "View Unit Information"
|
||
msgid "Unit Information"
|
||
msgstr "Продивитись відомості про модулі"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr "Модулі..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Вікно спостережень"
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Пропущені Події"
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Пропущені пакунки"
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismodify
|
||
msgid "&Modify"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgid "More"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
msgid "Move Page ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisms
|
||
msgid "(ms)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismvdocking
|
||
msgid "Docking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Зберегти повідомлення в файл (*.txt)"
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Назва нової процедури"
|
||
|
||
#: lazarusidestrconsts.lisnever
|
||
msgid "Never"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgid "new"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Нові предки"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Новий клас"
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Створити нову програму."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Створити новий файл редактора.%s Виберіть тип."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Створити новий порожній текстовий файл."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Створити нову графічну програму.%sЦя програма підтримується Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Створити новий модуль паскаля."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr "Створити нову програму.%sФайл програми підтримується Lazarus."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Створити новий проект.%sВиберіть тип."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Створити новий стандартний пакунок%sПакунок - це набір модулів і компонентів."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Створити новий модуль з модулем даних."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Створити новий модуль з формою LCL."
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
|
||
msgid "Inherit from an existing component."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Не вибрано пункту"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Виберіть спочатку елемент"
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "%s - (новий проект)"
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
msgid "New units are added to uses sections:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisno
|
||
msgid "No"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Немає резервних файлів"
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr "Без змін"
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Не вибрано коду"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Не успадковані параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr "без назви"
|
||
|
||
#: lazarusidestrconsts.lisnone
|
||
msgid "%snone"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnone2
|
||
msgid "none"
|
||
msgstr "нічого"
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
msgid "No pascal file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Не знайдено розділу в ResourceString"
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Як правило фільтр є регулярним виразом. В простому синтаксисі a . є нормальним символом, a * відповідає за все, a ? відповідає за будь-який символ, а кома і крапка з комою відділяють альтернативи. Наприклад, простий синтаксис *.pas;*.pp переписується на ^(.*\\.pas|.*\\.pp)$\""
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Не знайдено рядка з константами"
|
||
|
||
#: lazarusidestrconsts.lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr "Це не є проектом Delphi"
|
||
|
||
#: lazarusidestrconsts.lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr "Це не є модулем Delphi"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "ЗАУВАЖЕННЯ:Не можу створити означений шаблон для текстів Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Не зараз"
|
||
|
||
#: lazarusidestrconsts.lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Створити"
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Створити новий проект"
|
||
|
||
#: lazarusidestrconsts.lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Виберіть тип проекту"
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
msgid "Number of files to convert: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr "шлях до об'єкта"
|
||
|
||
#: lazarusidestrconsts.lisoff
|
||
msgid "? (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Додати до улюблених властивостей"
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Вибрати базовий клас для улюбленої властивості %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Клас %s%s%s не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Прибрати з улюблених властивостей"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "авто-встановити динамічно"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "авто-встановити статично"
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Опис: "
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sОпис: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Назва файлу: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "встановлено динамічно"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "встановлено статично"
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr "відсутній"
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr "змінено"
|
||
|
||
#: lazarusidestrconsts.lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Не вибрано пакунку"
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr "Відкрити завантажений пакунок"
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Пакунок Name"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Виберіть пакунок"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Виберіть пакунок, щоб відкрити"
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "тільки для читання"
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgid "State"
|
||
msgstr "Стан"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sЦей пакунок вже встановлений, але файлу lpk не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sЦей пакунок створений автоматично"
|
||
|
||
#: lazarusidestrconsts.lisok
|
||
msgid "&Ok"
|
||
msgstr "&Гаразд"
|
||
|
||
#: lazarusidestrconsts.lisold
|
||
msgid "old"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Старі предки"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Старий клас"
|
||
|
||
#: lazarusidestrconsts.lison
|
||
msgid "? (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Шукати лише для повних слів"
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Відкрити як XML-файл"
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Відкрити існуючий файл"
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
msgid "Open file"
|
||
msgstr "Відкрити файл"
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
msgid "Open File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Відкрити %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Відкрити пакунок?"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Відкрити файл пакунку"
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Відкрити проект?"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Відкрити проект"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Відкрити проект знову"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Відкрити файл проекту"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Відкрити файл як текст програми"
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Відкрити пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Відкрити проект %s"
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr "або"
|
||
|
||
#: lazarusidestrconsts.lisoriginalfilename
|
||
msgid "Original File Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Підмінити мову. Наприклад --language=de. Для можливих величин див. теку languages"
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Переписати файл?"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Переписати файл на диску"
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr "Пакунок"
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
msgid "package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr "Пакунок Info"
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Назва пакунку починається з ..."
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Назва пакунку вміщує ..."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Потрібне встановлення пакунку"
|
||
|
||
#: lazarusidestrconsts.lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Пакунки для встановлення в IDE"
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "Файл з паскаль-текстом"
|
||
|
||
#: lazarusidestrconsts.lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "Паскаль-модуль"
|
||
|
||
#: lazarusidestrconsts.lispasscount
|
||
msgid "Pass Count"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispastetextfromclipboard
|
||
msgid "Paste text from clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "Переглянути"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Пересунути шлях вниз"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Пересунути шлях вверх"
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Шляхи шаблонів"
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Шляхи пошуку:"
|
||
|
||
#: lazarusidestrconsts.lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Вибрати теку"
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
msgid "Path to failed Instance:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Додати пункт"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Застосувати зміни"
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Викликати процедуру %sRegister%s вибраного модуля"
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr "Очистити залежності до газви файла"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompile
|
||
msgctxt "lazarusidestrconsts.lispckeditcompile"
|
||
msgid "Compile"
|
||
msgstr "Компіл."
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Побудувати всі?"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Побудувати пакунок"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Параметри компілятора для пакунку %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompopts
|
||
msgctxt "lazarusidestrconsts.lispckeditcompopts"
|
||
msgid "Compiler Options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Створити Makefile"
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Редагувати Загальні Параметри"
|
||
|
||
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Редагувати параметри для компіляції пакунку"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Властивості файлу"
|
||
|
||
#: lazarusidestrconsts.lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Загальні параметри"
|
||
|
||
#: lazarusidestrconsts.lispckedithelp
|
||
msgctxt "lazarusidestrconsts.lispckedithelp"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Встановити"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Встановити пакунки IDE"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Неправильна максимальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Неправильна мінімальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Максимальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Мінімальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Змінено: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditmore
|
||
msgid "More ..."
|
||
msgstr "Докладніше ..."
