lazarus/languages/lazaruside.plwin.po
jesus 037203ea19 translations update
git-svn-id: trunk@17606 -
2008-11-26 20:45:06 +00:00

12426 lines
329 KiB
Plaintext
Raw Blame History

msgid ""
msgstr ""
"Last-Translator: Dominik Zablotny <dominz@wp.pl>\n"
"PO-Revision-Date: 2004-02-06 09:01+0100\n"
"Project-Id-Version: lazaruside\n"
"Language-Team: polski <pl@li.org>\n"
"Content-Type: text/plain; charset=CP1250\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: KBabel 1.3\n"
"Plural-Forms: nplurals=3; plural=(n==1 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Ma³ymi Literami, Pierwsza Du¿a"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Dodatkowa œcie¿ka poszukiwañ dla wszystkich projektów (.pp;.pas)"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr ""
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Wyrównaj górn¹ liniê do komentarza z przodu"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Wszystkie pliki"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabetycznie"
#: lazarusidestrconsts.dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr ""
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Przy niejednoznacznej nazwie pliku:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Ostrzegaj przed kompilacj¹"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Ustawienia aplikacji"
#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Domyœlnie"
#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Do³¹cz kod zabezpieczaj¹cy"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatycznie twórz:"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Nowe formularze dodawaj do tworzonych automatycznie"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Automatycznie usuñ plik"
#: lazarusidestrconsts.dlgautoform
msgid "Auto create form when opening unit"
msgstr "Automatycznie twórz formularz przy otwieraniu jednostki"
#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr ""
#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automatyczne zapisywanie"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Dostêpne formularze:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr ""
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr ""
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Taka sama nazwa (w podkatalogu)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Za metodami"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "KompatybilnoϾ z TP/BP 7.0"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Zastosuj"
#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Anuluj"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "W kolejnoœci klas"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Na koñcu"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "ma³ymi literami"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Podgl¹d (maks. d³ugoœæ wiersza = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Przedrostek odczytu"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Przyrostek \"zachowany\""
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "WIELKIMI LITERAMI"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Przedrostek zmiennej"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Przedrostek zapisu"
#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Wyœrodkuj aktualny wiersz"
#: lazarusidestrconsts.dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr ""
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr ""
#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "SprawdŸ spójnoœæ"
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Wybierz szablon Ÿród³a (*.dci)"
#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Zasady wstawiania czêœci klas"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr ""
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr ""
#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Makra w stylu C (globalne)"
#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "U¿ywaj napisów typu Ansi"
#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "[bez zmian]"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr ""
#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Sprawdzaj:"
#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Kompilacja"
#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operatory w stylu jêzyka C ( +=, -=, *= i /= )"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Twórz informacjê odpluskwiacza dla DBX (zwalnia kompilacjê)"
#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Odpluskwianie:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Tworzenie Ÿród³a"
#: lazarusidestrconsts.dlgcodegeneration
msgid "Code"
msgstr "Kod"
#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr ""
#: lazarusidestrconsts.dlgcodetoolstab
msgid "Code Tools"
msgstr "Narzêdzia Ÿróde³"
#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Szybki"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Twórz informacjê odpluskwiacza dla GDB (zwalnia kompilacjê)"
#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Kod:"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "U¿yj modu³u Heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr ""
#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Inherited"
#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "£¹czenie"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Za³aduj/Zapisz"
#: lazarusidestrconsts.dlgcomessages
msgctxt "lazarusidestrconsts.dlgcomessages"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametry linii poleceñ (bez nazwy pliku)"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opcje kompilatora"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Uzupe³niaj w³aœciwoœci"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Pliki konfiguracyjne:"
#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr ""
#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Opcje: "
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Inne"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Przepe³nienie"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analiza"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Zakres"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "B³êdy"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "Show Options"
msgstr "Poka¿ opcje"
#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Ma³y"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""
#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stos"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "WyczyϾ z symboli plik wykonywalny"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Rodzaj modu³u:"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""
#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE w stylu C++"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kursor poza koñcem linii"
#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor options:"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Inne rozszerzenie (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Rodzaj i œcie¿ka do odpluskwiacza"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Domyœlna czcionka edytora"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr ""
#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Rozszerzenia Delphi 2"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Usuñ szablon "
#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "KompatybilnoϾ z Delphi"
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Pulpit"
#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Ustawienia pulpitu"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Kierunek"
#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Katalog nie istnieje"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""
#: lazarusidestrconsts.dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" nie istnieje."
