lazarus/languages/lazaruside.id.po

22539 lines
613 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: Lazarus 1.x\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2007-09-22 01:16+0700\n"
"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
"Language-Team: Indonesian <ade999@gmail.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr ""
#: lazarusidestrconsts.cocoamfstbijumpback
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr ""
#: lazarusidestrconsts.cocoamfstbijumpforward
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr ""
#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Paste"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Umum"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Hanya Baca"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Huruf kecil, huruf pertama besar"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr ""
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Baris"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level 1"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level 2"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level 3"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level 4"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level 5"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level 6"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level 7"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level 8"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level 9"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Selected text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Tambah titik koma"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Sesuaikan baris atas karena komentar di depan"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Secara alfabetik"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr ""
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Aksi file tidak jelas:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Peringatan saat kompilasi"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr ""
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
#, fuzzy
#| msgid "Application Settings"
msgid "Application settings"
msgstr "Seting Aplikasi"
#: lazarusidestrconsts.dlgassertcode
#, fuzzy
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "Sertakan Kode Assertion"
#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr ""
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Otomatis-buat form:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr ""
#: lazarusidestrconsts.dlgautocreatenewforms
#, fuzzy
#| msgid "When creating new forms, add them to auto-created forms"
msgid "Auto-create new forms"
msgstr "ketika pembuatan form baru, tambahkan ke otomatis-buat form"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Otomatis menghapus file"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr ""
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr ""
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr ""
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Otomatis mengganti nama file ke huruf kecil"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr ""
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Form tersedia:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr ""
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Latar belakang"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(tidak ada sub direktori)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Nama sama (dalam subdirektori)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Disamping metode"
#: lazarusidestrconsts.dlgblockgroupoptions
#, fuzzy
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Pemilihan"
#: lazarusidestrconsts.dlgblockindent
#, fuzzy
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "Indent blok"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr ""
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr ""
#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr ""
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr ""
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Secondary carets (multi-caret mode)"
msgstr ""
#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr ""
#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr ""
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Main or primary caret"
msgstr ""
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr ""
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Uji"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Urutan Class"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Terakhir"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "huruf kecil"
#: lazarusidestrconsts.dlgcdtpreview
#, fuzzy
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "Peninjauan (Maks panjang baris = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefiks Read"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Akhiran Stored"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "HURUF BESAR"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefiks Variable"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefiks Write"
#: lazarusidestrconsts.dlgcharcasefileact
#, fuzzy
#| msgid "Save As - auto rename pascal files lower case"
msgid "Save As - auto rename Pascal files lower case"
msgstr "Simpan Sebagai - otomatis mengganti nama file pascal ke huruf kecil"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Pilih file template kode (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Tampilkan tombol tutup dalam notebook"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Skema Warna"
#: lazarusidestrconsts.dlgcmacro
#, fuzzy
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "Gaya Makro C (global)"
#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use ansi strings"
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Gunakan Ansi Strings"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr ""
#: lazarusidestrconsts.dlgcocfgcmpmessages
#, fuzzy
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Pesan"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""
#: lazarusidestrconsts.dlgcocops
#, fuzzy
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Operator Gaya C (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Buat Makefile"
#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Debugging:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Tambahan path Debugger (tidak ada):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Pembuatan Kode"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "hasilkan Info Debugging untuk GDB (Kompilasi Lambat)"
#: lazarusidestrconsts.dlgcoheaptrc
#, fuzzy
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Gunakan Unit Heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
#, fuzzy
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "File Include (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Debugger info"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Pustaka (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Penggabungan"
#: lazarusidestrconsts.dlgcoloadsavehint
#, fuzzy
#| msgid "Load/Save"
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Ambil/Simpan"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Warna"
#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parameter baris perintah (tanpa nama aplikasi)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr ""
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Lengkapi properti"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr ""
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""
#: lazarusidestrconsts.dlgconfigfiles
#, fuzzy
#| msgid "Config Files:"
msgid "Config files"
msgstr "File Konfig:"
#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr ""
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Kelebihan"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Penguraian"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Jangkauan"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""
#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Tampilkan Opsi"
#: lazarusidestrconsts.dlgcosmartlinkable
#, fuzzy
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "Linkable Pintar"
#: lazarusidestrconsts.dlgcosources
#, fuzzy
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Sumber Lain (file .pp/.pas, hanya digunakan oleh IDE bukan oleh kompilator)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Tumpukan"
#: lazarusidestrconsts.dlgcostrip
#, fuzzy
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "Hilangkan Simbol Dari Eksekutabel"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf 2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf 2 with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf 3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
#, fuzzy
#| msgid "Unit Style"
msgid "Unit style"
msgstr "Gaya Unit:"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Hasilkan kode untuk valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""
#: lazarusidestrconsts.dlgcppinline
#, fuzzy
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "Gaya C++ INLINE"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr ""
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kursor setelah EOL"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Ekstensi ditetapkan pemakai (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Path dan Tipe Debugger"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Font editor default"
#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr ""
#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr ""
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Nilai default"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr ""
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Hapus"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr ""
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Hapus template"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr ""
#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Arah"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr ""
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Kembali"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tebal"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sub direktori"
#: lazarusidestrconsts.dlgedcodetempl
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Template kode"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr ""
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Ekstensi ditetapkan pemakai"
#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr ""
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Tampilan"
#: lazarusidestrconsts.dlgedfiles
#, fuzzy
#| msgid "Editor files"
msgid "Editor Files"
msgstr "File Editor"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Pelengkapan pengenal"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Miring"
#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr ""
#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr ""
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opsi Editor"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""
#: lazarusidestrconsts.dlgedmisc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Lain-lain"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Garis bawah"
#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr ""
#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr ""
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Tanya"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Catatan: File Proyek adalah semua file dalam direktori proyek"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "File"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grid"
#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr ""
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Bahasa"
#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr ""
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Garis Pemandu"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Lain-lain"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Tidak ada"
#: lazarusidestrconsts.dlgenvotherfiles
#, fuzzy
#| msgid "Other files"
msgid "Other Files"
msgstr "File Lain"
#: lazarusidestrconsts.dlgenvproject
#, fuzzy
#| msgid "Project"
msgid "Tabs for project"
msgstr "Proyek"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr ""
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "baris spasi ekstra"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external debug symbols file"
msgstr ""
#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Ekstensi file"
#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr ""
#: lazarusidestrconsts.dlgfilterall
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Semua file"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Proyek Delphi"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr ""
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Seting Desktop Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusfile
#, fuzzy
#| msgid "Lazarus File"
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "File Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusform
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Form Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "File include Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazaruspackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Paket Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Proyek Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Sumber proyek Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Unit Lazarus"
#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr ""
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr ""
#: lazarusidestrconsts.dlgfilterxml
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "File XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Cari teks di kursor"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr ""
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr ""
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Warna latar depan"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Kebijakan penyisipan Procedure"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Biarkan urutan dari procedure"
#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr ""
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Direktori sumber FPC"
#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr ""
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor Form"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
msgid "From c&ursor"
msgstr ""
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Hasilkan kode untuk gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Warna Penggengam"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr ""
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Warna grid"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr ""
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Besar grid X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Besar langkah grid horisontal"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Besar grid Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Besar langkah grid vertikal"
#: lazarusidestrconsts.dlggroupcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Eksplorer Kode"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Lingkungan"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Undi Grup"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Tampilkan Garis Pemandu"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr ""
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Warna saluran"
#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr ""
#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr ""
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Gulung setengah halaman"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
#, fuzzy
#| msgid "Heap Size"
msgid "Heap size"
msgstr "Besar Heap"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr ""
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Tinggi:"
#: lazarusidestrconsts.dlghideideonrun
#, fuzzy
#| msgid "Hide IDE windows on run"
msgid "Hide IDE windows on Run/Debug"
msgstr "Sembunyikan jendela IDE saat menjalankan"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr ""
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
#, fuzzy
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Tampilkan Petunjuk untuk parameter \"Sender\" tidak digunakan"
#: lazarusidestrconsts.dlghintsunused
#, fuzzy
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "Tampilkan Petunjuk untuk unit yang tidak digunakan dalam sumber utama"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Kunci Home melompat ke awal terdekat"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Aplikasi Induk"
#: lazarusidestrconsts.dlgiahadentifiercomplentryabstractprocfunc
msgid "Abstract proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrycodetemplate
msgid "Template"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryconst
msgid "Const"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryenum
msgid "Enum"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryfunc
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryfunc"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryident
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryident"
msgid "Identifier"
msgstr "Pengenal"
#: lazarusidestrconsts.dlgiahadentifiercomplentrykeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrykeyword"
msgid "Keyword"
msgstr "Kata kunci"
#: lazarusidestrconsts.dlgiahadentifiercomplentrylabel
msgid "Label"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrylowervisibilityprocfunc
msgid "Lower visibility proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrynamespace
msgid "Namespace"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryother
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryother"
msgid "Other"
msgstr "Lainnya"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryproc"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproperty
msgid "Property"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrytext
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytext"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlgiahadentifiercomplentrytype
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.dlgiahadentifiercomplentryunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryunit"
msgid "Unit"
msgstr "Unit"
#: lazarusidestrconsts.dlgiahadentifiercomplentryvar
msgid "Var"
msgstr ""
#: lazarusidestrconsts.dlgidentifiercompletion
#, fuzzy
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Pelengkapan pengenal"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Kebijakan pengenal"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr ""
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr ""
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr ""
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Sertakan variabel sistem"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr ""
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Di depan metode"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Nama Constructor harus 'init' (destructor harus 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Sisipkan spasi setelah"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Sisipkan spasi di depan"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval dalam detik"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Lompatan (contoh Lompatan Metode)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr ""
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Pemetaan Kunci"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Pemetaan kunci salah"
#: lazarusidestrconsts.dlgkeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgkeyword"
msgid "Keyword"
msgstr "Kata kunci"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Kebijakan Kata kunci"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Ijinkan LABEL dan GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Bahasa"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Terakhir (contoh di akhir dari sumber)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Direktori Lazarus (default untuk semua proyek)"
#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr ""
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "warna untuk kiri, atas"
#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "Level 1 (quick and debugger friendly)"
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "Tingkat 1 (cepat dan ramah debugger)"
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "3 (slow optimizations)"
msgid "3 (-O2 + slow optimizations)"
msgstr "Tingkat 3 (Tingkat 2 + optimasi lambat)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra optimizations)"
msgid "0 (no optimization, for debugging)"
msgstr "Tingkat 0 (tidak ada Optimasi ekstra)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Pemisahan Baris"
#: lazarusidestrconsts.dlglinksmart
#, fuzzy
#| msgid "Link Smart"
msgid "Link smart"
msgstr "Link Pintar"
#: lazarusidestrconsts.dlglnumsbct
#, fuzzy
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "Tampilkan Nomor Baris dalam Penelusuran Kesalahan Run-time"
#: lazarusidestrconsts.dlgmainviewforms
#, fuzzy
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "Lihat form proyek"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr ""
#: lazarusidestrconsts.dlgmainviewunits
#, fuzzy
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Lihat unit proyek"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr ""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margin dan saluran"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Warna Penanda"
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr ""
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Hapus"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nama"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key mappings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr ""
#: lazarusidestrconsts.dlgmatchwords
msgid "Match words"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Penghitung maksimum"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maks panjang baris:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maks file terbaru"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr ""
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maks file proyek terbaru"
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr ""
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr ""
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Campur metode dan properti"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr ""
#: lazarusidestrconsts.dlgmodifier
msgid "Modifier"
msgstr ""
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Left"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Urutan"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Teks"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Pemilihan"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Salah"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Pilihan Multi"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr ""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Penamaan"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr ""
#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Tanpa otomatis penggantian nama"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
#, fuzzy
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "Jangan pisah baris setelah:"
#: lazarusidestrconsts.dlgnotsplitlinefront
#, fuzzy
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "Jangan pisah baris Di depan dari:"
#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr ""
#: lazarusidestrconsts.dlgobjinsp
#, fuzzy
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspektor Obyek"
#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "Tinggi item"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Lain-lain"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrap
msgid "Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapdisplaycaretatwrappositio
msgid "Display caret at wrap-position..."
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapendofline
msgid "end of line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapminimumlinelength
msgid "Minimum line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapstartofnextline
msgid "start of next line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapusewordwrap
msgid "Use Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""
#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgid "Other unit files (-Fu):"
msgstr "File Unit Lain (-Fu) (Pemisah adalah titik koma):"
#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr ""
#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr ""
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr ""
#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Petunjuk untuk palet komponen"
#: lazarusidestrconsts.dlgpasext
#, fuzzy
#| msgid "Default pascal extension"
msgid "Default Pascal extension"
msgstr "Ekstensi pascal default"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass options to linker (delimiter is space)"
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Opsi Operan Ke Penggabung (Pemisah adalah spasi)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Default"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Tidak ada"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr ""
#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikasi"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr ""
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts.dlgpodebugger
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Forms"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""
#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr ""
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr ""
#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness (Windows 10 1607+)"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Lain-lain"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr ""
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sesi"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Judul:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
msgid "Use Application Bundle for running and debugging"
msgstr "Gunakan Bundel Aplikasi untuk menjalankan dan debugging (hanya darwin)"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "Gunakan file manifest untuk menghidupkan tema (hany windows)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr ""
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr ""
#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
#, fuzzy
#| msgid "Project files"
msgid "Project Files"
msgstr "File Proyek"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr ""
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Melengkapi properti"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nama properti"
#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "Buka proyek terakhir saat mulai"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Tampilan ruang batas"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Tampilkan grid"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Menempel ke grid"
#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr ""
#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr ""
#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr ""
#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr ""
#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr ""
#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr ""
#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr ""
#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr ""
#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referensi"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr ""
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr ""
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Ganti nama"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Ganti &Semua"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace with"
msgid "Replace wit&h"
msgstr "&Ganti Dengan"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Laporan"
#: lazarusidestrconsts.dlgreset
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.dlgresetactivedesktopbtncaption
msgid "Restore active"
msgstr ""
#: lazarusidestrconsts.dlgresetactivedesktopbtnhint
msgid "Restore window layout of active desktop"
msgstr ""
#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr ""
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "warna untuk kanan, bawah"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Klik Kanan memilih"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margin kanan"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Direktori Pekerjaan"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Pembuatan"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Pemilihan"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Tampilan (tidak untuk win32, contoh 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Lingkungan"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokal"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variabel sistem"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Gunakan tampilan"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Penolakan pemakai"
#: lazarusidestrconsts.dlgrunparameters
#, fuzzy
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "Parameter Menjalankan"
#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr ""
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Simpan info editor untuk file yang ditutup"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Simpan info editor hanya untuk file proyek"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr ""
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Gulung dengan kurang satu"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr ""
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Tampilkan petunjuk menggulung"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Gulung ke akhir file"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Allow Caret to move past the end of line"
msgstr "Gulung ke akhir baris"
#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Pencarian dibatalkan oleh pemakai."