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Пересунути залежність вниз"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Пересунути залежність вверх"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Пакунок%s"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Пакунок %s%s%s змінено.%s Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "пакунок%s не збережений"
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Сторінка: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Оновити залежність"
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Оновити файл"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Тільки для читання:%s"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr "Необхідно перекомпілювати всі"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr "Чиста перебудова"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Перекомпілювати це, а також і всі потрібні пакунки?"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Зареєстровані доповнення"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Зареєструвати модуль"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Видалити залежність"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Видалити залежність?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Видалити залежність %s%s%s%sз пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr "Видалені файлі (ці елементи не зберігаються в lpk-файлі)"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr "Видалені необхідні пакунки (вони не зберігаються в lpk-файлі)"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Видалити файл"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Видалити файл?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Видалити файл %s%s%s%s з пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Видалити вибраний елемент"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr "Зберегти зміни?"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr "Зберегти пакунок"
|
||
|
||
#: lazarusidestrconsts.lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr "Зберегти залежність файлу"
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Максимальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Мінімальна версія %s%s%s є неправильною версією пакунку.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr "Продивитись код пакунку"
|
||
|
||
#: lazarusidestrconsts.lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "Автостворення"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Встановлено"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Встановити при наст. запуску"
|
||
|
||
#: lazarusidestrconsts.lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Вибраний пакунок потрібен для:"
|
||
|
||
#: lazarusidestrconsts.lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Завантажені пакунки"
|
||
|
||
#: lazarusidestrconsts.lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Пакунк%sне знайдений"
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sСтан: "
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Видалити при наст. пуску"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Додати параметри до підпорядкованих пакунків і проектів"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Додати шляхи до залежних пакунків/проектів"
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr "Автор:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Автоматично збільшити версію при побудові"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Перебудувати за необхідністю автоматично"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "перебудувати при перезбиранні всіх"
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Спеціальний"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr "Опис/коротко"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr "При розробці і запуску"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Тільки для розробки"
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Інтегрування в IDE"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Неправильний тип пакунку"
|
||
|
||
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
|
||
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
|
||
msgid "FPDoc files path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Бібліотека"
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
msgid "License:"
|
||
msgstr "Ліцензія:"
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Компонувальник"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Важливий"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Компіляція вручну (ніякої автоматизації)"
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Другорядний"
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Об'єкт"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Параметри пакунку"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr "Тип пакунку"
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "Часу виконання"
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "Пакунок %s%s%s має мітку Автовстановлення.%sЦе означає, що він автоматично вмонтується в IDE. Встановлювані пакунки%sмають бути для розробки."
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr "Поновити/перебудувати"
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Використання"
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Перебіг"
|
||
|
||
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Знайдений конфлікт"
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Неправильна назва файла модуля"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
msgid "Sort files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
|
||
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Назва Модуля"
|
||
|
||
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispeviewtodolist
|
||
msgid "View ToDo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Додавання CompiledSrcPath"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Вихідна тека"
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Відмітити теку кодів пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Шлях до модулів"
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Ви дійсно бажаєте забути всі зміни до пакунку %s і завантажити його з файлу?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Новий модуль не знаходиться в шляху до модулів"
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Опублікувати пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Повернути пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr "Файл %s%s%s%sзараз не знаходиться в списку шляхів модулів пакунку.%s%sДодати його туди?"
|
||
|
||
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Довідка по мережі ще не реалізована"
|
||
|
||
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Праве клацання на елементі дерева дає меню із всіма доступними функціями пакунку."
|
||
|
||
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "У спливаючому меню більше функцій"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "Бінарне"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Включити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "Текст форми LFM - Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "Ресурс LRS - Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeunit
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sДодавання нової залежності до пакунку %s: пакунку %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sДодавання нової залежності до проекту %s: пакунок %s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Додати модуль до операторної частини uses пакунку. Унеможливити це тільки для модулів, які в жодному випадку не треба компілювати"
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Знайдено модулі з однаково розпізнаними назвами"
|
||
|
||
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Необхідний пакунок не знайдений. Див. діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Автом. встановлені пакунки"
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sОбидва пакунки є пов'язаними. Це означає, що або один із них використовує інший, або обидва вони використовуються третім пакунком."
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Залежність порушена"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr "Циклічна залежність пакунків"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Видалення не вдалося"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Видалити старий файл пакунку?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Видалити старий файл пакунку %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Залежність без власника:%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Помилка читання файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Помилка читання пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Помилка запису файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Помилка запису пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Файл вже є в пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Файл в проекті"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Назва файлу відрізняється від назви пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Назву файлу використано іншим пакунком"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Назву файлу використано проектом"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "Не знайдений файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Файл не збережений"
|
||
|
||
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ігнорувати і зберегти зараз пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "При встановленні пакунку %s буде автоматично встановлено пакунок:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "При встановленні пакунку %s будуть автоматично встановлені пакунки:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "неправильна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Неправильне розширення файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Неправильне розширення файлу пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Неправильна назва файлу пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Завантаження пакунку %s замінить пакунок%s%s з файлу %s.%sСтарий пакунок змінено.%s%sЗберегти старий пакунок%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "Новий пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Пакунок:%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr "Пакунок %s%s%s змінено. Записати?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Конфлікти в пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Пропущений файл пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Пакунок %s%s%s не має правильної вихідної теки:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Пакунок не є designtime пакунком"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Потрібен пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "головний файл є кодом пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Така назва пакунку вже існує"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Пакунки повинні мати розширення файлів .lpk"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Збережіть файл перед додаванням в пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr "Спочатку збережіть пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Проект: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Перебудувати Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr "Перейменувати файл в пакунку?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Замінити існуючий файл %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Замінити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr "Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr "Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Зберегти пакунок%s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "Чи треба змінити назву файла на нижн. рег. в %s%s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "статичний файл налаштувань пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "Файл компілятора для пакунку %s не є виконуваним:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Файл %s%s%s%sвже в пакунку %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "Файл %s%s%s не є пакунком Lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "Назва файлу %s%s%s не відповідає назві пакунку %s%s%s в файлі.%sЗамінити назву пакунку на %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Назва файлу %s%s%s є частиною поточного проекту.%sПроекти і пакунки не мають ділити файли."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "Назва файлу %s%s%sвикористовується%sпакунком %s%s%s%sв файлі %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "Файл %s%s%s%sпакунку %s пропущений."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "Файл %s%s%s%sпакунку %s треба спочатку зберегти."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Наступний пакунок не вдалось завантажити"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Наступні пакунки не вдалось завантажити:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sНаступні модулі будуть додані до розділу uses %s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Пакунок %s%s%s компілюється з помилками.%sВидалити його із встановочного списку?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "Назва пакунку %s%s%s в%s%s%s%s є неправильною назвою пакунку lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "Пакунок %s є пакунком тільки часу виконання.%sТакі пакунки не можуть бути встановлені в IDE."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Пакунок %s%s%s відмічено для встановлення, але його не було знайдено.%sВидалити залежність із списку установки пакунків?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Пакунок %s потребується для %s, який був позначеним для установки.%sДивись діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть інший пакунок(напр., package1.lpk)."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "Назва пакунку %s%s%s %sфайлу %s%s%s є некоректною."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr "Пакунок %s має файл%s%s%s%s.%sЧи змінити назву файла в пакунку як правило?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок %s%s%s відмічено.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточне видалення потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок %s%s%s помічено для встановлення.%sЗараз lazarus підтримує тільки статично пов'язані пакунки. Поточна установка потребує перепобудови і перезапуску lazarus.%s%sВи бажаєте перебудувати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Проект вимагає пакунку %s%s%s.%sАле його не знайдено. Див. Проект -> Інспектор проекту."