#: lazarusidestrconsts.dlgdoubleclickline
msgid "Double click line"
msgstr "Podwójne klikniêcie zaznacza wiersz"
#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "W dó³"
#: lazarusidestrconsts.dlgdragdroped
msgid "Drag Drop editing"
msgstr ""
#: lazarusidestrconsts.dlgdropfiles
msgid "Drop files"
msgstr ""
#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Dodaj..."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "W ty³"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Pogrubiony"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Podkatalog"
#: lazarusidestrconsts.dlgedcodeparams
msgid "Code parameters"
msgstr "Parametry kodu"
#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Szablony Ÿróde³"
#: lazarusidestrconsts.dlgedcolor
msgid "Syntax highlight"
msgstr "Kolor"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Inne rozszerzenie"
#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "OpóŸnienie"
#: lazarusidestrconsts.dlgeddelete
msgid "Delete"
msgstr "Usuñ"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Ekran"
#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Edytuj..."
#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Pliki edytora"
#: lazarusidestrconsts.dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Porada: kliknij na poleceniu które chcesz edytowaæ"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Uzupe³niaj identyfikatory"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Pochy³y"
#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Czcionka"
#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "WysokoϾ czcionki"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""
#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Nie znalaz³em b³êdnych klawiszy skrótu."
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Podkreœlony"
#: lazarusidestrconsts.dlgedusedefcolor
msgid "Use default color"
msgstr "Domyœlny kolor"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Zapytaj"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Informacja: Plikami projektu s¹ wszystkie pliki w jego katalogu"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Kopia zapasowa"
#: lazarusidestrconsts.dlgenvcolors
msgid "Colors"
msgstr "Kolory"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Pliki"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Siatka"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Jêzyk"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Linie naprowadzaj¹ce"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Pozosta³e"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Brak"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Inne pliki"
#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projekt"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dod. odstêp miêdzy wierszami"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr ""
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Wyszukaj tekst przy kursorze"
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Kolor tekstu"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Zasady wstawiania procedur"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Zachowaj kolejnoϾ procedur"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr ""
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Katalog Ÿróde³ FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Frame color"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Edytor formularza"
#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr ""
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opcje"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Pobierz pozycjê"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "KompatybilnoϾ z GPC (GNU Pascal Compiler)"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Twórz kod dla gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Kolor paska ikon"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Kolor siatki"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rozmiar siatki X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Odstêpy poziome siatki"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rozmiar siatki Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Odstêpy pionowe siatki"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Œrodowisko"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Poka¿ do linie naprowadzaj¹ce"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Kolor paska ikon"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "SzerokoϾ paska ikon"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Rozmiar stosu"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "WysokoϾ"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Ukryj okna IDE przy uruchomieniu"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr ""
#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Pokazuj wskazówki przy nieu¿ywanych modu³ach w g³ównym Ÿródle"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr ""
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "G³ówna aplikacja"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Uzupe³niaj identyfikatory"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Identyfikatorów"
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignoruj"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Do³¹cz zmienne systemowe"
#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Wetnij kod do"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indents/Tabs options:"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Przed metodami"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Konstruktor musi nazywaæ siê 'init' (destruktor - 'done')"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Wstaw odstêp po"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Wstaw odstêp przed"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Odstêp w sekundach"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skoki (np. skoki do metod)"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Klawisze skrótu"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "B³êdne klawisze skrótu"
#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Schemat klawiszy skrótu"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "S³ów kluczowych"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Pozwalaj na instrukcje LABEL i GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Jêzyk"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Na koñcu (np. na koñcu Ÿród³a)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Katalog Lazarusa (domyœlny dla wszystkich projektów)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Od lewej:"
#: lazarusidestrconsts.dlglefttopclr
msgid "color for left, top"
msgstr "Kolor lewej i górnej"
#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr ""
#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr ""
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Dzielenie linii"
#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr ""
#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "£¹cz sprytnie"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Wyœwietlaj numery linii w zrzucie b³êdu uruchomieniowego:"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Odczytaj z pliku"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu g³ówne"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Poka¿ formularze projektu"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr ""