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "Pencarian..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Path"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr ""
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr ""
#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr ""
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Set semua elemen ke default"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Set elemen ke default"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Set property Variable"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr ""
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Tampilkan procedure yang dikompilasi"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
#, fuzzy
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Tampilkan nomor baris"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Tampilkan kondisional"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Tampilkan info debug"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr ""
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr ""
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Tampilkan apapun"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Tampilkan info eksekutabel (hanya Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Tampilkan info umum"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Tampilkan petunjuk saluran"
#: lazarusidestrconsts.dlgshowhint
#, fuzzy
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Tampilkan Petunjuk"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr ""
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Tampilkan nomor baris"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
#, fuzzy
#| msgid "Show Notes"
msgid "Show notes"
msgstr "Tampilkan Catatan"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Tampilkan file yang dicoba"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Tampilkan file yang digunakan"
#: lazarusidestrconsts.dlgshowwarnings
#, fuzzy
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "Tampilkan Peringatan"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tab pintar"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Simbol dibelakang (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Penghitung (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Simbol didepan (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Menempel ke Garis Pemandu"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr ""
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr ""
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spasi"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Petunjuk untuk tombol cepat utama (buka, simpan, ...)"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Asalnya"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Hentikan setelah sejumlah kesalahan:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opsi sintaks"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab memajukan blok"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tab ke spasi"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""
#: lazarusidestrconsts.dlgtargetos
#, fuzzy
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Target OS"
#: lazarusidestrconsts.dlgtargetplatform
#, fuzzy
#| msgid "Target Platform"
msgid "Target platform"
msgstr "Target Platform:"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Direktori untuk pembangunan proyek tes"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr ""
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "&Teks yang Dicari"
#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr ""
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Hapus sisa spasi"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Undo setelah menyimpan"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Batas Undo"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Segarkan"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Direktori output unit (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Lipatan kode"
#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr ""
#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr ""
#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr ""
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr ""
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
#, fuzzy
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Gunakan File Konfig Kompilator standar (fpc.cfg)"
#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr ""
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr ""
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Gunakan aplikasi peluncuran"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr ""
#: lazarusidestrconsts.dlguseschemedefaults
msgid "- Scheme globals -"
msgstr ""
#: lazarusidestrconsts.dlguseschemelocal
msgid "selected language"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Gunakan penerangan sintaks"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Nilai"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Perlihatkan selama kompilasi:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Nampak saluran"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Nampak margin kanan"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Panjang:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Jendela"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Kata"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Peninjauan"
#: lazarusidestrconsts.dlgwritefpclogo
#, fuzzy
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "Tulis logo FPC"
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr ""
#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr ""
#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr ""
#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr ""
#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr ""
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Pemilihan multi komponen harus dari form tunggal."
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Penilihan penghapusan"
#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Cerminkan horisontal"
#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Cerminkan vertikal"
#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Mundur satu"
#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Maju satu"
#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Pindahkan ke belakang"
#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Pindahkan ke depan"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "Simpan form sebagai xml"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skala"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Pilih Semua"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Ukuran"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opsi: Menempel ke grid"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opsi: Menempel ke garis pemandu"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""
#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr ""
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugcurrent
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr ""
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr ""
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugignore
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr ""
#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugnew
#, fuzzy
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Baru"
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Tambah File"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipe Karuhun Dwimakna"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nama Class Dwimakna"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nama Unit Dwimakna"
#: lazarusidestrconsts.lisa2pancestortype
#, fuzzy
#| msgid "Ancestor Type"
msgid "Ancestor type"
msgstr "Tipe Karuhun"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dependensi Rusak"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Nama Class sudah ada"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dependensi"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr ""
#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "File sudah ada"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "File sudah digunakan"
#: lazarusidestrconsts.lisa2pfilename2
#, fuzzy
#| msgid "Filename"
msgid "Filename/URL"
msgstr "Nama file"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "File bukan unit"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr ""
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr ""
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipe Karuhun tidak benar"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nama Class tidak benar"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "File tidak benar"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nama file tidak benar"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nama Unit tidak benar"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format, fuzzy, badformat
#| msgid "%s%s%s is not a valid unit name."
msgid "\"%s\" is not a valid unit name."
msgstr "%s%s%s bukan nama unit yang benar."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nama class baru:"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "File Baru"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format, fuzzy, badformat
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Tidak ada paket ditemukan untuk dependensi %s%s%s.%sSilahkan pilih paket yang sudah ada."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr ""
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nama Halaman terlalu panjang"
#: lazarusidestrconsts.lisa2ppalettepage
#, fuzzy
#| msgid "Palette Page:"
msgid "Palette page:"
msgstr "Halaman Palet:"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Nama file pendek atau panjang"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Tampilkan semua"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format, fuzzy, badformat
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Tipe karuhun %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format, fuzzy, badformat
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Tipe karuhun %s%s%s bukan pengenal pascal yang benar."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Nama class %s%s%s dan tipe karuhun %s%s%s sama."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Nama class %s%s%s sudah ada dalam%sPaket %s%s%sFile: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Nama class %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Nama class %s%s%s bukan pengenal pascal yang benar."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "File %s%s%s adalah bagian dari proyek saat ini.%sAdalah ide buruk untuk membagi file diantara proyek dan paket."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format, fuzzy, badformat
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Nama file %s%s%s dwimakna, karena paket belum mempunyai direktori default. %sSilahkan tetapkan nama file dengan path penuh."
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
#, fuzzy
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format, fuzzy, badformat
#| msgid "The package already has a dependency on the package %s%s%s."
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Paket sudah mempunyai dependensi untuk paket %s%s%s."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format, fuzzy, badformat
#| msgid "The page name %s%s%s is too long (max 100 chars)."
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Nama halaman %s%s%s terlalu panjang (maks 100 karakter)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Nama unit %s%s%s sudah ada dalam paket:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The unitname %s%s%s already exists in this package."
msgid "The unitname \"%s\" already exists in this package."
msgstr "Nama unit %s%s%s sudah ada dalam paket ini."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Nama unit %s%s%s dan nama file %s%s%s berbeda."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Nama unit %s%s%s sama dengan komponen terdaftar.%sMenggunakan ini bisa menyebabkan pesan kesalahan aneh."
#: lazarusidestrconsts.lisa2punitname
#, fuzzy
#| msgid "Unit Name:"
msgid "Unit name:"
msgstr "Nama Unit:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nama unit sudah ada"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Batalkan semua pengambilan"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Batalkan pengambilan proyek"
#: lazarusidestrconsts.lisabout
#, fuzzy
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Tentang"
#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Tentang Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Lisensi: GPL/LGPL%sLazarus adalah IDE untuk membuat aplikasi (grafis dan konsol) dengan Free Pascal. Free Pascal adalah (L)GPL kompilator Pascal dan Object Pascal yang berjalan pada Windows, Linux, Mac OS X, FreeBSD dan banyak lagi.%sLazarus adalah bagian yang hilang dari teka-teki yang akan membolehkan anda mengembangkan program untuk semua platform di atas dalam lingkungan mirip Delphi. IDE adalah piranti RAD yang menyertakan desainer formulir.%sKarena Lazarus berkembang kami memerlukan lebih banyak para pengembang."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Tidak menemukan daftar kontributor."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format, fuzzy
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "%s tidak bisa menampung TControls.%sAnda hanya bisa menaruh komponen visual diatasnya."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Pengakuan"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktifkan aturan ekspresi reguler untuk teks dan penggantian (mirip sekali dengan perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr ""
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr ""
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr ""
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr ""
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr ""
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""
#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr ""
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""
#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "Tambah %s ke proyek?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr ""
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""
#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
#, fuzzy
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "Tambah file ke paket"
#: lazarusidestrconsts.lisaf2pdestinationpackage
#, fuzzy
#| msgid "Destination Package"
msgid "Destination package"
msgstr "Paket Tujuan"
#: lazarusidestrconsts.lisaf2pfiletype
#, fuzzy
#| msgid "File Type"
msgid "File type"
msgstr "Tipe File"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Paket Tidak benar"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format, fuzzy, badformat
#| msgid "Invalid package ID: %s%s%s"
msgid "Invalid package ID: \"%s\""
msgstr "ID paket tidak benar: %s%s%s"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Paket hanya baca"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "Package %s%s%s not found."
msgid "Package \"%s\" not found."
msgstr "Paket %s%s%s tidak ditemukan."
#: lazarusidestrconsts.lisaf2pshowall
#, fuzzy
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Tampilkan Semua"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "Paket %s hanya baca."
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Penjajaran"
#: lazarusidestrconsts.lisallblockslooksok
#, fuzzy
#| msgid "All blocks looks ok."
msgid "All blocks look ok."
msgstr "Seluruh blok terlihat ok."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""
#: lazarusidestrconsts.lisalloptions
#, object-pascal-format
msgid "All options of FPC%s (\"%s\")"
msgstr ""
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Ijinkan pencarian untuk multipel baris"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalreadycontainsthehe
#, object-pascal-format
msgid ""
"%s already contains the help:\n"
"%s"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "File dwimakna ditemukan"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format, fuzzy, badformat
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "File yang tidak jelas ditemukan: %s%s%s%sFile ini mungkin salah dengan %s%s%s%s%sHapus file tidak jelas?"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor Anchor - tidak ada kontrol dipilih"
#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Anchor dari kontrol yang dipilih"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format, fuzzy, badformat
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Kesalahan terjadi saat terakhir startup ketika mengambil %s!%s%sAmbil proyek ini lagi?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr ""
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Terapkan"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "Apply build flags (-B) to dependencies too."
msgstr ""
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Batas spasi sekeliling kontrol. Batas spasi ke empat lainnya ditambahkan ke nilai ini"
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Tanya sebelum mengganti setiap teks yang ditemukan"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr ""
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Fitur otomatis"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Mem-backup file gagal"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Pengubahan nama paket atau versi memisahkan dependensi. Apakah dependensi ini diubah juga?%sPilih Ya untuk mengubah semua dependensi terdaftar.%sPilih Abaikan untuk memisahkan dependensi dan melanjutkan."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "mulai"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "Be less verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "Be more verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
#, fuzzy
#| msgid "Always Build before Run"
msgid "Always build before run"
msgstr "Selalu Membangun sebelum Dijalankan"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Perintah Bangun"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Saat membangun proyek sebaliknya menjalankan perintah Bangun File"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Saat menjalankan proyek sebaliknya menjalankan perintah Jalankan File"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Jalankan Perintah"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
#, fuzzy
#| msgid "When this file is active in source editor ..."
msgid "When this file is active in source editor"
msgstr "Ketika file ini aktif dalam editor sumber ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
#, fuzzy
#| msgid "Working directory (Leave empty for file path)"
msgid "Working directory (leave empty for file path)"
msgstr "Direktori kerja (biarkan kosong untuk path file)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "BatasSpasi"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Batas spasi Bawah. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dibawah kontrol."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Anchor Bawah"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bawah"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ini adalah kontrol terdekat dimana sisi bawah dianchor. Biarkan kosong untuk parent."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Bawah spasi secara sama"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr ""
#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr ""
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Tutup"
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr ""
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""
#: lazarusidestrconsts.lisbtnquit
#, fuzzy
#| msgid "Quit"
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "Keluar"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Hapus"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr ""
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Bangun"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "Build all files of project/package/IDE."
msgstr ""
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Bangun"
#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr ""
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr ""
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""
#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build mode"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Bangun proyek baru"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "Angka Buatan"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Bangun"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr ""
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Batalkan pengambilan komponen ini"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Batalkan pengambilan unit"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Batalkan penggantian nama"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
#, fuzzy
#| msgid "Can not copy top level component."
msgid "Cannot copy top level component."
msgstr "Tidak bisa meng-copy komponen tingkat teratas."
#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format, fuzzy, badformat
#| msgid "Cannot create file %s%s%s"
msgid "Cannot create file \"%s\""
msgstr "Tidak bisa membuat file %s%s%s"
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr ""
#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr ""
#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format, fuzzy
#| msgid "Cannot find lazarus starter:%s%s"
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Tidak bisas menemukan starter lazarus:%s%s"
#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Hanya bisa mengubah kelas dari TComponents."
#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr ""
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr ""
#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""
#: lazarusidestrconsts.liscefilter
#, fuzzy
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(Filter)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Mengikuti kursor"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
#, fuzzy
#| msgid "Center control horizontally relative to the given sibling"
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Tengahkan kontrol secara horisontal relatif ke yang terdekat"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
#, fuzzy
#| msgid "Center control vertically relative to the given sibling"
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Tengahkan kontrol secara vertikal relatif ke yang terdekat"
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr ""
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Tengah dalam jendela"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Tengah"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr ""
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Tidak pernah, hanya secara manual"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Saat menganggur"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Segarkan secara otomatis"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Lainnya"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Mutahirkan"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Saat menukar file dalam editor sumber"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr ""
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Ubah"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Ubah Kelas"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change Parent..."
msgid "Change Parent"
msgstr "Ubah leluhur ..."