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Існує два модуля з однаковими назвами:%s%s1. %s%s%s з %s%s2. %s%s%s з %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr "Виявлений цикл залежностей пакунків. Дивіться діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Існує модуль FPC з такою самою назвою, як і пакунок:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Існує модуль FPC з такою самою назвою, як:%s%s%s%s%s з %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Вже існує іншій пакунок з назвою %s%s%s.%sКонфліктуючий пакунок:%s%s%s%sФайл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Вже завантажено пакунок%s%s%s %sз файлу %s%s%s.%sДив. Компоненти -> Діаграма пакунків.%sЗаміна неможлива."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Посеред необхідних пакунків є не збережений. Див. діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Існує модуль з такою самою назвою, як і пакунок: %s%s1. %s%s%s з %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr "Цей файл було автоматично створено Lazarus. Не редагувати!"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Це віртуальний пакунок. В нього немає коду. Збережіть спочатку пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr "Цей код вимагає тільки компіляції і встановлення пакунку."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Не можу створити теку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Не можу створити теку виведення %s%s%s%sз пакунку %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Не можу створити теку кодів пакунку %s%s%s%sдля пакунку %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Не можу створити теку цілі для lazarus:%s%s%s%s.%sЦя тека потрібна для оновленого IDE lazarus з вашими пакунками."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Не можу видалити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Не можу видалити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Не можу видалити старий файл %s%s%s%s з пакунку %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Не можу відкрити пакунок%s%s%s.%sЦей пакунок було позначено для встановлення."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Не можу прочитати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Не можу записати пакунок%s%s%s%sу файл %s%s%s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Не можу записати файл стану %s%s%s%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Видалити пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Видалити пакунок%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Не збережений пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Викор. модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Увага: Файл %s%s%s%sналежить поточному проекту."
|
||
|
||
#: lazarusidestrconsts.lispkgreg
|
||
msgid "Package Registration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Не можу зареєструвати компоненти без модуля"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr "CodeTools - це інструменти для синтаксичного аналізу, переглядання і редагування текстів на pascal"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Клас компонента %s%s%s вже визначений"
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sНазва файлу: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Неправильний клас компонента"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Неправильна назва модуля: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Файл пакунку не знайдений"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "Порожня процедура реєстрації"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "Було викликано RegisterUnit, але пакунків не зареєстровано."
|
||
|
||
#: lazarusidestrconsts.lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr "Помилка реєстрації"
|
||
|
||
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SynEdit - компонент редактора, використано Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr "FCL - бібліотека компонентів FreePascal забезпечує базові класи для об'єктного паскаля."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "LCL - Бібліотека компонентів Lazarus вміщує всі основні компоненти для редагування форм."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Пакунок %s%s%s встановлено, але не знайдений правильний файл з пакунком (.lpk).%sБув створений зламаний холостий пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Це пакунок за замовчуванням. Використовується тільки для компонентів без пакунку. Такі компоненти є застарілими."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Цей пакунок встановлений але lpk-файл не був знайдений. Всі компоненти дезактивовані. Будь-ласка, виправте проблему."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sНазва модуля: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr "Модуль не знайдений: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr "Модуль %s%s%s був видалений з пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Цього файлу немає у всіх завантажених пакунках."
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Неможливо прочитати файл пакунку %s%s%s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispldexists
|
||
msgid "Exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispleasecheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr "Перевірте назву компілятора"
|
||
|
||
#: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr "Перевірте теку кодів FreePascal"
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Відкрийте модуль перед запуском."
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Виділіть трохи коду, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Всі>"
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Змінити Шрифт"
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Копіювати назву методу з буферу обміну"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Фільтр за збіжністю будь-якої частини метода"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Фільтр за збіжністю початку метода"
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Перейти до Обраного"
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<нічого>"
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Об'єкти"
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Не зберігати ніякої сесії"
|
||
|
||
#: lazarusidestrconsts.lispointer
|
||
msgid "Pointer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Зберегти в теці графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Зберегти в файлі .lpi"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Зберегти в файлі .lpi в теці проекту"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Зберегти інформацію про сесію в"
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "тека головних налаштувань, де Lazarus зберігає свої файли налаштувань. За замовчуванням"
|
||
|
||
#: lazarusidestrconsts.lisprint
|
||
msgid "Print"
|
||
msgstr "Друкування"
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr "Приватний"
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Приватний метод"
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%s%sЗауважте:%sПроект залежить від деяких пакунків, які містять модулі з процедурою Register. Процедура Register зазвичай використовується для встановлення компонентів в IDE. Але наступні модулі залежать від пакунків, які ще не встановлено в IDE. Якщо Ви спробуєте відкрити форму в IDE, яка використовує таку компоненту, отримаєте повідомлення про відсутність компонентів і результати завантаження форми не дадуть очікуваного результату.%s%sЦе жодним чином не відіб'ється на проекті, який відкривається чи на його файлах.%s%sЦе тільки означає: Недобре відкривати форми для роботи перед встановленням відсутніх пакунків.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Процедура"
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Процедура з інтерфейсом"
|
||
|
||
#: lazarusidestrconsts.lisproductname
|
||
msgid "Product Name:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisproductversion
|
||
msgid "Product Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Програма%sПрограма freepascal. Файл програми автоматично підтримується lazarus."