#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Poka¿ modu³y projektu"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margines i pasek ikon"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Kolor zaznaczenia"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maksymalny licznik"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maks. d³ugoœæ wiersza:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Liczba niedawno otartych plików"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Liczba niedawno otartych projektów"
#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Zasady wstawiania metod"
#: lazarusidestrconsts.dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Minimalizuj wszystkie okna razem z g³ównym"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mieszanie metod i w³aœciwoœci"
#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse options:"
msgstr ""
#: lazarusidestrconsts.dlgmouselinks
msgid "Mouse links"
msgstr "Powi¹zania myszy"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr ""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nazewnictwo"
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Nie dziel wiersza po:"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Nie dziel wiersza przed:"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "WysokoϾ elementu"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Pozosta³e"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opcje"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""
#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optymalizacje:"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Podpowiedzi dla palety komponentów"
#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Domyœlne rozszerzenie pascala"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Przeœlij opcje do linkera (oddzielone spacj¹)"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikacja"
#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr ""
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formularze"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Pozosta³e"
#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Ustawienia wyjœcia"
#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr ""
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr ""
#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Docelowa nazwa pliku"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Nazwa:"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opcje projektu"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Pliki projektu"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr ""
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Uzupe³nianie w³aœciwoœci"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr ""
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Otwieraj poprzedni projekt po uruchomieniu"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr ""
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr ""
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Poka¿ siatkê"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Przyci¹gaj do siatki"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr ""
#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr ""
#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Zamieñ na"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Raport"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "color for right, bottom"
msgstr "Kolor prawej i dolnej"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr ""
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "po³o¿enie marginesu"
#: lazarusidestrconsts.dlgrightmargincolor
msgid "Right margin color"
msgstr "Kolor prawego marginesu"
#: lazarusidestrconsts.dlgrightmousemovescursor
msgid "Right mouse moves cursor"
msgstr ""
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Katalog roboczy"
#: lazarusidestrconsts.dlgrubberbandgroup
msgid "Rubber band"
msgstr "Obwódka do rozci¹gania"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr "Wybierz wszystkie wewn."
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Creation"
msgstr "Tworzenie"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgid "Selection"
msgstr "Wybór"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Ekran (nie dotyczy win32), np. 198.112.45.11:0, x.org:1, hydra:0.1"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Œrodowisko"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokalne"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Zmienne systemowe"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "U¿yj ekranu"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Nadpisanie zmiennych"
#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr ""
#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Zmienna"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Parametry uruchomienia"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Zapisz do pliku"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Zapisuj informacjê edytora dla zamykanych plików"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Zapisuj informacjê edytora tylko dla plików projektu"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Zasiêg"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scroll options:"
msgstr ""
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr ""
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Scroll past end of line"
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Wyszukiwane przerwane przez u¿ytkownika"
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Wyszukiwanie..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Œcie¿ki"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Domyœlny wygl¹d wszystkich elementów"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Domyœlny wygl¹d elementu"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Zmiennna w³aœciwoœci"
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Napisy na komponentach"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""
#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Poka¿ opcje kompilatora"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr ""
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr ""
#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr ""
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Podpowiedzi edytora"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr ""
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr ""
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""
#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Wskazówki"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Uwagi"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr ""
#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Wszystkie procs przy b³êdzie"
#: lazarusidestrconsts.dlgshowscrollhint
msgid "Show scroll hint"
msgstr ""
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr ""
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr ""
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr ""
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Ostrze¿enia"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr ""