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ""
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ""
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr ""
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Pilih nama yang berbeda"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr ""
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr ""
#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr ""
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr ""
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Pilih unit Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Pilih direktori"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr ""
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Pilih direktori sumber FPC"
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Pilih Direktori Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr ""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Pilih satu dari item-item ini untuk membuat File baru"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Pilih satu dari item-item ini untuk membuat Paket baru"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Pilih satu dari item-item ini untuk membuat Proyek baru"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Pilih sumber program (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Pilih struktur untuk menyertakan pilihan"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format, fuzzy, badformat
#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Class %s%s%s tidak terdaftar sebagai kompnen class.%sTidak bisa mem- paste."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Class tidak ditemukan"
#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Bersihkan Direktori"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Bersihkan sub direktori"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Biarkan semua file teks"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Biarkan file yang memenuhi filter"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Hapus file yang memenuhi filter"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintaks Sederhana (contoh. * instead of .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Bersihkan Sumber Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr ""
#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "bersihkan path unit?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Clear"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr ""
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr ""
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Tutup"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opsi khusus Antarmuka LCL"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "File konfig kompilator tambahan tidak jelas"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Panggilan pada:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format, fuzzy
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sKlik OK jika anda yakin akan melakukannya."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Perintah:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""
#: lazarusidestrconsts.liscodebrowser
#, fuzzy
#| msgid "Code browser"
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Browser Kode"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr ""
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Tambah path"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
#, fuzzy
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Browse"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Hapus path"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""
#: lazarusidestrconsts.liscodehelperrorstag
#, fuzzy
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Salah"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Contoh"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Sisipkan tag format kode"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Sisipkan tag format miring"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Sisipkan tag format catatan"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Sisipkan tag format garis bawah"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Sisipkan tag format var"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Diturunkan"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<TIDAK ADA>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Lihat juga"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Pendek"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Tambah"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Tambah template kode"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr ""
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentar:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Edit template kode"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Salah"
#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr ""
#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr ""
#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr ""
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Aksi: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format, fuzzy
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Node otomatis dibuat tidak bisa diedit,%stidak juga mempunyai node anak yang tidak otomatis dibuat."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, otomatis dibuat"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "Node yang otomatis dibuat tidak bisa diedit."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor Definisi CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "path kompilator"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konversi node"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Buat Defines untuk Direktori %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Buat Defines untuk Kompilator Free Pasal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
#, fuzzy
#| msgid "Create Defines for Free Pascal SVN Sources"
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Buat Defines untuk Sumber Free Pascal SVN"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Buat Defines untuk Proyek %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Buat Makro FPC dan path untuk direktori proyek fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definiskan"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definisikan Berulang"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Hapus node"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Direktori utama %s, %sdimana Borland telah menginstalasi semua sumber %s.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Deskripsi:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "direktori %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
#, fuzzy
#| msgid "FPC SVN source directory"
msgid "FPC Git source directory"
msgstr "Direktori sumber FPC SVN"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Direktori"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Sisipkan Template Proyek Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Sisipkan Template Proyek Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Sisipkan Template Proyek Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Sisipkan Template Kompilator Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Sisipkan Template Proyek Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
#, fuzzy
#| msgid "Insert Free Pascal SVN Source Template"
msgid "Insert Free Pascal Git Source Template"
msgstr "Sisipkan Template Sumber SVN Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Sisipkan Template Kompilator Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Sisipkan Template Direktori Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Sisipkan Template Proyek Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Sisipkan node sebagai anak"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Sisipkan node dibawah"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Sisipkan Template"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Induk tidak benar"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Node induk tidak benar"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Node sebelumnya tidak benar"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s.%sContoh: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Turunkan node"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Turunkan node selangkah"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Naikkan node selangkah"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Naikkan node"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nama:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NodeBaru"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Node hanya-baca"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "tidak ada yang dipilih"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
#, fuzzy
#| msgid "Parent node can not contain child nodes."
msgid "Parent node cannot contain child nodes."
msgstr "Node induk tidak bisa berisi node anak."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Node sebelumnya tidak bisa berisi anak node."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
#, fuzzy
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Direktori proyek"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "Direktori proyek %s"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Node Terpilih:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "Direktori sumber Free Pascal SVN. Tidak diperlukan. Ini akan meningkatkan pencarian deklarasi dan debugging."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Direktori proyek Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
#, fuzzy
#| msgid "The Free Pascal SVN source directory."
msgid "The Free Pascal Git source directory."
msgstr "Direktori sumber Free Pascal SVN."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format, fuzzy
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Path ke kompilator free pascal. %s Sebagai contoh %s/usr/bin/%s -n%s atau %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "Path ke kompilator free pascal. Hanya diperlukan jika anda menset sumber FPC SVN dibawah ini. Digunakan untuk pembuatan makro otomatis."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Direktori proyek %s,%syang berisi file .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Tidak didefiniskan"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Tidak didefinisikan Semua"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Tidak didefinisikan Berulang"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Nilai sebagai Teks"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabel:"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Di"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Titik dua"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Koma"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Pengenal"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgctxt "lazarusidestrconsts.liscodetoolsoptskeyword"
msgid "Keyword"
msgstr "Kata kunci"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Baris baru"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Tidak ada"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nomor"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Titik"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Titik koma"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spasi"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Konstan string"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Simbol"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Jalankan setelah"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Jalankan sebelum"
#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All [Ctrl+Minus]"
msgstr ""
#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Sempitkan semua kelas"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Sempitkan semua paket"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Sempitkan semua unit"
#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr ""
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parameter baris perintah dari program"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Kompilasi"
#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr ""
#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr ""
#: lazarusidestrconsts.liscompilepackagetwiceandcheckifanyunitwascompiledaga
msgid "Compile package twice and check if any unit was compiled again."
msgstr ""
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Kompilator"
#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr ""
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr ""
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Salah: kompilator tidak benar: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nama file kompilator"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Petunjuk: anda bisa menset path kompilator dalam Lingkungan->Opsi Lingkungan->File->Path Kompilator"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "CATATAN: file konfig codetools tidak ditemukan - menggunakan default"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "CATATAN: pengambilan file opsi codetools lama:"
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Kompilasi"
#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr ""
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (kompilasi ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format, fuzzy, badformat
#| msgid "Component name %s%s%s is keyword"
msgid "Component name \"%s\" is keyword"
msgstr "Nama kompionen %s%s%s adalah kata kunci"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Buka paket"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Buka unit"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr ""
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr ""
#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Uji"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Direktori konfig Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Konfigurasi Pembangunan %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr ""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Konfirmasi perubahan"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format, fuzzy, badformat
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Anda ingin membangun ulang Lazarus?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""
#: lazarusidestrconsts.lisconfirmreplace
msgid "Confirm Replace"
msgstr ""
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Aplikasi Konsol"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "berisi"
#: lazarusidestrconsts.liscontents
#, fuzzy
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Isi"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Lanjutkan tanpa pengambilan form"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Kontributor"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Kontrol membutuhkan leluhurnya"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr ""
#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr ""
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr ""
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr ""
#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""
#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""
#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Konversi salah"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr ""
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr ""
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr ""
#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr ""
#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr ""
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr ""
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr ""
#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Tidak ada"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.liscoolbarcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Eksplorer Kode"
#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Template kode"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr ""
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""
#: lazarusidestrconsts.liscoolbarmessages
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Pesan"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourceeditor
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Editor Sumber"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr ""
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Copy salah"
#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr ""
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr ""
#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Meng-copy seluruh form tidak diimplementasikan."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#, fuzzy
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "Copy pesan yang dipilih ke clipboard"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Cari pesan FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Cari pesan Make"
#: lazarusidestrconsts.liscoskipcallingcompiler
#, fuzzy
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "Lewati pemanggilan Kompilator"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Peringatan: file konfig kompilator tambahan mempunyai nama sama, seperti salah satu dari nama file konfig standar yang dicari kompilator FreePascal. Ini bisa berhasil HANYA penguraian konfig tambahan dan melewatkan konfig standar."
#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Buka Paket %s"
#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Buka Unit %s"
#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ""
#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Buat proyek dulu!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr ""
#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Pilih Direktori"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Nilai Direktori CodeTools"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definisikan template"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<tidak ada variabel dipilih>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Buka Peninjauan"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Piranti"
#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Variabel: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nama Variabel"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Template"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "silahkan pilih makro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Pilih Makro Kode"
#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr ""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Kolom kursor dalam editor saat ini"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Baris kursor dalam editor saat ini"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "opsi kustom"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opsi Kustom"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Program Kustom"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Debugger tidak ditetapkan"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Tetap set titikpisah"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format, fuzzy
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Tidak ada debugger ditetapkan.%sSeting titikpisah tidak berpengaruh sampai anda menyiapkan Debugger dalam opsi dialog debugger dalam menu."
#: lazarusidestrconsts.lisdebug
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr ""
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format, fuzzy, badformat
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Kesalahan Debugger%sOoops, debugger masuk ke keadaan salah%sSimpan pekerjaan anda sekarang !%sTekan Hentikan, dan harapan terbaik, kami mencabut colokan."
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger tidak benar"
#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (debugging ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Tambahan path pencarian"
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Titik pisah"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "bersihkan log saat dijalankan"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opsi umum Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opsi spesifik Debugger (tergantung pada tipe dari debugger)"
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Log Event"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Ditangani oleh"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Ditangani oleh Debugger"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Ditangani oleh Program"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Abaikan eksepsi ini"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Eksepsi Bahasa"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "Batasi hitungan baris ke"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmname
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Nama:"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Eksepsi OS"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Output"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proses"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Tampilkan pesan saat berhenti"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Sinyal"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Tidak bisa mengambil file"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to load file %s%s%s."
msgid "Unable to load file \"%s\"."
msgstr "Tidak bisa mengambil file %s%s%s."
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Default"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr ""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr ""
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr ""
#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Hapus semua file ini?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Hapus file yang tidak jelas?"
#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format, fuzzy, badformat
#| msgid "Delete old file %s%s%s?"
msgid "Delete old file \"%s\"?"
msgstr "Hapus file lama %s%s%s?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr ""
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr ""
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr ""
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Direktori Tujuan"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""
#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Huruf Diabaikan"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Abaikan jika baris kosong saat ditambahkan atau dihapus"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Abaikan perbedaan dalam akhir baris (contoh. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Abaikan besar dari karakter spasi"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Abaikan spasi (karakter baris baru tidak disertakan)."
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Abaikan spasi diakhir baris"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Abaikan spasi diawal baris"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Hanya pilihan"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
#, fuzzy
#| msgid "Open Diff in editor"
msgid "Open difference in editor"
msgstr "Buka Diff dalam editor"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktif"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr ""
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Abaikan perubahan"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klik pada salah satu item diatas untuk melihat perbedaan"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Kesalahan pembacaan file: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Beberapa file telah berubah pada disk:"
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr ""
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Bedakan huruf besar dan kecil contoh A dan a"
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""
#: lazarusidestrconsts.lisdlgedit
#, fuzzy
#| msgid "Edit..."
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Edit..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Ekspor ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr ""
#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr ""
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "Do not check if another IDE instance is already running."
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Jangan tutup proyek"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "Do not compile dependencies."
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
#, fuzzy
#| msgid "Do not show splash screen"
msgid "Do not show splash screen."
msgstr "Jangan tampilkan layar splash"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""
#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Turun"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr ""
#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr ""
#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copy komponen yang dipilih ke clipboard"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Potong komponen yang dipilih ke clipboard"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Pindahkan komponen selangkah kebelakang"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Pindahkan komponen selangkah kedepan"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Pindahkan komponen ke belakang"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Pindahkan komponen ke depan"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Paste komponen yang dipilih dari clipboard"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Pilih komponen leluhurnya"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr ""
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr ""
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr ""
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format, fuzzy, badformat
#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Duplikasi nama: Komponen bernama %s%s%ssudah ada dalam komponen inherited %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr ""
#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Edit"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr ""
#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr ""
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Proyek Saat Ini"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Piranti yang benar membutuhkan setidaknya judul dan nama file."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Edit Piranti"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Kunci"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makro"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parameters:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Namafileprogram:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Pindai output untuk pesan Kompilator Free Pascal"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Pindai output untuk pesan make"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Dibutuhkan Nama file dan Judul"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Direktori Kerja:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr ""
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr ""
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr ""
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr ""
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Hidupkan makro"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr ""
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr ""
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr ""
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nama file debugger tidak benar"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "File debugger \"%s\" bukan eksekutabel."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Direktori Tes \"%s\" tidak ditemukan."
#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Opsi tidak benar di posisi %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"
#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Salah:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Kesalahan pembuatan file"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Kesalahan penghapusan file"
#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Kesalahan dalam %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr ""
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr ""
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr ""
#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format
msgid "Error: invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Kesalahan pemindahan komponen"
#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Kesalahan pemindahan komponen %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Pemindaian aliran komponen lfm salah."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format, fuzzy, badformat
msgid "Error reading package list from file%s%s%s%s"
msgstr "Pembacaan daftar paket salah dari file %s%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Kesalahan penggantian nama file"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Salah"
#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ""
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Kesalahan penulisan daftar paket ke file%s%s%s%s"
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Show every n-th line number"
msgstr ""
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr ""
#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr ""
#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr ""
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr ""
#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr ""
#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr ""
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Eksekusi dihentikan"
#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr ""
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Keluar"
#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr ""
#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr ""
#: lazarusidestrconsts.lisexpandall
msgid "Expand All [Ctrl+Plus]"
msgstr ""
#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Lebarkan semua kelas"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Lebarkan semua paket"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Lebarkan semua unit"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nama file lebar dari file editor saat ini"
#: lazarusidestrconsts.lisexport
#, fuzzy
#| msgid "Export ..."
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Ekspor ..."
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr ""
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr ""
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr ""
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list"
msgstr ""
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr ""
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Ekstrak"
#: lazarusidestrconsts.lisextractprocedure
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Ekstraks prosedur"
#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr ""
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "Piranti eksternal"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Piranti Maksimum tercapai"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Terdapat jumlah maksimum %s piranti."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr ""
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr ""
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "File"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""
#: lazarusidestrconsts.lisfilealreadyexists
#, object-pascal-format
msgid "File \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format, fuzzy, badformat
#| msgid "File %s%s%s is virtual."
msgid "File \"%s\" is virtual."
msgstr "File %s%s%s adalah virtual."