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Виявлена програма"
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "Текст програми повинен мати розширення паскаля, напр. .pas, .pp або .lpr"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
||
msgid "Add files to project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Додати файл до проекту:"
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Залежність вже існує"
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Додати файли редактора"
|
||
|
||
#: lazarusidestrconsts.lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Додати файли"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Неправильна версія (Min-Max)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Неправильна назва пакунку"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Неправильна назва модуля паскаля"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Неправильна версія"
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Максимальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Мінімальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Нова вимога"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Пакунок Name:"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Пакунок не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "Залежності %s%s%s не знайдено.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "Максимальна версія %s%s%s некоректна.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "Максимальна версія менше за мінімальну."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "Мінімальна версія %s%s%s є некоректною.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "Назва пакунку %s%s%s є некоректною.%sВиберіть існуючий пакунок."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "Проект вже залежить от пакунку %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "Назва модуля %s%s%s вже існує в проекті%sв файлі: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "Назва модуля %s%s%s вже існує в виділенні%sв файлі: %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва модуля %s%s%s є неприпустимим ідентифікатором паскаля."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtoproject
|
||
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
||
msgid "Add to project"
|
||
msgstr "Додати до проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Проект змінено"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Тека проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Шляхи, що включені до проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Виявлено info-файл проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr "Інформація про проект"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Проект є виконуваним"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Властивості макросів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr "макрос ProjectUnitPath"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Шлях до кодів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
|
||
#, fuzzy
|
||
#| msgid "Project %s%s%s successfully built. :)"
|
||
msgid "Project %s%s%s successfully built"
|
||
msgstr "Проект %s%s%s успішно зібрано. :)"
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Шлях до модулів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Підтвердити видалення залежності"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Видалити залежність для %s?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Інспектор проекту - %s"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr "Видалені необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Видалити файл %s з проекту?"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Неможливо прочитати файл стану %s проекту %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Неможливо записати файл стану в проект %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Завжди будувати (навіть якщо нічого не мінялось)"
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Не можу змінити список автостворюваних форм в коді програми.%sВиправте спочатку помилки."
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Мітка теки програмних файлів проекту"
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Довідка за значенням"
|
||
|
||
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
|
||
msgid "Properties of conditional compiler option"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr "Захищений"
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Захищений метод"
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Спільний метод"
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Опублікований метод"
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Тека публікації проекту"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Неправильний фільтр виключень"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr "Неправильний фільтр включень"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Модуль паскаля має мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Редагувати віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Вже є модуль з такою назвою. %sФайл: %s"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Назва модуля не є правильним ідентифікатором pascal. "
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr "Назва модуля використана графічною оболонкою при розширенні користувацьких виразів."
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Назва модуля і Назва файлу не збігаються.%sНаприклад: unit1.pas і Unit1"
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
msgid "Convert Delphi Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
msgid "New Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
msgid "Open Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open Recent"
|
||
msgstr "Відкрити нещодавні"
|
||
|
||
#: lazarusidestrconsts.lispwrecentprojects
|
||
msgid "Recent Projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Вийти з Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts.lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisregisters
|
||
msgctxt "lazarusidestrconsts.lisregisters"
|
||
msgid "Registers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgname
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgname"
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts.lisregistersdlgvalue
|
||
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Відносні шляхи"
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
msgid "remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Видалити всі некоректні властивості"
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr "Видалити з проекту"
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Видалити їх"
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Перейменувати файл?"
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Не вдалося змінити назву файла"
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Превести в нижній регістр"
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Помилка заміни"
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresourcefilecomment
|
||
msgid "This is an automatically generated lazarus resource file"
|
||
msgstr "Це файл ресурсів, що було автоматично створено lazarus"
|
||
|
||
#: lazarusidestrconsts.lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Помилка завантаження ресурсу"
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Помилка збереження ресурсу"
|
||
|
||
#: lazarusidestrconsts.lisresult
|
||
msgid "Result :="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid "returns list of all values of case variable in front of variable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Обертання не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого права сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Праві краї"
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "По правому краю"
|
||
|
||
#: lazarusidestrconsts.lisroot
|
||
msgid "Root"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Файл не є виконуваним"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "Головна програма %s%s%s не є виконуваним файлом."
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Виконати-до не вдався"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract methods - not yet overridden"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
msgid "Save ..."
|
||
msgstr "Збереження ..."
|
||
|
||
#: lazarusidestrconsts.lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr "Зберегти всі повідомлення в файл"
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr "зберегти всі змінені файли"
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Зберегти і вийти з діалогу"
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Зберегти і перебудувати IDE"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Зберегти зміни?"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Зберегти зміни в проект %s?"
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr "зберегти поточний файл редактора"
|
||
|
||
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Зберегти інформацію редактора про файли, що не відносяться до проекту"
|
||
|
||
#: lazarusidestrconsts.lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Зберегти файл як"
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Зберегти файл %s%s%sперед закриттям форми %s%s%s?"
|
||
|
||
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Зберегти інформацію про закриті редактором файли"
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
msgid "Save project %s (*%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Зберегти налаштування"
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "Зберегти "
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Масштабний фактор:"
|
||
|
||
#: lazarusidestrconsts.lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Шукати "
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "вторинна тека налаштувань, де Lazarus шукає свої шаблони налаштувань. За замовчуванням "
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Дивись повідомлення."
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sДив.. Проект -> Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Шукати елемент довідки:"
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Виберіть елемент"
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Виберіть файли форм Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
msgid "(selected left neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
msgid "(selected right neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
msgid "(selected top neighbour)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "Вибір перевищує рядкову константу"
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Інструмент вибору"
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissetvalue
|
||
msgid "Set value"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgid "Show hints"
|
||
msgstr "Показувати довідки в Інспекторі об'єкту"
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Показувати змінні"
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr "Показувати попередній порядок tab"
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Показувати пакунки"
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show status bar"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr "Рівень"
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr "Простий синтаксис"
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Пропустити файл і продовжити завантаження"
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Пропустити завантаження останнього проекту"
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "smaller rather than faster"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr "Збіги"
|
||
|
||
#: lazarusidestrconsts.lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Вибачте, цей тип ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "За зростанням"
|
||
|
||
#: lazarusidestrconsts.lissortselcancel
|
||
msgctxt "lazarusidestrconsts.lissortselcancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Спадаюче"
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Домен"
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ігнорувати пробіли"
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Рядки"
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Абзаци"
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Прийняти"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Сортування вибраного"
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr "Слова"
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Код і призначення однакові:%s%s"
|
||
|
||
#: lazarusidestrconsts.lissourcebreakpoint
|
||
msgid "&Source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "Теки кодів %s%s%s не існує."
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Код змінено"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Код сторінки %s%s%s змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Шляхи до програмних файлів"
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Вирівняти по ширині"
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr "Пошук"
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Шукати текст"
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Розпочати з нового проекту"
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Завершити налагоджування і перебудувати прект?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Завершити налагодження?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Завершити налагоджування?"
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Завершити налагоджування?"
|
||
|
||
#: lazarusidestrconsts.lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Помилка потоків"
|
||
|
||
#: lazarusidestrconsts.lisstring
|
||
msgid "String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisstyle
|
||
msgctxt "lazarusidestrconsts.lisstyle"
|
||
msgid "Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Підпроцедура"
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Підпроцедура того ж рівня"
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr "Успішно"
|
||
|
||
#: lazarusidestrconsts.lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Версія SVN"
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Неправильна назва змінної"
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s є некоректним ідентифікатором."
|
||
|
||
#: lazarusidestrconsts.lissvuook
|
||
msgctxt "lazarusidestrconsts.lissvuook"
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Змінювання системної змінної"
|
||
|
||
#: lazarusidestrconsts.lissynedit
|
||
msgid "SynEdit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr "ТАБ"
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "Для ЦП:"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Назва цільового файлу проекту"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr "Для якої ОС"
|
||
|
||
#: lazarusidestrconsts.listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Внутрішня помилка компілятора! (%d)"
|
||
|
||
#: lazarusidestrconsts.listddinserttodo
|
||
msgid "Insert ToDo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
msgid ""
|
||
"Inserts an editable Cell, with a default value\n"
|
||
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
|
||
"\"default\",Sync, to Sync with a previous cell of equal default\n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Тека проб"
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "Клас %s%s%s не є елементом управління (TControl) і його не можна вставити на що-небудь інше.%sНе можу вставити."
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "Команда після %s%s%s не є виконуваною."
|
||
|
||
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "Команда після опублікування є некоректною:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "Редактор компонента для класу %s%s%sщо пов'язаний зі словом #%s %s%s%sвикликав помилку:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "%s%s%s.%sІнакше перевірте Оточення->Параметри оточення->Файли"
|
||
|
||
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна назва компілятора %s%s%s%s не є виконуваним файлом.%sПеревірте Environment -> Environment Options -> Files"
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sВиберіть Гаразд щоб повернути використаний за замовчуванням %s%s%s,%s або перевірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека кодів FPC %s%s%s%sвиглядає неправильною.%sПеревірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sВиберіть ОК для використовування теки за замовчуванням %s%s%s,%s або перевірте Оточення -> Параматри Оточення -> Files"
|
||
|
||
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Поточна тека Lazarus %s%s%s%sвиглядає неправильною.%sБез нього Ви не зможете створювати додатки LCL.%sПеревірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr "Поточний шлях модуля для файлу %s%s%s%s - %s%s%s%s.%s%sШлях до модулів LCL %s%s%s відсутній.%s%sДовідка для новачків:%sСтворіть програму lazarus і розмістіть файл в каталозі проекту."
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr "Налагоджувач %s%s%s%sdoes не існує або не є виконуваним.%s%sДив. Оточення -> Параметри Налагоджувача"
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "Теки призначення%s%s%s%s не існує."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "Тека %s%s%s більше не потрібна в шляху до модулів.%sПрибрати її?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "Теки %s%s%s немає в шляху до модулів.%sДодати її?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "Файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr "Файл %s%s%s не є проектом Delphi (.dpr)"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr "Файл %s%s%s не є модулем Delphi."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Файл %s%s%s%sсхожий на програму. Закрити поточний проект і створити новий проект lazarus для цієї програми?%s\"Ні\" відкриє файл як звичайний код."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "Схоже, що файл %s є програмним в існуючому Проекті"
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "Файлу %s%s%s%sне знайдено.%sВи бажаєте пошукати його самостійно?%s"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Файл %s%s%s%sне знайдено.%sПропуск продовжить завантаження проекту,%sПереривання зупинить завантаження."
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Наступні методи, що використовуються %s відсутні в програмному файлі%s%s%s%s%s%sПрибрати завислі посилання?"
|
||
|
||
#: lazarusidestrconsts.listhefollowingunitswerenotfound1eithertheseunitsaren
|
||
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "Компілятор FreePascal (назва файлу: %s) не знайдено.%sВам рекомендується встановити fpc"
|
||
|
||
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr "Теки кодів FPC не знайдено.%sОкремі дії з кодом не будуть працювати.%sРекомендується встановити її і встановити шлях%sОточення -> Оточення Параматри -> Файли"
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "Виконувана програма %s%s%s%sне існує або не є виконуваною.%s%sДивіться -> Запуск -> Параметри запуску -> Локальні"
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Теки Lazarus не знайдено.%sВи не зможете створювати додатки LCL.Перевірте Оточення -> Параметри Оточення -> Файли"
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "LFM-файл (файл форми Lazarus) вміщує некоректні властивості. Це означає, наприклад, що він вміщує деякі властивості/класи, яких немає в поточній версії LCL. Як правило треба прибрати ці властивості з lfm і (якщо треба) виправити код паскаля вручну."
|
||
|
||
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Назва %s%s%s є неправильним ідентифікатором паскаля."
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "Програму %smake%s не знайдено.%sЦей інструмент потрібен, щоб Побудувати lazarus.%s"
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "Файл відомостей проекту %s%s%s%sзбігається з головним кодом!"
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Проект треба зберегти для компіляції%sЯкщо Ви встановите теку проб в параметри оточення,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?"
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "В теці є і інші файли з такою самою назвою,%s, що відрізняється тільки регістром:%s%s%sВидалити їх?"
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "На диску є файл з такою самою назвою і схожим розширенням%sФайл: %s%sСхожий файл: %s%s%sВидалити інший файл?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyabuildvarwiththename
|
||
msgid "There is already a build variable with the name %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Вже існує форма з назвою %s%s%s"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Вже існує модуль, що називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "В проекті є модуль з назвою %s%s%s.%sВиберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "Ресурс класу %s%s%s походить від %s%s%s. Можливо, що це відноситься ло TForm."
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при запису вибраних компонентів %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при перетворенні бінарного потоку вибраного компонента %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Сталася помилка при копіюванні потоку компонента в буфер:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "Компоненту верхнього рівня не може бути видалено."
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "Модуль %s%s%s вже існує. Пропуск призведе до перейменування,%sВідміна скасує збереження цього файлу, а%sПерервати відмінить збереження взагалі."
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Модуль вже називається %s%s%s. Ідентифікатори паскаля мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "це довідкове повідомлення"
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Це виглядає як pascal файл.%sРекомендується використовувати назви файлів в нижньому регістрі для запобігання різних проблем на деякиих операційних системах і різних компіляторах.%sЗмінити на нижній регістр?"