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "File tidak ditemukan"
#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format, fuzzy, badformat
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "File %s%s%s tidak ditemukan.%sAnda ingin membuatnya?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "File tidak dengan huruf kecil"
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr ""
#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format
msgid "File %s was converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgid "File where debug output is written to. Default is write to the console."
msgstr "file, dimana output debug ditulisnya. Jika tidak ditetapkan, output debug ditulis ke konsol"
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filter"
#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr ""
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr ""
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr ""
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr ""
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr ""
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr ""
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr ""
#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr ""
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
#, fuzzy
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "Sertakan sub direktori"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "all files in &project"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "all &open files"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "&active file"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "&directories"
msgstr ""
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "project &group"
msgstr ""
#: lazarusidestrconsts.lisfindfilewhere
#, fuzzy
#| msgid "Where"
msgid "Search location"
msgstr "Dimana"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""
#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr ""
#: lazarusidestrconsts.lisfindoverridestoo
msgid "Find overrides too"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Betulkan file LFM"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Paksa penggantian nama"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr ""
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Format salah"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr ""
#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr ""
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr ""
#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr ""
#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr ""
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr ""
#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr ""
#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr ""
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "direktori sumber Freepascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "File tambahan yang dicari (contoh /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Cari atau Ganti nama Pengenal"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Cari Referensi"
#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Pengenal: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "dalam semua paket dan proyek terbuka"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "dalam unit saat ini"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "dalam proyek utama"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "dalam proyek/paket pemilik unit saat ini"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Pengenal tidak benar"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Ganti nama semua Referensi"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr ""
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Cari dalam komentar juga"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr ""
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Umum"
#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr ""
#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr ""
#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr ""
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
#| "\n"
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr ""
#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr ""
#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Komentar header untuk class"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Selektor Panduan"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
#, fuzzy
#| msgid "Help for FreePascal Compiler message"
msgid "Help for Free Pascal Compiler message"
msgstr "Bantuan untuk pesan Kompilator FreePascal"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr ""
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr ""
#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr ""
#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Petunjuk: Fungsi Buat Resourcestring mengharapkan konstan string.%sSilahkan pilih ekspresi dan coba lagi."
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Lihat Form"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Lihat Unit"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Database"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opsi Panduan"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Properti:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Peninjauan"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Path FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horisontal"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr ""
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr ""
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""
#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr ""
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr ""
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Pengenal dimulai dengan ..."
#: lazarusidestrconsts.lisidentifiercannotbedotted
#, object-pascal-format
msgid "Identifier \"%s\" cannot be dotted"
msgstr ""
#: lazarusidestrconsts.lisidentifiercannotbeempty
msgid "Identifier cannot be empty"
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Pengenal berisi ..."
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerfunction
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler function"
msgstr ""
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerprocedure
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler procedure"
msgstr ""
#: lazarusidestrconsts.lisidentifierisinvalid
#, object-pascal-format
msgid "Identifier \"%s\" is invalid"
msgstr ""
#: lazarusidestrconsts.lisidentifierisreservedword
#, object-pascal-format
msgid "Identifier \"%s\" is a reserved word"
msgstr ""
#: lazarusidestrconsts.lisidentifierwasalreadyused
#, object-pascal-format
msgid "Identifier \"%s\" was already used"
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opsi IDE"
#: lazarusidestrconsts.lisidetitlecustom
msgid "Custom IDE title"
msgstr ""
#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "Show custom IDE title before built-in IDE title or info"
msgstr ""
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr ""
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr ""
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "File ekspor sudah ada"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format, fuzzy, badformat
#| msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "File ekspor %s%s%s sudah ada.%sBuka file dan hanya timpa opsi kompilator?%s(Seting lain akan disimpan.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Ambil dari file"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr ""
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Simpan ke file"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr ""
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr ""
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr ""
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr ""
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr ""
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list"
msgstr ""
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "path include"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Sertakan path"
#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr ""
#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr ""
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Informasi tentang %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr ""
#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr ""
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Insert"
#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Sisipkan Makro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr ""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""
#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Pilihan Instalasi"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr ""
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compiling a package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""
#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr ""
#: lazarusidestrconsts.lisinvaliddeclaration
msgid "Invalid Declaration"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Penghapusan tidak benar"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr ""
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ekspresi tidak benar.%sPetunjuk: Fungsi Make Resourcestring mengharapkan konstan string dalam file tunggal. Silahkan pilih ekspresi dan coba lagi."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr ""
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Pemilihan multi tidak benar"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Pengenal Pascal Tidak Benar"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr ""
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "nama proc tidak benar"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nama file proyek tidak benar"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Pilihan tidak benar"
#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s sudah merupakan bagian dari Proyek."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format, fuzzy, badformat
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%sbukan nama proyek yang benar.%sSilahkan pilih yang lain (contoh. project1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr ""
#: lazarusidestrconsts.lisjhjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Lihat Histori-Lompatan ..."
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr ""
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr ""
#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr ""
#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr ""
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr ""
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Biarkan nama"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr ""
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr ""
#: lazarusidestrconsts.liskeepsubindentation
msgid "Absolute indentation"
msgstr ""
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Biarkan mereka dan lanjutkan"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Kunci"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Perintah Kustom"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Perintah Desainer"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Perintah Inspektor Objek"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Batalkan pembuatan"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Tambah pengawasan"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Bangun proyek/program"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasik"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Tutup proyek"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
#, fuzzy
#| msgid "Config %sBuild File%s"
msgid "Config \"Build File\""
msgstr "Konfig %sBuild File%s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
#, fuzzy
#| msgid "Configure custom components"
msgid "Configure Custom Components"
msgstr "Konfigurasi komponen kustom"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Bantuan sensitif konteks"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Ubah paket Delphi ke paket Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Ubah proyek Delphi ke proyek Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Ubah unit Delphi ke unit Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#, fuzzy
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "Ubah file DFM ke LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
#, fuzzy
#| msgid "Copy selected Components to clipboard"
msgid "Copy selected components"
msgstr "Copy Komponen yang dipilih ke clipboard"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
#, fuzzy
#| msgid "Cut selected Components to clipboard"
msgid "Cut selected components"
msgstr "Cut Komponen yang dipilih ke clipboard"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Hapus karakter terakhir"
#: lazarusidestrconsts.liskmdiffeditorfiles
#, fuzzy
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "File editor Diff"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Edit Template Kode"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Edit Bantuan sensitif konteks"
#: lazarusidestrconsts.liskmencloseselection
#, fuzzy
#| msgid "Enclose selection"
msgid "Enclose Selection"
msgstr "Tutupi pilihan"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evaluasi/Ubah"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Seting Piranti Eksternal"
#: lazarusidestrconsts.liskmfindincremental
#, fuzzy
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "Cari inkremental"
#: lazarusidestrconsts.liskmgotomarker0
#, fuzzy
#| msgid "Go to marker 0"
msgid "Go to bookmark 0"
msgstr "Pergi ke penanda 0"
#: lazarusidestrconsts.liskmgotomarker1
#, fuzzy
#| msgid "Go to marker 1"
msgid "Go to bookmark 1"
msgstr "Pergi ke penanda 1"
#: lazarusidestrconsts.liskmgotomarker2
#, fuzzy
#| msgid "Go to marker 2"
msgid "Go to bookmark 2"
msgstr "Pergi ke penanda 2"
#: lazarusidestrconsts.liskmgotomarker3
#, fuzzy
#| msgid "Go to marker 3"
msgid "Go to bookmark 3"
msgstr "Pergi ke penanda 3"
#: lazarusidestrconsts.liskmgotomarker4
#, fuzzy
#| msgid "Go to marker 4"
msgid "Go to bookmark 4"
msgstr "Pergi ke penanda 4"
#: lazarusidestrconsts.liskmgotomarker5
#, fuzzy
#| msgid "Go to marker 5"
msgid "Go to bookmark 5"
msgstr "Pergi ke penanda 5"
#: lazarusidestrconsts.liskmgotomarker6
#, fuzzy
#| msgid "Go to marker 6"
msgid "Go to bookmark 6"
msgstr "Pergi ke penanda 6"
#: lazarusidestrconsts.liskmgotomarker7
#, fuzzy
#| msgid "Go to marker 7"
msgid "Go to bookmark 7"
msgstr "Pergi ke penanda 7"
#: lazarusidestrconsts.liskmgotomarker8
#, fuzzy
#| msgid "Go to marker 8"
msgid "Go to bookmark 8"
msgstr "Pergi ke penanda 8"
#: lazarusidestrconsts.liskmgotomarker9
#, fuzzy
#| msgid "Go to marker 9"
msgid "Go to bookmark 9"
msgstr "Pergi ke penanda 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Pergi ke editor sumber 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Pergi ke editor sumber 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Pergi ke editor sumber 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Pergi ke editor sumber 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Pergi ke editor sumber 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Pergi ke editor sumber 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Pergi ke editor sumber 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Pergi ke editor sumber 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Pergi ke editor sumber 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Pergi ke editor sumber 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Sisipkan tanggal dan jam"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Sisipkan nama pengguna"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspeksi"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Skema Pemetaan tombol"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr ""
#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr ""
#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr ""
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Proyek baru"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Proyek baru dari file"
#: lazarusidestrconsts.liskmnewunit
#, fuzzy
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Unit Baru"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Buka file paket"
#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr ""
#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr ""
#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr ""
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "Paste Komponen dari clipboard"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Istirahatkan program"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Terbitkan proyek"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Jalankan program"
#: lazarusidestrconsts.liskmsaveall
#, fuzzy
#| msgid "SaveAll"
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "Simpan Semua"
#: lazarusidestrconsts.liskmsaveas
#, fuzzy
#| msgid "SaveAs"
msgid "Save As"
msgstr "SimpanS ebagai"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Simpan proyek"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Simpan proyek sebagai"
#: lazarusidestrconsts.liskmselectlineend
#, fuzzy
#| msgid "Select line end"
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Pilih akhir baris"
#: lazarusidestrconsts.liskmselectlinestart
#, fuzzy
#| msgid "Select line start"
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Pilih awal baris"
#: lazarusidestrconsts.liskmselectpagebottom
#, fuzzy
#| msgid "Select page bottom"
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Pilih bawah halaman"
#: lazarusidestrconsts.liskmselectpagetop
#, fuzzy
#| msgid "Select page top"
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Pilih atas halaman"
#: lazarusidestrconsts.liskmselectwordleft
#, fuzzy
#| msgid "Select word left"
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Pilih kata ke kiri"
#: lazarusidestrconsts.liskmselectwordright
#, fuzzy
#| msgid "Select word right"
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Pilih kata ke kanan"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Setel Bookmark bebas"
#: lazarusidestrconsts.liskmsetmarker0
#, fuzzy
#| msgid "Set marker 0"
msgid "Set bookmark 0"
msgstr "Set penanda 0"
#: lazarusidestrconsts.liskmsetmarker1
#, fuzzy
#| msgid "Set marker 1"
msgid "Set bookmark 1"
msgstr "Set penanda 1"
#: lazarusidestrconsts.liskmsetmarker2
#, fuzzy
#| msgid "Set marker 2"
msgid "Set bookmark 2"
msgstr "Set penanda 2"
#: lazarusidestrconsts.liskmsetmarker3
#, fuzzy
#| msgid "Set marker 3"
msgid "Set bookmark 3"
msgstr "Set penanda 3"
#: lazarusidestrconsts.liskmsetmarker4
#, fuzzy
#| msgid "Set marker 4"
msgid "Set bookmark 4"
msgstr "Set penanda 4"
#: lazarusidestrconsts.liskmsetmarker5
#, fuzzy
#| msgid "Set marker 5"
msgid "Set bookmark 5"
msgstr "Set penanda 5"
#: lazarusidestrconsts.liskmsetmarker6
#, fuzzy
#| msgid "Set marker 6"
msgid "Set bookmark 6"
msgstr "Set penanda 6"
#: lazarusidestrconsts.liskmsetmarker7
#, fuzzy
#| msgid "Set marker 7"
msgid "Set bookmark 7"
msgstr "Set penanda 7"
#: lazarusidestrconsts.liskmsetmarker8
#, fuzzy
#| msgid "Set marker 8"
msgid "Set bookmark 8"
msgstr "Set penanda 8"
#: lazarusidestrconsts.liskmsetmarker9
#, fuzzy
#| msgid "Set marker 9"
msgid "Set bookmark 9"
msgstr "Set penanda 9"
#: lazarusidestrconsts.liskmstopprogram
#, fuzzy
#| msgid "Stop program"
msgid "Stop Program"
msgstr "Hentikan program"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Toggle antara Unit dan Form"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
#, fuzzy
#| msgid "Toggle view Breakpoints"
msgid "View Breakpoints"
msgstr "Togglel ihat Breakpoints"
#: lazarusidestrconsts.liskmtoggleviewcallstack
#, fuzzy
#| msgid "Toggle view Call Stack"
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Toggle lihat Call Stack"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Toggle lihat Explorer Kode"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
#, fuzzy
#| msgid "Toggle view component palette"
msgid "Toggle View Component Palette"
msgstr "Toggle lihat palet komponen"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
#, fuzzy
#| msgid "Toggle view Debugger Output"
msgid "View Debugger Output"
msgstr "Toggle lihat Output Debugger"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Toggle lihat Editor Dokumentasi"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Toggle lihat tombol cepat IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
#, fuzzy
#| msgid "Toggle view Local Variables"
msgid "View Local Variables"
msgstr "Toggle lihat Variabel Lokal"
#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Toggle lihat Pesan"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Toggle lihat Inspektor Obyek"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Toggle lihat Hasil Pencarian"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Toggle lihat Editor Sumber"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
#, fuzzy
#| msgid "Toggle view Watches"
msgid "View Watches"
msgstr "Toggle lihat Pengawasan"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Lihat histori lompat"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Lihat opsi proyek"
#: lazarusidestrconsts.liskmviewprojectsource
#, fuzzy
#| msgid "View project source"
msgid "View Project Source"
msgstr "Lihat sumber proyek"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Lihat Info Unit"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Menjalankan aplikasi tidak benar"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Menjalankan baris perintah target"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Direktori Lazarus"
#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr ""
#: lazarusidestrconsts.lislazarusdiroverride
msgid "Directory to be used as a basedirectory."