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Цей вираз не може бути витягнутий.%sВиберіть будь-який код, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts.listhiswillhappencontinue
|
||
msgid "This will happen:%s%s%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Функція: додати розподілювач шляхів"
|
||
|
||
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Функція: прибрати розподілювач шляхів"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Функція: витягнути розширення файлу"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Функція: витягнути назву файлу з розширенням"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Функція: витягнути тільки назву файлу"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Функція: витягнути шлях до файлу"
|
||
|
||
#: lazarusidestrconsts.listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(невідомий макрос: %s)"
|
||
|
||
#: lazarusidestrconsts.listodoexport
|
||
msgctxt "lazarusidestrconsts.listodoexport"
|
||
msgid "Export"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listodogoto
|
||
msgid "Goto"
|
||
msgstr "Перейти"
|
||
|
||
#: lazarusidestrconsts.listodoldescription
|
||
msgctxt "lazarusidestrconsts.listodoldescription"
|
||
msgid "Description"
|
||
msgstr "Опис"
|
||
|
||
#: lazarusidestrconsts.listodoldone
|
||
msgid "Done"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listodolfile
|
||
msgctxt "lazarusidestrconsts.listodolfile"
|
||
msgid "Module"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.listodolistcaption
|
||
msgctxt "lazarusidestrconsts.listodolistcaption"
|
||
msgid "ToDo List"
|
||
msgstr "Список ToDo"
|
||
|
||
#: lazarusidestrconsts.listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr "Перейти до виділеного рядка коду"
|
||
|
||
#: lazarusidestrconsts.listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr "Параметри ToDo..."
|
||
|
||
#: lazarusidestrconsts.listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr "Друкувати елементи todo"
|
||
|
||
#: lazarusidestrconsts.listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr "Оновити елементи todo"
|
||
|
||
#: lazarusidestrconsts.listodolline
|
||
msgctxt "lazarusidestrconsts.listodolline"
|
||
msgid "Line"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts.listodolowner
|
||
msgid "Owner"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listodolpriority
|
||
msgctxt "lazarusidestrconsts.listodolpriority"
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Шлях:"
|
||
|
||
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listop
|
||
msgid "Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Фіксація по верху"
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "Ширина верхнього бордюру. Ця величина додана до базової ширини бордюрів і використовується для відступів навколо контролу."
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr "Вершини"
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "Це список контролів одного рівня для якого верхня сторона зафіксована. Залишити порожнім для батьківського."
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Вирівняти по висоті"
|
||
|
||
#: lazarusidestrconsts.listtodolcategory
|
||
msgctxt "lazarusidestrconsts.listtodolcategory"
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Не показувати це повідомлення знову."
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Помилка в регулярному виразі"
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Шрифт без UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
msgid "Goto line :"
|
||
msgstr "Перейти до рядка:"
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisuereadonly
|
||
msgid "%s/ReadOnly"
|
||
msgstr "%s/тільки для читання"
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Замінити %s%s%s%s на %s%s%s в цьому місті?"
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Шукаю: %s"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Рядок пошуку '%s' не знайдено!"
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Очистити кеш включень (includes)"
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s байтів"
|
||
|
||
#: lazarusidestrconsts.lisuidclear
|
||
msgid "Clear"
|
||
msgstr "Очистити"
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Доданий:"
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "в проекті:"
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr "Рядків"
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr "ні"
|
||
|
||
#: lazarusidestrconsts.lisuidok
|
||
msgctxt "lazarusidestrconsts.lisuidok"
|
||
msgid "Ok"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Шляхи (тільки для читання)"
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts.lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Джл"
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Тип:"
|
||
|
||
#: lazarusidestrconsts.lisuidunit
|
||
msgctxt "lazarusidestrconsts.lisuidunit"
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr "так"
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Значення CodeTools"
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Не можу перетворити бінарний потік на текст"
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Не можу скопіювати компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Не можу додати коментар заголовка ресурсу до файлу ресурсу %s%s%s%s.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Не можу додати ресурс T%s:FORMDATA до файлу ресурсів %s%s%s%s.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Не можу додати %s до проекту, тому що в проекті вже є модуль з такою самою назвою."
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Не можу зберегти резервний файл %s%s%s як %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sНеможливо змінити клас %s на %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Не можу очистити теку призначення"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Не можу очистити %s%s%s.%sПеревірте доступ."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Не можу перетворити компонент з текстового на бінарний формат:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Не можу перевести файл %s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Неможливо перетворити lfm в lrs і записати lrs-файл."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Не можу перетворити текстові дані форми файлу %s%s%s%s%sна двійковий потік. (%s)"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Не можу скопіювати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Не можу скопіювати файл %s%s%s%sв %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Не можу створити резервну теку %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Не можу створити теку %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Не можу створити теку %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Не можу створити файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Не можу створити файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Не можу створити файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
|
||
msgid "Unable to create new method. Please fix the error shown in the message window."
|
||
msgstr "Не можу створити новий метод. Виправте помилки, що вказані в вікні повідомлень."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Не можу створити тимчасовий lfm буфер"
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Не можу видалити двозначний файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Не можу знайти правильну назву класу в %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Не можу знайти файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Не можу знайти %s в LFM Потоці"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Please fix the error shown in the message window."
|
||
msgstr "Не можу знайти метод. Виправте помилки в вікні повідомлень."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr "Не можу знайти модуль компонета класу %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Не можу побудувати зміни редактора"
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Не можу знайти код для дизайнера"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Не можу завантажити старий ресурсний файл.%sЦей файл є першим include-файлом в%s розділі ініціалізації.%sНаприклад, {$I %s.lrs}.%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "Неможливо завантажити клас компоненту %s%s%s через те, що він залежить сам від себе. "
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Не можу відкрити дизайнер.%sКлас %s не походить від розробляємого класу типу TForm або TDataModule."
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Не можу прочитати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Не можу прочитати файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Не можу прочитати файл %s%s%s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Не можу прочитати файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Не можу стерти старий резервний файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Не можу змінити назву двозначного файла %s%s%s%sв %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Не можу змінити назву файла"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Не можу змінити назву файла %s%s%s в %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Не можу змінити назву файла %s%s%s%sв %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Неможливо змінити назву форми в коді"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Не можу змінити назву метода. Виправте помилку. Див. вікно повідомлень."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Неможливо змінити назву змінної в коді."
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Не можу зберегти файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Неможливо встановити AnchorSide Control"
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Please fix the error shown in the message window."
|
||
msgstr "Не можу показати метод. Виправте помилку. Див. вікно повідомлень."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Не можу скопіювати вибрані компоненти в потік"
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Не можу скопіювати вибрані компоненти в потік"
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Не можу створити потік %s:T%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Не можу перевести двійковий компонент потоку %s:T%s на текст."
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Неможливо оновити вираз CreateForm в коді проекту"
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
|
||
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Не можу записати %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Не можу записати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile2
|
||
msgid "Unable to write file %s%s%s"
|
||
msgstr "Не можу записати файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Не можу записати файл %s%s%s%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefilename
|
||
msgid "Unable to write file %s%s%s."
|
||
msgstr "Не можу записати файл %s%s%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile
|
||
msgid "Unable to write to file %s%s%s!"
|
||
msgstr "Не можу записати в файл %s%s%s!"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile2
|
||
msgid "Unable to write to file %s%s%s"
|
||
msgstr "Не можу записати в файл %s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Видалити виділення"
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Ідентифікатор модуля існує"
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisunitlfmfile
|
||
msgid "Unit: %s%sLFM file: %s"
|
||
msgstr "Модуль: %s%sФайл LFM: %s"
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Модуль з такою назвою вже є в проекті"
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Назва модуля починається з ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Назва модуля включає ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnotfound
|
||
msgid "Unit not found"
|
||
msgstr "Модул не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Тека для генерації модулів"
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr "шлях до модуля"
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Шляхи до модулів"
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfound2
|
||
msgid "Units not found"
|
||
msgstr "Модулі не знайдені"
|
||
|
||
#: lazarusidestrconsts.lisunusedunits
|
||
msgid "Unused units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdatepreview
|
||
msgid "Update preview"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr "Використовувати фільтр виключень"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr "Використовувати фільтр включень"
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Запуск програми"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
msgid "Use package %s in package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
msgid "Use package %s in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
msgid "Value:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
msgid "Value%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Вертикально"
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisviewbreakpointproperties
|
||
msgid "View Breakpoint Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr "Показувати модулі проекту"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Переглянути код (.lfm)"
|
||
|
||
#: lazarusidestrconsts.lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Попередження: знайдений двозначний файл %s%s%s. Код: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswatch
|
||
msgid "&Watch"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
msgid "When a unit is renamed, update references ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "З необхідними пакунками"
|
||
|
||
#: lazarusidestrconsts.liswladd
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: lazarusidestrconsts.liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Видалити"
|
||
|
||
#: lazarusidestrconsts.liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "Ви&далити Всі"
|
||
|
||
#: lazarusidestrconsts.liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "Н&едоступні Всі"
|
||
|
||
#: lazarusidestrconsts.liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "В&вімкнути Все"
|
||
|
||
#: lazarusidestrconsts.liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Доступний"
|
||
|
||
#: lazarusidestrconsts.liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Вираз"
|
||
|
||
#: lazarusidestrconsts.liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Властивості"
|
||
|
||
#: lazarusidestrconsts.liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr "Список спостережень"
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Слово під курсором в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Робоча тека для побудови"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Робоча тека для виконання"
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Файли XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Ви не можете перебудувати lazarus при налагоджуванні або компіляції."
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор тексту"
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsadditionalinfo
|
||
msgid "Additional info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsavailablescanners
|
||
msgid "Available scanners"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
msgid "Build:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscopyright
|
||
msgid "Copyright:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscreatingdirfailed
|
||
msgid "Creating directory \"%s\" failed!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinkfailed
|
||
msgid "Creating symbolic link \"%s\" failed!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rscreatingsymlinknotsupported
|
||
msgid "Creating symbolic link is not supported on this platform!"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
|
||
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
|
||
msgid "Filter the list with the current filter expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Файл форми (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found, but not listed here: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
|
||
msgid "Go to the next item in the search list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
msgid "Include Version Info in executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Спеціальна позиція"
|
||
|
||
#: lazarusidestrconsts.rsiwpdefault
|
||
msgctxt "lazarusidestrconsts.rsiwpdefault"
|
||
msgid "Default"
|
||
msgstr "Типовий"
|
||
|
||
#: lazarusidestrconsts.rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Пришвартований"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Відновити геометрію вікна"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Відновити розмір вікна"
|
||
|
||
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Використати налаштування windowmanager"
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Африканський"
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Арабська"
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Автоматично (або англійською)"
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Каталонська"
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Китайська"
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Датський"
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Англійська"
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Фінська"
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Французька"
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Німецька"
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Єврейська"
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Індонезійська"
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Італійська"
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Японська"
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Польська"
|
||
|
||
#: lazarusidestrconsts.rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr "Португальська"
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Російська"
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Іспанська"
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Українська"
|
||
|
||
#: lazarusidestrconsts.rsmajorrevision
|
||
msgid "Major revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsminorrevision
|
||
msgid "Minor revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsok
|
||
msgid "ok"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsremove
|
||
msgid "&Remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsresetfilter
|
||
msgid "Reset filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsscanners
|
||
msgid "Scanners"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsstartanewsearch
|
||
msgid "Start a new search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsversion
|
||
msgid "Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr "Клавіша \"%s\" вже приєднана до \"%s\"."
|
||
|
||
#: lazarusidestrconsts.srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr "Альтернативна клавіша (або комбінація з 2 клавіш)"
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Команди меню Довідка"
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Команда команди"
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Команди Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Команди переміщення курсора"
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Команди редагування тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Команди меню оточення"
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Команди файлового меню"
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Команди маркера тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Команди меню Проект"
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Команди меню Виконати"
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Команди пошуку і заміни тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Команди виділення тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Команди блокноту зауважень до тексту програми"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Команди меню Інструменти"
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Команди меню Переглядання"
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: lazarusidestrconsts.srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " команда1 \""
|
||
|
||
#: lazarusidestrconsts.srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " команда2 \""
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Конфлікт "
|
||
|
||
#: lazarusidestrconsts.srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " конфліктує з "
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "перервати побудову"
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "Додати точку переходу"
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "додати спостереження"
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Завершення шаблонів коду"
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Зсунути блок вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Відмінити зсув блоку вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "побудувати програму/проект"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr "побудувати всі файли програми/проекту"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "побудувати файл"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Побудувати lazarus"
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Видалити весь текст"
|
||
|
||
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Редактор визначень Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr "Параметри Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Режим вибирання колонки"
|
||
|
||
#: lazarusidestrconsts.srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "файл налаштувань побудови"
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Копіювати вибране у буфер обміну"
|
||
|
||
#: lazarusidestrconsts.srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr "Спеціальний інструмент %d"
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Вирізати вибране в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Видалити до початку рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Видалити символ біля курсора"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Видалити до кінця рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Видалити останній символ"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Видалити до початку слова"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Видалити поточний рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Видалити до кінця слова"
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr "Порівнянти"
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Пересунути курсор на абсолютний кінець"
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Пересунути курсор на абсолютний початок"
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
msgid "IDE options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "розрахувати/змінити"
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr "Здобути процедуру"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Зовнішній інструмент %d"
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Налаштування зовнішнього інструменту"
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
msgid "Find text"
|
||
msgstr "Пошук тексту"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Знайти інший кінець блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Знайти початок блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr "Знайти опис"
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr "Знайти посилання на ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr "Знайти в файлах"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr "Знайти наступне"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr "Знайти наступне слово"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
msgid "Find overloads"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr "Знайти попередній"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr "Знайти попереднє слово"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr "Знайти опис процедури"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr "Знайти метод процедури"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
msgid "Fold to Level %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Перейти до редактора %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr "Перейти за директивою include поточного включеного файлу"
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr "Перейти до рядка номер"
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Перейти до маркера %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Перейти за координатою XY"
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr "Передбачити відсутність $IFDEF"
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Вставити елемент ChangeLog"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Вставити з таблиці символів"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Вставити ключове слово CVS Author"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Вставити ключове слово CVS Date"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Вставити ключове слово CVS Header"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Вставити ключове слово CVS ID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Вставити ключове слово CVS Log"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Вставити ключове слово CVS Name"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Вставити ключове слово CVS Revision"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Вставити ключове слово CVS Source"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Вставити поточні дату і час"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Вставити примітку про GPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Вставити примітку про LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Розірвати рядок, залишити курсор"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Режим вставки"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Вставити змінений LGPL допис"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Вставити поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "перевірити"
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Розірвати рядок і зсунути курсор"
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Пересунути курсор в кінець рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Метод вибору рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Пересунути курсор на початок рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Перейти до відпов. дужки"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Пересунути редактор вліво"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Пересунути редактор вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Наступна закладка"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Перейти до наступного редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Нормальний режим вибрання"
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr "Відкрити файл над курсором"
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Режим перезапису"
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Пересунути курсор до низу сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Пересунути курсор вниз на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Пересунути курсор вліво на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Пересунути курсор вправо на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Пересунути курсор на початок сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Пересунути курсор на попередню сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Вставити з буфера в поточну позицію"
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr "призупинити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Попередня закладка"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Перейти до попереднього редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr "Процедура List ..."