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID bahasa Lazarus (contoh. en, de, id, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nama bahasa Lazarus (contoh english, dutsch)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opsi] <namafile-proyek>"
#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Kesalahan penulisan file"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opsi:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Target CPU:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Target OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr ""
#: lazarusidestrconsts.lislclwidgettype
#, fuzzy
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "Tipe Widget LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copy dari inherited"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Pindahkan entri ke inherited"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Left"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Batas spasi Kiri. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikiri kontrol."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Anchor Kiri"
#: lazarusidestrconsts.lisleftgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Left"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ini adalah kontrol terdekat dimana sisi kiri dianchor. Biarkan kosong untuk parent."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Sisi Kiri"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Kiri spasi secara sama"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Tingkat"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "File LFM"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "File LFM rusak"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "path pustaka"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "opsi penggabung"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr ""
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr ""
#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr ""
#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Masukkan data"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Masukkan parameter menjalankan"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#, fuzzy
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "Unit Utama mempunyai Seksi Uses yang berisi semua Unit dari proyek"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr ""
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr ""
#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr ""
#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Buat Eksekutabel"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make tidak ditemukan"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Buat ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Tambahkan ke bagian"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format, fuzzy, badformat
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s sudah ada.%sSilahkan pilih nama lain.%sGunakan Abaikan untuk tetap menambahkan juga."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opsi Konversi"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Pengenal Kustom:"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Pengenal"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Panjang Pengenal:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefiks Pengenal:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Sisipkan secara alfabetik"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Sisipkan sensitif konteks"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Bagian ResourceString tidak benar"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring sudah ada"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Bagian Resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Peninjauan Sumber"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Konstan String dalam sumber"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "String dengan nilai sama:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr ""
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr ""
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr ""
#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr ""
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Batalkan Pembangunan"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "Tambah breakpoint"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
#, fuzzy
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "Tambah titik lompatan ke histori"
#: lazarusidestrconsts.lismenuaddtoproject
#, fuzzy
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "Tambah file editor ke Proyek"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "Tambah pengawasan ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr ""
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Bangun File"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "Bangun Lazarus"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr ""
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Periksa file LFM dalam editor"
#: lazarusidestrconsts.lismenucleandirectory
#, fuzzy
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "Bersihkan direktori ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Tutuip Proyek"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#, fuzzy
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "Editor definisi CodeTools ..."
#: lazarusidestrconsts.lismenucommentselection
#, fuzzy
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "Komentari pilihan"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr ""
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Kode Lengkap"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr ""
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Konfigurasi Pembangunan+Jalankan File ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Konfigurasi komponen kustom ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Konfigurasi \"Bangun Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Panduan sensitif isi"
#: lazarusidestrconsts.lismenuconvertdelphipackage
#, fuzzy
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Konversi paket Delphi ke paket Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Konversi proyek Delphi ke proyek Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Konversi unit Delphi ke unit Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to LFM ..."
msgstr "Konversi file DFM ke LFM ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr ""
#: lazarusidestrconsts.lismenudebugwindows
#, fuzzy
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "Jendela Debug"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr ""
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Edit"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Template kode ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Edit Bantuan sensitif konteks"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "Konfigurasi paket terinstalasi ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr ""
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteitem
#, fuzzy
#| msgid "Delete Item"
msgid "&Delete item"
msgstr "Hapus Item"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""
#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor Menu"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr ""
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""
#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr ""
#: lazarusidestrconsts.lismenuencloseselection
#, fuzzy
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "Tutupi pilihan ..."
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "Evaluasi/Ubah ..."
#: lazarusidestrconsts.lismenuextractproc
#, fuzzy
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "Ekstraks prosedur ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&File"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Cari"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#, fuzzy
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "Cari akhir blok kode lainnya"
#: lazarusidestrconsts.lismenufindcodeblockstart
#, fuzzy
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "Cari awal blok kode"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
#, fuzzy
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "Cari Deklarasi di kursor"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Cari Referensi Pengenal ..."
#: lazarusidestrconsts.lismenufindinfiles
#, fuzzy
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "Cari &dalam file ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Cari Berikut&nya"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Cari &Sebelumnya"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr ""
#: lazarusidestrconsts.lismenugotoincludedirective
#, fuzzy
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "Pergi ke direktif include"
#: lazarusidestrconsts.lismenugotoline
#, fuzzy
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "Pergi ke baris ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Tebak IFDEF/ENDIF salah tempat"
#: lazarusidestrconsts.lismenuguessunclosedblock
#, fuzzy
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "Tebak blok tidak tertutup"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Panduan"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr ""
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Pencarian inkremental"
#: lazarusidestrconsts.lismenuindentselection
#, fuzzy
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "Lekukan pilihan"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "Entri ChangeLog"
#: lazarusidestrconsts.lismenuinsertcharacter
#, fuzzy
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "Sisipkan dari Peta Karakter"
#: lazarusidestrconsts.lismenuinsertcvskeyword
#, fuzzy
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "kata kunci CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
#, fuzzy
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "Tanggal dan waktu saat ini"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Umum"
#: lazarusidestrconsts.lismenuinsertgplnotice
#, fuzzy
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "catatan GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "catatan LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertusername
#, fuzzy
#| msgid "Current username"
msgid "Current Username"
msgstr "Nama pemakai saat ini"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Inspeksi ..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Lompat kembali"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Lompat maju"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Lompat ke"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr ""
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "Lompat ke penunjuk berikutnya"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "Lompat ke kesalahan berikutnya"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "Lompat ke penunjuk sebelumnya"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "Lompat ke kesalahan sebelumnya"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr ""
#: lazarusidestrconsts.lismenulowercaseselection
#, fuzzy
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "Kecilkan huruf pilihan"
#: lazarusidestrconsts.lismenumacrolistview
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr ""
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Buat String Resource ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr ""
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Komponen Baru"
#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr ""
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Form Baru"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Baru ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr ""
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Proyek Baru ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "Proyek Baru dari file ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Unit Baru"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Panduan Online"
#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Buka ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "Buka nama file di kursor"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr ""
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "Buka paket yang diambil ..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "Buka file paket (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "Open paket dari unit saat ini"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Buka Proyek ..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "Buka yang Terakhir ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "Buka paket terbaru ..."
#: lazarusidestrconsts.lismenuopenrecentproject
#, fuzzy
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Buka Proyek Terakhir ..."
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr ""
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr ""
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "Paket Grafik ..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr ""
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr " ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Proyek"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor Proyek"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opsi Proyek ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Jalankan"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikasikan Proyek ..."
#: lazarusidestrconsts.lismenuquickcompile
#, fuzzy
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "Kompilasi Cepat"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
#, fuzzy
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "Pemeriksaan sintaks cepat"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Hapus dari Proyek ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Ganti nama Pengenal ..."
#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Melaporkan bug..."
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#, fuzzy
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "Cari lagi direktori sumber FPC"
#: lazarusidestrconsts.lismenuresetdebugger
#, fuzzy
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "Reset debugger"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Kembalikan"
#: lazarusidestrconsts.lismenurevertconfirm
#, object-pascal-format
msgid ""
"Discard all unsaved changes in\n"
"\"%s\"?\n"
"\n"
"This action cannot be undone and will affect all editor tabs with the file."
msgstr ""
#: lazarusidestrconsts.lismenurun
#, fuzzy
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Jalankan"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Jalankan File"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "Parameter Menjalankan ..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Jalanjan sampai kursor"
#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr ""
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr ""
#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Simpan"
#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Simpan Sebagai ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Simpan Proyek"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Simpan Proyek Sebagai ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Cari"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Pilih"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Pilih semua"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "Pilih blok kode"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "Pilih baris"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "Pilih paragraf"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "Pilih untuk dikurung"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "Pilih kata"
#: lazarusidestrconsts.lismenusetfreebookmark
#, fuzzy
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Set penunjuk bebas"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr ""
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "Urut pilihan ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutabstospacesselection
#, fuzzy
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "Tab ke spasi dalam pilihan"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Tentang"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr ""
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Piranti"
#: lazarusidestrconsts.lismenuuncommentselection
#, fuzzy
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "Jangan komentari pilihan"
#: lazarusidestrconsts.lismenuunindentselection
#, fuzzy
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "Jangan lekukan pilihan"
#: lazarusidestrconsts.lismenuuppercaseselection
#, fuzzy
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "Besarkan huruf pilihan"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr ""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Lihat"
#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Lihat Editor Jangkar"
#: lazarusidestrconsts.lismenuviewcodebrowser
#, fuzzy
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Browser Kode"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Eksplorer Kode"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Lihat Palet Komponen"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponen"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Log Event"
#: lazarusidestrconsts.lismenuviewdebugoutput
#, fuzzy
#| msgid "Debug output"
msgid "Debug Output"
msgstr "Output Debug"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Forms..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Lihat Histori-Lompatan ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Variabel Lokal"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Pesan"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspektor Obyek"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Cari Hasil"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor Sumber"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtoggleformunit
#, fuzzy
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "Toggle tampilan form/unit"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies ..."
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Lihat Ketergantungan Unit"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "Lihat Informasi Unit"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "Units..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Pengawasan"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr ""
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts.lismeother
#, fuzzy
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Lainnya"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Event Hilang"
#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Paket Tidak Ada"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Leave these units in uses sections as they are."
msgstr ""
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""
#: lazarusidestrconsts.lismissingunitsskip
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format
msgid "expected \":=\" after macro name but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format
msgid "expected macro name but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""
#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
#| "\n"
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<description>%sHak Cipta (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr ""
#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr ""
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr ""
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr ""
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr ""
#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr ""
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr ""
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr ""
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr ""
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr ""
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr ""
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr ""
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr ""
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr ""
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr ""
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Simpan pesan ke file (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nama"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nama dari procedure baru"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Baru"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Kelas Baru"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Buat file editor baru.%sPilih jenis."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Buat file teks kosong baru."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format, fuzzy, badformat
msgid "Create a new project.%sChoose a type."
msgstr "Buat proyek baru.%Pilih jenis."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format, fuzzy, badformat
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Buat paket standar baru.%Paket adalah koleksi dari unit dan komponen."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Buat unit baru dengan modul data."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Buat unit baru dengan form LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Tidak ada item dipilih"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Silahkan pilih item terlebih dulu."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr ""
#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "%s - (proyek baru)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr ""
#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Tidak ada file backup"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Tidak ada perubahan"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Tidak ada kode dipilih"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Tidak ada opsi kompilator diturunkan."
#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr ""
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "tanpa nama"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr ""
#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "ResourceString Section tidak ditemukan"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Biasanya filter adalah ekspresi reguler. Dalam Sintaks Sederhana sebuah . adalah karakter normal, sebuah * bisa berarti apapun, sebuah ? berarti setiap karakter, dan koma serta titk koma memisahkan alternatif. Sebagai contoh: Sintaks Sederhana *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Tidak ada Konstan String Ditemukan"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""
#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr ""
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Left"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "CATATAN: Tidak bisa membuat Define Template untuk Sumber Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "CATATAN: Tidak bisa membuat Define Template untuk Sumber Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr ""
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Tdak sekarang"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Buat proyek baru"
#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr ""
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "path objek"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""
#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr ""
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "Class %s%s%s not found."
msgid "Class \"%s\" not found."
msgstr "Class %s%s%s tidak ditemukan."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "otomatis menginstalasi dinamis"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "otomatis menginstalasi statis"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Deskripsi: "
#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription: %s"
msgstr "%sDeskripsi: %s"
#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename: %s"
msgstr "Nama file: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "diinstalasi dinamis"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "diinstalasi statis"
#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense: %s"
msgstr ""
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "tidak ada"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "diubah"
#: lazarusidestrconsts.lisoipopenloadedpackage
#, fuzzy
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "Buka paket yang diambil"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nama Paket"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Silahkan pilih paket"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "hanya baca"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Kondisi"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format, fuzzy
#| msgid "%sThis package is installed, but the lpk file was not found"
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sPaket ini diinstalasi, tetapi file lpk tidak ditemukan"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Kelas Lama"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr ""
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr ""
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr ""
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hanya mencari seluruh kata"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Buka"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Buka sebagai file XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Buka file yang ada"
#: lazarusidestrconsts.lisopenfile
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Buka file"
#: lazarusidestrconsts.lisopenfile2
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Buka file"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr ""
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr ""
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr ""
#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Buka %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Buka Paket?"
#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Buka File Paket"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Buka Proyek?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Buka proyek"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Buka lagi proyek"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Buka File Proyek"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Buka file sebagai sumber normal"
#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format
msgid "Open the package %s?"
msgstr "Buka paket %s?"
#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format
msgid "Open the project %s?"
msgstr "Buka proyek %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr ""
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr ""
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Opsi"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""
#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ""
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr ""
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr ""
#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
#, fuzzy
#| msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Timpa bahasa. Sebagai contoh --language=de. untuk nilai yang mungkin lihat file dalam direktori languages."
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "Override the project or IDE build mode."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetsetegdefault
#, object-pascal-format
msgid "Override the project widgetset. For example: %s. Default: %s."
msgstr ""
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paket"
#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr ""
#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
#, fuzzy
#| msgid "Package Info"
msgid "Package info"
msgstr "Info Paket"
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr ""
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Nama paket dimulai dengan ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Nama paket berisi ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Paket perlu diinstalasi"
#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr ""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""
#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr ""
#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr ""
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""
#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr ""
#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr ""
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr ""
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Browse"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
#, fuzzy
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "Turunkan path"
#: lazarusidestrconsts.lispatheditmovepathup
#, fuzzy
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "Naikkan path"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Template Path"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Path Pencarian:"
#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr ""
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Istirahat"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr ""
#: lazarusidestrconsts.lispckeditaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Tambah ke proyek"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Terapkan perubahan"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr ""
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Panggil %sRegister%s procedure dari unit yang dipilih"
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr ""
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr ""
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Kompilasi semuanya?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompilasi paket"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Buat Makefile"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
#, fuzzy
#| msgid "Edit General Options"
msgid "Edit general options"
msgstr "Edit Opsi Umum"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Properti File"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalasi"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versi maksimum tidak benar"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versi minimum tidak benar"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versi Maksimum:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versi Minimum:"
#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Diubah: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Turunkan dependensi"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Naikkan dependensi"
#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr ""
#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Paket %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "Package %s%s%s has changed.%sSave package?"
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Paket %s%s%s sudah diubah.%sSimpan paket?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "paket %s tidak dismpan"
#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Halaman: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Tambah-Ulang dependensi"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Tambah-Ulang file"
#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Hanya Baca: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
#, fuzzy
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "Kompilasi ulang semua yang dibutuhkan"
#: lazarusidestrconsts.lispckeditrecompileclean
#, fuzzy
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "Kompilasi ulang bersih"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Rekompilasi ini dan semua paket yang dibutuhkan?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Plugins terdaftar"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Register unit"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Hapus dependensi"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format, fuzzy, badformat
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Hapus dependensi %s%s%s%sdari paket %s%s%s?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Hapus paket yang diperlukan"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Hapus file"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Hapus file?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format, fuzzy, badformat
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Hapus file %s%s%s%sdari paket %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Hapus item yang dipilih"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Paket yang Dibutuhkan"
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "Simpan paket"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format, fuzzy, badformat
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Versi maksimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format, fuzzy, badformat
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Versi minimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Uninstalasi"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Lihat Sumber Paket"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Diinstalasi"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalasi saat mulai nanti"
#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sKondisi: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
#, fuzzy
#| msgid "Uninstall on next start"
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Jangan instalasi saat mulai nanti"
#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Tambah opsi untuk paket dependen dan proyek"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Tambah path ke paket dependen/proyek"
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "Pembuat:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Otomatis membangun ulang jika diperlukan"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Otomatis membangun ulang ketika pembangunan ulang semua"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Kustom"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Deskripsi/Abstrak"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#, fuzzy
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "Waktu desain dan Runtime"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrasi IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipe paket tidak benar"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Librari"
#: lazarusidestrconsts.lispckoptslicense
#, fuzzy
#| msgid "License:"
msgid "License"
msgstr "Lisensi:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Mayor"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Kompilasi manual (tidak secara otomatis)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minor"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objek"
#: lazarusidestrconsts.lispckoptspackagetype
#, fuzzy
#| msgid "PackageType"
msgid "Package type"
msgstr "TipePaket"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Menyediakan"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Rilis"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Paket %s%s%s mempunyai tanda otomatis instalasi.%sIni berarti akan diinstalasi dalam IDE. Paket instalasi%sharus Paket waktu desain."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Paket ini menyediakan hal yang sama seperti paket berikut:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
#, fuzzy
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "Pemutakhiran/Bangun ulang"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Penggunaan"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Batalkan"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progres"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Konflik ditemukan"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nama file:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nama file unit tidak benar"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nama unit tidak benar"
#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr ""
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr ""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr ""
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr ""
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr ""
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr ""
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr ""
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr ""
#: lazarusidestrconsts.lispeshowpropspanel
msgid "Show properties panel"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr ""
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr ""
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nama unit:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr ""
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr ""
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Anda benar-benar ingin melupakan semua perubahan terhadap paket %s dan mengambil ulang dari file?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Unit baru tidak dalam unitpath"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikasikan Paket"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Kembalikan paket?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "File %s%s%s%ssaat ini tidak dalam unitpath dari paket.%s%sTambah %s%s%s ke UnitPath?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "%sAdding new Dependency for package %s: package %s%s"
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sPenambahan Dependensi baru untuk paket %s: paket %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format, fuzzy, badformat
#| msgid "%sAdding new Dependency for project %s: package %s%s"
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sPenambahan Dependensi baru untuk proyek %s: paket %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unit dwimakna ditemukan"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Otomatis menginstalasi paket"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sKedua paket tersambung. Ini berarti, This means, either one package uses the other, or they are both used by a third package."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dependensi Rusak"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Hapus File Paket Lama?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format, fuzzy, badformat
#| msgid "Delete old package file %s%s%s?"
msgid "Delete old package file \"%s\"?"
msgstr "Hapus file paket %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Dependensi tapa Pemilik: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Kesalahan Pembacaan Paket"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Kesalahan Penulisan Paket"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "File sudah ada dalam paket"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "File dalam Proyek"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nama file berbeda dari Namapaket"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nama file sedang digunakan oleh paket lain"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nama file sedang digunakan oleh proyek"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "File %s%s%s not found."
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "File %s%s%s tidak ditemukan."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "File tidak disimpan"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Ekstensi file tidak benar"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ekstensi file paket tidak benar"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nama file paket tidak benar"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nama paket tidak benar"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nama Paket Tidak Benar"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Pengambilan paket %s akan menimpa paket %s%sdari file %s.%sPaket lama diubah.%s%sSimpan paket lama %s?"
#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Paket: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Paket konflik"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "Paket bukan paket waktu desain"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Paket dibutuhkan"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Nama paket sudah ada"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Paket harus mempunyai ekstensi .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Silahkan simpan file sebelum menambahkannya ke paket."
#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Proyek: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Bangun ulang Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format, fuzzy, badformat
#| msgid "Replace existing file %s%s%s?"
msgid "Replace existing file \"%s\"?"
msgstr "Timpa file yang sudah ada %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Timpa File"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
#, fuzzy
#| msgid "Save Package?"
msgid "Save package?"
msgstr "Simpan Paket?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Simpan Paket %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format, fuzzy, badformat
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Haruskah file diganti nama huruf kecil ke %s%s%s%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Lewati paket ini"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%sis already in the package %s."
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "File %s%s%s%ssudah berada dalam paket %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s is not a Lazarus package."
msgid "The file \"%s\" is not a Lazarus package."
msgstr "File %s%s%s ibukan paket Lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Nama file %s%s%s tidak terkait ke nama paket %s%s%s dalam file.%sUbah nama paket ke %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Nama file %s%s%s adalah bagian dari proyek saat ini.%sProyek dan Paket seharusnya bukan file berbagi."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format, fuzzy, badformat
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Nama file %s%s%s digunakan oleh%spaket %s%s%s%sdalam file %s%s%s."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Paket berikut gagal diambil:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Paket berikut gagal diambil:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format, fuzzy, badformat
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sUnit berikut akan ditambahkan ke bagian uses dari%s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format, fuzzy, badformat
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Nama file paket %s%s%s in%s%s%s%s bukan nama paket Lazarus yang benar."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format, fuzzy
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Paket %s adalah hanya paket runtime.%sPaket hanya runtime tidak bisa diinstalasi dalam IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Paket %s%s%s ditandai untuk instalasi, tetapi tidak ditemukan.%sHapus dependensi dari daftar instalasi paket?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format, fuzzy
#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Paket %s diperlukan oleh %s, yang ditandai untuk instalasi.%sLihat grafik paket."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format, fuzzy, badformat
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Nama paket %s%s%s bukan nama paket yang benar%sSilahkan pilih nama lain (contoh. paket1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format, fuzzy, badformat
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Nama paket %s%s%s dari%sfile %s%s%s tidak benar."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Paket %s%s%s sudah ditandai.%sSaat ini Lazarus hanya mendukung paket static linked. Pembatalan instalasi sebenarnya perlu membangun ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Paket %s%s%s ditandai untuk instalasi.%sSaat ini Lazarus hanya mendukung paket static linked. Instalasi sebenarnya memerlukan pembangunan ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Proyek memerlukan paket %s%s%s.%sTetapi tidak ditemukan. Lihat Proyek -> Inspektor Proyek."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format, fuzzy, badformat
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Ada dua unit dengan nama sama:%s%s1. %s%s%s dari %s%s2. %s%s%s dari %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Ada unit FPC dengan nama yang sama dengan paket::%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Ada unit FPC dengan nama yang sama dengan: %s%s%s%s%s dari %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Sudah ada nama paket lain dengan nama %s%s%s.%sPaket konflik: %s%s%s%sFile: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Sudah ada paket %s%s%s diambil%sdari file %s%s%s.%sLihat Komponen -> Grafik Paket.%sPenimpaan tidak mungkin."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Ada paket tidak disimpan dalam paket yang diperlukan. Lihat grafik paket."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Ada unit dengan nama yang sama dengan paket:%s%s1. %s%s%s dari %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Ini adalah paket virtual. belum mempunyai sumber. Silahkan simpan paket terlebih dulu."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Tidak bisa membuat direktori target untuk lazarus:%s%s%s%s.%sDirektori ini dibutuhkan untuk Lazarus IDE baru yang diubah dengan paket kustom anda."
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Tidak bisa menulis paket %s%s%s%ske file %s%s%s.%sKesalahan: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Batalkan instalasi paket?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Batalkan instalasi paket %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Paket tidak disimpan"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Gunakan unit"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format, fuzzy, badformat
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Perhatian: File %s%s%s%smilik proyek saat ini."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr ""
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr ""
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr ""
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "File tidak dalam paket yang diaktifkan."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to read package file %s%s%s.%sError: %s"
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Tidak bisa membaca file paket %s%s%s.%sKesalahan: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr ""
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr ""
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr ""
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Silahkan buka unit sebelum menjalankan"
#: lazarusidestrconsts.lispleaseplacetheeditorcaretonanidentifierifthisisane
msgid "Please place the editor caret on an identifier. If this is a new unit, please save the file first."
msgstr ""
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Silahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Semua>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Ubah Font"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copy nama method ke clipboard"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filter menyamai setiap bagian dari method"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filter menyamai setiap awal dari method"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Lompat Ke Pilihan"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Tidak ada>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objects"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Jangan simpan info sesi apapun"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
#, fuzzy
#| msgid "Save in IDE config directory"
msgid "Save in .lps file in IDE config directory"
msgstr "Simpan dalam direktori konfigurasi IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Simpan dalam file .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Simpan dalam file .lps dalam direktori proyek"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Simpan informasi sesi dalam"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ""
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr ""
#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr ""
#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr ""
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format, fuzzy, badformat
#| msgid "primary config directory, where Lazarus stores its config files. Default is "
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "direktori konfigurasi utama, dimana Lazarus menyimpan file konfigurasinya. Default adalah"
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Metode Private"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format, fuzzy, badformat
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Mungkin anda perlu menginstalasi beberapa paket sebelum melanjutkan. %s%sPerhatian:%sProyek tergantung pada beberapa paket, yang berisi unit dengan prosedur Register. Prosedur Register biasanya digunakan untuk menginstalasi komponen dalam IDE. Tetapi unit berikut milik paket yang belum diinstalasi dalam IDE. Jika anda ingin mencoba membuka form dalam IDE, yang menggunakan komponen tersebut, anda akan mendapatkan kesalahan mengenai komponen yang tidak ada dan pengambilan form akan membuat hasil yang tidak menyenangkan.%s%sIni tidak berpengaruh pada pembukaan proyek atau sumbernya.%s%sIni hanya berarti: Adalah ide yang buruk untuk membuka form untuk desain, sebelum menginstalasi paket yang tidak ada.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedure"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Proseduir dengan interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program dideteksi"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Sumber program harus ekstensi pascal seperti .pas, .pp or .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Dependensi sudah ada"
#: lazarusidestrconsts.lisprojaddeditorfile
#, fuzzy
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "Tambah file editor"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versi Min-Max tidak benar"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versi tidak benar"
#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versi Maksimum (opsional):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versi Minimum (opsional):"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr ""
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Kebutuhan Baru"
#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nama Paket:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paket tidak ditemukan"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr ""
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Dependensi %s%s%s tidak ditemukan.%sSilahkan pilih paket yang ada."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format, fuzzy, badformat
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Versi Maksimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format, fuzzy, badformat
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Versi Minimum %s%s%s tidak benar.%sSilahkan gunakan format mayor mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format, fuzzy, badformat
#| msgid "The project has already a dependency for the package %s%s%s."
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Proyek sudah mempunyai dependensi untuk paket %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Nama unit %s%s%s sudah ada dalam proyek%sdengan file: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Nama unit %s%s%s sudah ada dalam pilihan%sdengan file: %s%s%s."
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Nama unit sudah ada"
#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr ""
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr ""
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr ""
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Prouek diubah"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Direktori proyek"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nama file proyek"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Path Include Proyek"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "File info proyek dideteksi"
#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Proyek bisa dijalankan"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr ""
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Properti makro proyek"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Path Src Proyek"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Path Unir Proyek"
#: lazarusidestrconsts.lisprojectver
msgid "Project version"
msgstr ""
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Konfirmasi penghapusan dependensi"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Hapus dependensi untuk %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Inspektor Proyek - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Hapus paket yang diperlukan"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Hapus file %s dari proyek?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr ""
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Selalu membangun (meskipun jika tidak ada yang berubah)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Salah"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Tidak bisas mengubah form otomatis dibuat dalam sumber program.%Silahkan betulkan kesalahan terlebih dahulu."
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Nilai untuk prompt"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""
#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Metode Protected"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Metode Public"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Metode Published"
#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr ""
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr ""
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Direktori publikasi proyek"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Edit unit virtual"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Sudah ada unit dengan nama ini.%sFile: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unitname is not a valid pascal identifier."