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "швидка компіляція без збирання"
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "видалити точку зупинки"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
msgid "Remove empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
msgid "Remove unused units"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr "Перейменувати ID"
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr "Замінити текст"
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "скидання налагоджувача"
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr "запустити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "запуск файлу"
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "параметри запуску"
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Прокрутити вниз один рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Прокрутити вліво один символ"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Прокрутити вправо на один символ"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Прокрутити вверх на один рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Виділити вниз"
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Перетворення ТАБ в пробіли в виділеному"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Виділити до самого кінця"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Виділити до самого початку"
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Виділити перехід за коорд."
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "Виділити зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr "Виділити кінць рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr "Виділити початок рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr "Виділити низ сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Виділити сторінку знизу"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Виділити сторінку зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Виділити сторінку справа"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr "Виділити верх сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Виділити сторінку зверху"
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "Виділити справа"
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Виділити вверх"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Встановити позначку %d"
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
msgid "Show abstract methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr "Контекст коду"
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "зупинити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr "Перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
msgid "toggle break point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Переглядання точок зупинки"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Переглядання стеку викликів"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Браузер коду програми"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Показувати оглядач коду"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Переглянути палітру компонетів"
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Переглядання виводу налагоджувача"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Перемкнути модуль/форму"
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Переглянути Редактор Документації"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Переглянути швидкі клавіші графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Переглядання локальних змінних"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
msgid "Toggle Marker %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Переглядання повідомлень"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Перемкнути режим"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Показувати Інспектор Об'єктів"
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Показувати результати пошуку"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Показувати редактор тексту"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Показувати спостереження"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgid "Unfold all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "невідома команда редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Спочатку Користувач"
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Показувати редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts.srkmecviewtodolist
|
||
msgid "View todo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Показувати залежності модулів"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Показувати відомості про модулі"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr "Завершення слів"
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Пересунути курсор на слово вліво"
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Пересунути курсор на слово вправо"
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Змінити клавіші"
|
||
|
||
#: lazarusidestrconsts.srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr "Захопити клавішу"
|
||
|
||
#: lazarusidestrconsts.srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr "Захопити наступну клавішу"
|
||
|
||
#: lazarusidestrconsts.srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr "Ключ (або комбінація з 2 ключів)"
|
||
|
||
#: lazarusidestrconsts.srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr "Натисніть будь-яку клавішу..."
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Файл тільки для читання"
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Файл \""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" не для запису."
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Додати спостереження біля курсора"
|
||
|
||
#: lazarusidestrconsts.uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Закладки"
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Закрити сторінку"
|
||
|
||
#: lazarusidestrconsts.uemcompletecode
|
||
msgctxt "lazarusidestrconsts.uemcompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts.uemcopy
|
||
msgctxt "lazarusidestrconsts.uemcopy"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
#, fuzzy
|
||
#| msgid "Copy filename"
|
||
msgid "Copy Filename"
|
||
msgstr "Копіювати назву файлу"
|
||
|
||
#: lazarusidestrconsts.uemcut
|
||
msgctxt "lazarusidestrconsts.uemcut"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Налагодження"
|
||
|
||
#: lazarusidestrconsts.uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr "Властивості редактора"
|
||
|
||
#: lazarusidestrconsts.uemencloseselection
|
||
msgctxt "lazarusidestrconsts.uemencloseselection"
|
||
msgid "Enclose Selection"
|
||
msgstr "Задужкувати виділене"
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
msgid "&Evaluate/Modify..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemextractproc
|
||
msgctxt "lazarusidestrconsts.uemextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "Здобути процедуру"
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Знайти опис"
|
||
|
||
#: lazarusidestrconsts.uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr "Знайти посилання на ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Перехід на закладку"
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.ueminserttodo
|
||
msgid "Insert Todo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
msgid "Move page left"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
msgid "Move page leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
msgid "Move page right"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
msgid "Move page rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr "Перейти до наступної закладки"
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr "Змінено"
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "&Відкрити файл біля курсора"
|
||
|
||
#: lazarusidestrconsts.uempaste
|
||
msgctxt "lazarusidestrconsts.uempaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr "Перейти до попер. закладки"
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Процедурний перехід"
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgid "Read Only"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Переробка коду"
|
||
|
||
#: lazarusidestrconsts.uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Перейменувати ID"
|
||
|
||
#: lazarusidestrconsts.uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Виконувати до курсора"
|
||
|
||
#: lazarusidestrconsts.uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "&Встановити закладку"
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Встановити вільну Закладку"
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Показувати нумерацію рядків"
|
||
|
||
#: lazarusidestrconsts.uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr "Відомості про модулі"
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
msgid "&Toggle Breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Показувати стек викликів"
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts.uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Таки я Вам кажу, що це ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts.uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Якщо Ви можете допомогти нам реалізувати цю функцію, напишіть lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr "ВСТ"
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr "ЗАМ"
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Інформація про Версію"
|
||
|