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Nama unit bukan pengenal pascal yang benar."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Namam unit dan nama file tidak sama.%sContoh: unit1.pas dan Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr ""
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr ""
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr ""
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Buka yang Terakhir"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr ""
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
#, fuzzy
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "Keluar Lazarus"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr ""
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Redo"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr ""
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr ""
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr ""
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Hapus semua properti yang tidak benar"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr ""
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr ""
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr ""
#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "Hapus dari proyek"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Hapus mereka"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Ganti nama"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Ganti nama file?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Penggantian nama file gagal"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""
#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr ""
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Ganti nama ke huruf kecil"
#: lazarusidestrconsts.lisrenamingaborted
msgid "Renaming aborted"
msgstr ""
#: lazarusidestrconsts.lisrenamingconflict
msgid "Renaming conflict"
msgstr ""
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr ""
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Ganti"
#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Penggantian yang dipilih gagal."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""
#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Penyimpanan resource salah"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr ""
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Mulai lagi"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation"
msgstr ""
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Pengembalian gagal"
#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr ""
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Anchor Kanan"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Batas spasi Kanan. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikanan kontrol."
#: lazarusidestrconsts.lisrightgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ini adalah kontrol terdekat dimana sisi kanan dianchor. Biarkan kosong untuk parent."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Sisi Kanan"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Kanan spasi secara sama"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Jalankan"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "File bukan eksekutabel"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format, fuzzy, badformat
#| msgid "The host application %s%s%s is not executable."
msgid "The host application \"%s\" is not executable."
msgstr "Aplikasi induk %s%s%s bukan eksekutabel."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Jalankan"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Jalankan-sampai gagal"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Simpan ..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Simpan Semua"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "simpan semua file yang diubah"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissaveandexitdialog
#, fuzzy
#| msgid "Save and exit dialog"
msgid "Only Save"
msgstr "Dialog Simpan dan keluar"
#: lazarusidestrconsts.lissaveandrebuildide
#, fuzzy
#| msgid "Save and rebuild IDE"
msgid "Rebuild IDE"
msgstr "Simpan dan bangun ulang IDE"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Simpan perubahan?"
#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Simpan perubahan ke proyek %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "simpan file editor saat ini"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format, fuzzy, badformat
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Simpan file %s%s%s%ssebelum menutup form %s%s%s?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr ""
#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr ""
#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Simpan Seting"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Simpan"
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr ""
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Faktor Skala:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr ""
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr ""
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""
#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format, fuzzy, badformat
#| msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "direktori konfig kedua, dimana Lazarus mencari file template konfig. Default adalah"
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Lihat pesan."
#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sLihat Proyek -> Inspektor Proyek"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Pilih item panduan:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Pilih node"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Pilih form Delphi dari file (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr ""
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr ""
#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr ""
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Pilihan melebih konstan string"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Piranti pemilihan"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr ""
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr ""
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr ""
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr ""
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr ""
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
#, fuzzy
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Tampilkan petunjuk dalam Inspektor Objek"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Tampilkan pengenal"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr ""
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr ""
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr ""
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Tampilkan paket"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr ""
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr ""
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr ""
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings."
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr ""
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Tampilkan unit"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr ""
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr ""
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""
#: lazarusidestrconsts.lisshowversionandexit
msgid "Show version and exit."
msgstr ""
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Terdekat"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
#, fuzzy
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "Sintaks Sederhana"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Lewati file dan lanjutkan pengambilan"
#: lazarusidestrconsts.lisskiploadinglastproject
#, fuzzy
#| msgid "Skip loading last project"
msgid "Skip loading last project."
msgstr "Lewati pengambilan proyek terakhir"
#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr ""
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Sama"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Maaf, tipe ini belum diimplementasikan"
#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr ""
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr ""
#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr ""
#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Membesar"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Mengecil"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domain"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Abaikan Spasi"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Baris"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opsi"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragraf"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Peninjauan"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Terima"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Urut pilihan"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Kata"
#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format, fuzzy, badformat
#| msgid "Source directory %s%s%s does not exist."
msgid "Source directory \"%s\" does not exist."
msgstr "Direktori sumber %s%s%s tidak ada."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Sumber dimodifikasi"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format, fuzzy, badformat
#| msgid "Source of page %s%s%s has changed. Save?"
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Sumber dari halaman %s%s%s sudah diubah. Simpan?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Path sumber"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Spasi secara sama"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Pencarian"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Cari teks"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Mulai dengan proyek baru"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr ""
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Hentikan"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Hentikan debugging saat ini dan bangun ulang proyek?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Hentikan Debugging?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Hentikan debugging?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Hentikan debugging?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Pengaliran salah"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub Prosedur"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub Prosedur pada tingkat yang sama"
#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr ""
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sukses"
#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nama variabel tidak benar"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format, fuzzy, badformat
#| msgid "%s%s%s is not a valid identifier."
msgid "\"%s\" is not a valid identifier."
msgstr "%s%s%s bukan pengenal yang benar."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Timpa variabel sistem"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr ""
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, object-pascal-format, fuzzy, badformat
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Urutan Tab dari"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr ""
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr ""
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr ""
#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Target CPU"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nama file target dari proyek"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Target OS"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr ""
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Direktori Tes"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr ""
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr ""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format, fuzzy, badformat
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Class %s%s%s adalah TControl dan tidak bisa di-paste ke dalam non kontrol.%sTidak mem-paste."
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format, fuzzy, badformat
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "Editor komponen dari class%s%s%s%sditemukan dengan verb #%s %s%s%s%stelah menghasilkan kesalahan:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr ""
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr ""
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format, fuzzy, badformat
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Debugger %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Lingkungan -> Opsi Debugger"
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format, fuzzy, badformat
#| msgid "The destination directory%s%s%s%s does not exist."
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Direktori tujuan %s%s%s%s tidak ada."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format, fuzzy, badformat
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Direktori %s%s%s tidak dibutuhkan lagi dalam path unit.%sHapus?"
#: lazarusidestrconsts.listhefile
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s"
msgid "The file \"%s\""
msgstr "File %s%s%s"
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr ""
#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "File %s%s%s%ssepertinya sebuah program. Tutup proyek sekarang dan buat proyek Lazarus baru untuk program ini?%s\"Tidak\" akan mengambil file sebagai sumber normal."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format, fuzzy
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "File %s nampaknya file program dari Proyek Lazarus yang sudah ada."
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "File %s%s%s%stidak ditemukan.%sAnda ingin mencarinya sendiri?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "File %s%s%s%stidak ditemukan. %sMengabaikan akan tetap mengambil proyek, %sMembatalkan akan menghentikan pengambilan."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format, fuzzy, badformat
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Method berikut digunakan oleh %s tidak dalam sumber%s%s%s%s%s%sHapus referensi dangling?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitproceedanyway
#, object-pascal-format
msgid "The identifier is a %s.%sNew file(s) will be created, old can be deleted.%sProceed anyway?"
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format, fuzzy, badformat
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Menjalankan aplikasi %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Jalankan -> Parameter menjalankan -> Lokal"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "File LFM (form Lazarus) berisi properti tidak benar. Ini berarti sebagai contoh berisi beberapa properti/kelas, yang tidak ada dalam LCL saat ini. Pembetulan normal adalah menghapus properti ini dari lfm dan membetulkan kode pascal secara manual."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr ""
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format, fuzzy, badformat
#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Program %smake%stidak ditemukan.%sPiranti ini diperlukan untuk membangun lazarus.%s"
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr ""
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr ""
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format, fuzzy, badformat
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "File info proyek %s%s%s%ssama dengan file sumber utama proyek!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr ""
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format, fuzzy
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Proyek harus disimpan sebelum pembangunan%sJika anda menset Direktori Test dalam opsi lingkungan,%sanda bisa membuat proyek baru dan membangunnya sekaligus.%sSimpan proyek?"
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr ""
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr ""
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr ""
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Ada file lain dalam direktori dengan nama yang sama, %syang beda hanya jenis hurufnya:%s%s%sHapus dulu?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Ada file dengan nama sama dan ekstensi mirip pada disk%File: %s%s%sHapus file dwimakna?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already a form with the name %s%s%s"
msgid "There is already a form with the name \"%s\""
msgstr "Sudah ada form dengan nama %s%s%s"
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Sudah ada unit dengan nama%s%s%s. Pengenal Pascal harus unik."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Ada unit dengan nama %s%s%s dalam proyek.%sSilahkan pilih nama yang berbeda"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format, fuzzy, badformat
#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Resource class %s%s%s turunan dari %s%s%s. Mungkin ini salah ketik untuk TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Ada kesalahan selama penulisan komponen yang dipilih %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Ada kesalahan ketika pengubahan stream biner dari komponen yang dipilih %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Ada kesalahan ketikda meng-copy stream komponen ke clipboard:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "Komponen teratas tidak bisa dihapus."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr ""
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr ""
#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr ""
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr ""
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Unit sendiri sudah mempunyai nama %s%s%s. Pengenal Pascal harus unik."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr ""
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
#, fuzzy
#| msgid "this help message"
msgid "This help message."
msgstr "pesan panduan ini"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr ""
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format, fuzzy
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Ini sepertinya file pascal. %s direkomendasikan untuk menggunakan nama file dengan huruf kecil, untuk menghindari berbagai masalah pada beberapa filesystems dan kompilator berbeda. %sGanti nama ke huruf kecil?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Pernyataan ini tidak bisa diekstrak.%sSilahkan pilih beberapa kode untuk mengekstrak procedure/method baru."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr ""
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Path:"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""
#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr ""
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr ""
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr ""
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr ""
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr ""
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Anchor Atas"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Batas spasi Atas. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi diatas kontrol."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Atas"
#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ini adalah kontrol terdekat dimana sisi atas dianchor. Biarkan kosong untuk parent."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Spasi Atas secara sama"
#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr ""
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr ""
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr ""
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr ""
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""
#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Jangan tampilkan pesan ini lagi."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Kesalahan dalam ekspresi reguler"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Font tanpa UTF-8"
#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Pergi ke baris :"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Tidak ditemukan"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format, fuzzy, badformat
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Ganti %s%s%s%s yang ditemukan ini dengan %s%s%s?"
#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Pencarian: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "Pencarian string '%s' tidak ditemukan!"
#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Font editor saat ini tidak mendukung UTF-8, tetapi sistem anda nampak menggunakannya. %sItu berarti karakter non ASCII mungkin akan ditampilk tidak benar. %sAnda bisa memilih font lain dalam opsi editor."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Bersihkan cache include"
#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s byte"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Disertakan oleh:"
#: lazarusidestrconsts.lisuidinproject
#, fuzzy
#| msgid "in Project:"
msgid "In project:"
msgstr "dalam Proyek:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Baris:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nama:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "tidak"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Ukuran:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "TipeL"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "ya"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Tampilkan Nilai CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Tidak bisas mengubah stream biner ke teks"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Tidak bisa meng-copy komponen ke clipboard"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Tidak bisa menambah komentar header resource ke file resource %s%s%s%s.%sKemungkinan salah sintaks"
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Tidak bisa menambah resource T%s:FORMDATA ke file resource %s%s%s%s.%sKemungkinan salah sintaks."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format, fuzzy
#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Tidak bisa menambah %s ke proyek, karena sudah ada unit dengan nama yang sama dalam Proyek."
#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Tidak bisa mem-backup file %s%s%s to %s%s%s!"
#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sTidak bisa mengubah kelas dari %s ke %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Tidak bisa membersihkan direktori tujuan"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Tidak bisa membersihkan %s%s%s.%sSilahkan periksa perijinan."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Tidak bisa mengkonversi teks komponen ke dalam format biner:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to convert file %s%s%s%sError: %s"
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Tidak bisa mengubah file %s%s%s%sKesalahan: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Tidak bisa mengubah data form teks dari file %s%s%s%s%skedalam aliran biner. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Tidak bisa membuat bufer lfm sementara."
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to delete ambiguous file %s%s%s"
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Tidak bisa menghapus file dwimakna %s%s%s"
#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to find a valid classname in %s%s%s"
msgid "Unable to find a valid classname in \"%s\""
msgstr "Tidak menemukan nama class yang benar dalam %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to find file %s%s%s."
msgid "Unable to find file \"%s\"."
msgstr "Tidak bisa menemukan file %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr ""
#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "Tidak bisa menemukan %s dalam LFM Stream."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Tidak bisa mengumpulkan perubahan editor."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Tidak bisa mendapatkan sumber untuk desainer."
#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Tidak bisa mengambil kelas komponen %s%s%s, karena ia tergantung pada dirinya sendiri."
#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Tidak bisa membuka desainer.%sKelas %s bukan turunan dari kelas bisa didesain seperti TForm atau TDataModule."
#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to remove old backup file %s%s%s!"
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Tidak bisa menghapus file backup lama %s%s%s!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Tidak bisa mengganti nama file dwimakna %s%s%s%ske %s%s%s"
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Tidak bisa mengganti nama form dalam sumber."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Tidak bisa mengganti nama metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Tidak bisa mengganti nama variabel dalam sumber."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Tidak bisa men-set Kontrol AnchorSide"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Tidak bisas menyalurkan komponen yang dipilih"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Tidak bisa mengalirkan komponen yang dipilih."
#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "Tidak bisa mengalirkan %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Tidak bisa mentransformasi aliran komponen biner %s:T%s ke dalam teks"
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Tidak bisa memutakhirkan pernyataan CreateForm dalam sumber proyek"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr ""
#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Deinstalasi pilihan"
#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr ""
#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Pengenal unit sudah ada"
#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nama unit sudah ada dalam proyek"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Nama unit dimulai dengan ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Nama unit berisi ..."
#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Direktori Output Unit"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "path unit"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Path Unit"
#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr ""
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Naik"
#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr ""
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
#, fuzzy
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Gunakan Ansi Strings"
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr ""
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""
#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr ""
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr ""
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr ""
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""
#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr ""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Meluncurkan aplikasi"
#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr ""
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr ""
#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr ""
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Nilai"
#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr ""
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr ""
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr ""
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variabel"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versi"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertikal"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr ""
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Lihat Sumber (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ""
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr ""
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr ""
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr ""
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Dengan paket yang diperlukan"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Kata di kursor dalam editor saat ini"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Direktori kerja untuk membangun"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Direktori kerja untuk menjalankan"
#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
msgid "Write config instead of command line parameters"
msgstr ""
#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr ""
#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr ""
#: lazarusidestrconsts.liswritewhatpackagefilesares
msgid "Write what package files are searched and found."
msgstr ""
#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
#, fuzzy
#| msgid "You can not build lazarus while debugging or compiling."
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Anda tidak bisa membangun lazarus saat debugging atau kompilasi."
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr ""
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr ""
#: lazarusidestrconsts.lis_all_
#, fuzzy
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Semua>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor Sumber"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr ""
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr ""
#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr ""
#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptlevels
#, fuzzy
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Tingkat"
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr ""
#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitnone
#, fuzzy
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Tidak ada"
#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr ""
#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr ""
#: lazarusidestrconsts.optdispgutterchanges
msgid "Changes"
msgstr ""
#: lazarusidestrconsts.optdispgutterfolding
msgid "Folding"
msgstr ""
#: lazarusidestrconsts.optdispguttermarks
msgid "Marks"
msgstr ""
#: lazarusidestrconsts.optdispgutternocurrentlinecolor
msgid "No current line color"
msgstr ""
#: lazarusidestrconsts.optdispgutterseparator
msgid "Separator"
msgstr ""
#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
msgid "Use current line color"
msgstr ""
#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
msgid "Use current line number color"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Tambah Inverse"
#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr ""
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
msgstr ""
#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr ""
#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr ""
#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr ""
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Definisi kondisional"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Buat definisi baru"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string (Ctrl+F)"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr ""
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr ""
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr ""
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria (Ctrl+N)"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search (F5)"
msgstr ""
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""
#: lazarusidestrconsts.rsresourcefilename
msgctxt "lazarusidestrconsts.rsresourcefilename"
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tipe"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""
#: lazarusidestrconsts.rsshowabspath
msgid "Absolute path"
msgstr ""
#: lazarusidestrconsts.rsshowfilename
msgctxt "lazarusidestrconsts.rsshowfilename"
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsshowpathmode
msgid "Path display mode (Ctrl+P)"
msgstr ""
#: lazarusidestrconsts.rsshowrelpath
msgid "Relative path"
msgstr ""
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr ""
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Perintah menu Panduan"
#: lazarusidestrconsts.srkmcatclipboard
msgid "Clipboard commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Perintah Perintah"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Perintah CodeTools"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Perintah pemindahan kursor"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Perintah pengeditan teks"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Perintah menu File"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makro"
#: lazarusidestrconsts.srkmcatmarker
#, fuzzy
#| msgid "Text marker commands"
msgid "Text bookmark commands"
msgstr "Perintah penanda teks"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr ""
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Perintah menu Proyek"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Perintah menu Jalankan"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Perintah pencarian dan penggantian teks"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Perintah pemindahan teks"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Perintah Notebook Sumber"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Perintah menu Piranti"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Perintah menu Lihat"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Perintah:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflik"
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "batalkan pembangunan"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
#, fuzzy
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "Tambahkan titik lompat"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "tambah pengawasan"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Penyempurnaan template kode"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockindent
#, fuzzy
#| msgid "Indent block"
msgid "Indent line/block"
msgstr "Lekukan Blok"
#: lazarusidestrconsts.srkmecblockindentmove
msgid "Indent line/block (move columns)"
msgstr ""
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""
#: lazarusidestrconsts.srkmecblockunindent
#, fuzzy
#| msgid "Unindent block"
msgid "Unindent line/block"
msgstr "Jangan lekukan blok"
#: lazarusidestrconsts.srkmecblockunindentmove
msgid "Unindent line/block (move columns)"
msgstr ""
#: lazarusidestrconsts.srkmecbreakpointproperties
msgid "show breakpoint properties"
msgstr ""
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "bangun program/proyek"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "bangun file"
#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "Bangun Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr ""
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Karakter"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Hapus seluruh teks"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Mode pemilihan kolom"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "file konfig pembangunan"
#: lazarusidestrconsts.srkmeccopy
#, fuzzy
#| msgid "Copy selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Copy pilihan ke clipboard"
#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy (Add to Clipboard)"
msgstr ""
#: lazarusidestrconsts.srkmeccopyaddcurrentline
msgid "Copy current line (Add to Clipboard)"
msgstr ""
#: lazarusidestrconsts.srkmeccopycurrentline
msgid "Copy current line"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmeccut
#, fuzzy
#| msgid "Cut selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Potong pilihan ke clipboard"
#: lazarusidestrconsts.srkmeccutadd
msgid "Cut (Add to Clipboard)"
msgstr ""
#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line (Add to Clipboard)"
msgstr ""
#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line"
msgstr ""
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Hapus sampai awal baris"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Hapus karakter di kursor"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Hapus sampai akhir baris"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Hapus Karakter Terakhir"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Hapus sampai awal kata"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Hapus baris saat ini"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Hapus sampai akhir kata"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr ""
#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Pindahkan kursor ke absolut akhir"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Pindahkan kursor ke absolut awal"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr ""
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "evaluasi/modifikasi"
#: lazarusidestrconsts.srkmecextractproc
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Ekstraks prosedur"
#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Piranti eksternal %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Seting piranti eksternal"
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "Cari teks"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Cari akhir blok lain"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Cari awal blok"
#: lazarusidestrconsts.srkmecfinddeclaration
#, fuzzy
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "Cari deklarasi"
#: lazarusidestrconsts.srkmecfindidentifierrefs
#, fuzzy
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "Cari referensi pengenal"
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "Cari dalam file"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Cari berikutnya"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
#, fuzzy
#| msgid "Find next word occurrence"
msgid "Find Next Word Occurrence"
msgstr "Cari keberadaan kata berikutnya"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "Cari sebelumnya"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
#, fuzzy
#| msgid "Find previous word occurrence"
msgid "Find Previous Word Occurrence"
msgstr "Cari keberadaan kata sebelumnya"
#: lazarusidestrconsts.srkmecfindproceduredefinition
#, fuzzy
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "Cari definisi procedure"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Cari metode procedure"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecfoldtoggle
msgid "Toggle Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format
msgid "Go to editor %d"
msgstr "Pergi ke editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
#, fuzzy
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "Pergi ke direktif include dari file include saat ini"
#: lazarusidestrconsts.srkmecgotolinenumber
#, fuzzy
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "Pergi ke nomor baris"
#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format, fuzzy
#| msgid "Go to Marker %d"
msgid "Go to bookmark %d"
msgstr "Pergi ke Penanda %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Pergi ke XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "Tebak $IFDEF salah tempat"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Sisipkan entri ChangeLog"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Sisipkan dari Charactermap"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Sisipkan Pembuat kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Sisipkan Tanggal kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Sisipkan Header kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Sisipkan ID kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Sisipkan Log kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Sisipkan Nama kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Sisipkan Revisi kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Sisipkan Sumber kata kunci CVS"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Sisipkan tanggal dan waktu saat ini"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Sisipkan catatan GPL"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Sisipkan catatan LGPL"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Pisahkan baris, biarkan kursor"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Mode Sisipan"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Sisipkan catatan LGPL yang diubah"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Sisipkan nama pemakai saat ini"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspeksi"
#: lazarusidestrconsts.srkmecinvertassignment
#, fuzzy
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Balikkan penempatan"
#: lazarusidestrconsts.srkmecjumptonextsearchresult
msgid "Jump to next search result"
msgstr ""
#: lazarusidestrconsts.srkmecjumptoprevsearchresult
msgid "Jump to previous search result"
msgstr ""
#: lazarusidestrconsts.srkmeckeymapleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Left"
#: lazarusidestrconsts.srkmeckeymapright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Right"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Pisahkan baris dan pindahkan kursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Pindahkan kursor ke akhir baris"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Mode pemilihan baris"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Pindahkan kursorke awal baris"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""
#: lazarusidestrconsts.srkmecmakeresourcestring
#, fuzzy
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "Buat string resource"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Pergi ke kurung yang sama"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Pindahkan editor ke kiri"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Pindahkan editor ke kanan"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr ""
#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr ""
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Penanda berikutnya"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Pergi ke editor berikutnya"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Mode pilihan normal"
#: lazarusidestrconsts.srkmecopenfileatcursor
#, fuzzy
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "Buka file di kursor"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Mode Menimpa"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Pindahkan kursor ke bawah halaman"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Pindahkan kursor turun satu halaman"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Pindahkan kursor ke kiri satu halaman"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Pindahkan kursor ke kanan satu halaman"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Pindahkan kursor ke atas halaman"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Pindahkan kursor naik satu halaman"
#: lazarusidestrconsts.srkmecpaste
#, fuzzy
#| msgid "Paste clipboard to current position"
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Paste clipboard ke posisi saat ini"
#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pause program"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Penanda sebelumnya"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Pergi ke editor sebelumnya"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "kompilasi cepat, tanpa linking"
#: lazarusidestrconsts.srkmecremovebreakpoint
#, fuzzy
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "hapus break point"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr ""
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr ""
#: lazarusidestrconsts.srkmecrenameidentifier
#, fuzzy
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "Ganti nama pengenal"
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "Ganti teks"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Melaporkan bug..."
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reset debugger"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "jalankan program"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "jalankan file"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parameter menjalankan"
#: lazarusidestrconsts.srkmecrunwithdebugging
msgid "run with debugging"
msgstr ""
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr ""
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Gulung sebaris ke bawah"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Gulung satu karakter ke kiri"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Gulung satu karakter ke kanan"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Gulung sebaris ke atas"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Pilih Turun"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Pilih Semua"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Ubah tab ke spasi dalam pilihan"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Pilih ke absolut akhir"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Pilih ke absolut awal"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Pilih Pergi ke XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
#, fuzzy
#| msgid "SelLeft"
msgid "Select Left"
msgstr "PilihKiri"
#: lazarusidestrconsts.srkmecsellineend
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Pilih Akhir Baris"
#: lazarusidestrconsts.srkmecsellinestart
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Pilih Awal Baris"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecselpagebottom
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Pilih Halaman ke Bawah"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Pilih Halaman Turun"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Pilih Halaman ke Kiri"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Pilih Halaman ke Kanan"
#: lazarusidestrconsts.srkmecselpagetop
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Pilih Halaman ke Atas"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Pilih Halaman Naik"
#: lazarusidestrconsts.srkmecselright
#, fuzzy
#| msgid "SelRight"
msgid "Select Right"
msgstr "Pilih Kanan"
#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Pilih Naik"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Pilih Sekata ke Kiri"
#: lazarusidestrconsts.srkmecselwordright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Pilih Sekata ke Kanan"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format, fuzzy
#| msgid "Set Marker %d"
msgid "Set bookmark %d"
msgstr "Set Penanda %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr ""
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Tampilkan konteks kode"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""
#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "hentikan program"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
msgid "Add Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
msgid "Add Cell (case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
msgid "Add Cell (context-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
msgid "Add Cell (context & case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
msgid "Remove current Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
msgid "Grow cell on the left"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
msgid "Grow cell on the right"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
msgid "Shrink cell on the left"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
msgid "Shrink cell on the right"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
msgid "Start Syncro edit (case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
msgid "Start Syncro edit (context-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
msgid "Start Syncro edit (context & case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
#, fuzzy
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "Pemeriksaan Sintaks"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Lihat breakpoint"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Lihat pemanggilan stack"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Lihat browser kode"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Lihat Eksplorer Kode"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Lihat palet komponen"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Lihat output debugger"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Tukar antara form dan unit"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Lihat Editor Dokumentasi"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Lihat tombol cepat IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Lihat variabel lokal"
#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr ""
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""
#: lazarusidestrconsts.srkmectogglememviewer
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
msgid "View Mem viewer"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Lihat pesan"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Toggle Mode"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Lihat Inspektor Objek"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Lihat Hasil Pencarian"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Lihat Editor Sumber"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Lihat pengawasan"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "perintah editor tidak dikenal"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr ""
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Lihat editor anchor"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Lihat form"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Lihat ketergantungan unit"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Lihat informasi unit"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Lihat unit"
#: lazarusidestrconsts.srkmecwordcompletion
#, fuzzy
#| msgid "Word completion"
msgid "Word Completion"
msgstr "Penyempurnaan kata"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Pindahkan kursor sekata ke kiri"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Pindahkan kursor sekata ke kanan"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr ""
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr ""
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr ""
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr ""
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "File adalah hanya-baca"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "File \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" tidak bisa ditulisi."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Tambah &Pengawasan Di Kursor"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr ""
#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr ""
#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr ""
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""
#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr ""
#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr ""
#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr ""
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Tutup Halaman"
#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Copy nama file"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr ""
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Debug"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Cari Deklarasi"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "Per&gi ke penujuk"
#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr ""
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts.ueminspect
#, fuzzy
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Inspeksi ..."
#: lazarusidestrconsts.ueminvertassignment
#, fuzzy
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Balikkan Penempatan"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr ""
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr ""
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr ""
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr ""
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr ""
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr ""
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "Pergi ke Penunjuk berikutnya"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Dimodifikasi"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "&Buka file di kursor"
#: lazarusidestrconsts.uemprevbookmark
#, fuzzy
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "Pergi ke Penunjuk sebelumnya"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Procedure Lompat"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Hanya Baca"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"
#: lazarusidestrconsts.uemsetfreebookmark
#, fuzzy
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Set penunjuk bebas"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Tampilkan Niomor Baris"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr ""
#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr ""
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr ""
#: lazarusidestrconsts.uemviewcallstack
#, fuzzy
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Lihat Panggilan Stack"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Belum Di Imlementasikan"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Hanya-baca"
#: lazarusidestrconsts.uepselchars
#, object-pascal-format
msgid "%d"
msgstr ""
#: lazarusidestrconsts.uepselcol
msgid "COL"
msgstr ""
#: lazarusidestrconsts.uepselcxchars
#, object-pascal-format
msgid "%d * %d"
msgstr ""
#: lazarusidestrconsts.uepselline
#, fuzzy
#| msgid "Line"
msgctxt "lazarusidestrconsts.uepselline"
msgid "LINE"
msgstr "Baris"
#: lazarusidestrconsts.uepselnorm
msgid "DEF"
msgstr ""
#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr ""
#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr ""
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Info Versi"