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Przyrostek (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Licznik (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Przedrostek (~.pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Przyci¹gaj do linii naprowadzaj¹cych"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Odstêp"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Podpowiedzi dla g³ównych przycisków (otwórz, zapisz, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Rozpocznij"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "S³owo kluczowe static w obiektach"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zatrzymuj po liczbie b³êdów:"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr ""
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr ""
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr ""
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Katalog do budowania testowych projektów"
#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&ZnajdŸ"
#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Katalog \""
#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "sek"
#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Rozwijaj wartoœci w podpowiedziach"
#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Podpowiedzi narzêdzi symbolicznych"
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Od góry:"
#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Plik szablonu"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr ""
#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Inne, mniej wa¿ne optymalizacje"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Cofnij po zapisaniu"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo options:"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr ""
#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr ""
#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Zaleznoœci modu³ów"
#: lazarusidestrconsts.dlgunitdeprefresh
msgid "Refresh"
msgstr "Odœwie¿"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "W górê"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr ""
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr ""
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "U¿yj programu ³aduj¹cego"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Podœwietlaj sk³adniê"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "WartoϾ"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Pokazuj pasek ikon"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Pokazuj margines"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr ""
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "SzerokoϾ:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr ""
#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Pozycje okien"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "WielkoϾ liter"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Podgl¹d"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr ""
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Wybrane komponenty musz¹ byæ na tym samym formularzu"
#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Wyrównaj"
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete selection"
msgstr "Usuñ zaznaczenie"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Poziome odbicie lustrzane"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Pionowe odbicie lustrzane"
#: lazarusidestrconsts.fdmorder
msgid "Order"
msgstr ""
#: lazarusidestrconsts.fdmorderbackone
msgid "Back one"
msgstr ""
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward one"
msgstr ""
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to back"
msgstr ""
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to front"
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save form as xml"
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skala"
#: lazarusidestrconsts.fdmshowoptions
msgid "Show Options for form editing"
msgstr "Pokazuj opcje edycji formularzy"
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Rozmiar"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opcja: Równaj do siatki"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opcja: Równaj do linii naprowadzaj¹cych"
#: lazarusidestrconsts.fdmtaborder
msgid "Tab order..."
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""
#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Dodaj plik"
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Dodaj pliki"
#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Dodaj pliki do pakietu"
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Dodaj pliki LFM, LRS, jeœli istniej¹"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Dodaj do pakietu"
#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Dodaj modu³"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Niejednoznaczy typ przodka"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Niejednoznaczna nazwa klasy"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Niejednoznaczna nazwa modu³u"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ przodka"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Zerwane zale¿noœci"
#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Jest ju¿ klasa o tej nazwie."
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Zale¿noœæ"
#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sIstniej¹cy plik: %s%s%s"
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Plik ju¿ istnieje"
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Plik o nazwie %s%s%s ju¿ nale¿y do projektu."
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Plik ju¿ nale¿y do pakietu"
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Plik jest w u¿yciu"
#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Nazwa pliku:"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Nazwa pliku"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Plik nie jest modu³em"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Nieprawid³owy typ przodka"
#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Niedopuszczalne zapêtlenie"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nieprawid³owa nazwa klasy"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Nieprawid³owy plik"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "B³êdna nazwa pliku"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "B³êdna nazwa modu³u"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s nie jest prawid³ow¹ nazw¹ modu³u."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nazwa nowej klasy:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Nowy komponent"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr ""
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Nie znalaz³em pakietu dla zale¿noœci %s%s%s.%sWybierz _istniej¹cy_ pakiet."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nazwa zak³adki jest zbyt d³uga"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Zak³adka palet:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Modu³y pascala musz¹ mieæ rozszerzenie .pp lub .pas"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr ""
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr ""
#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr ""
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Prze³¹cz œcie¿ki"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Typ przodka %s%s%s ma tak¹ sam¹ nazwê jak%smodu³ %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Typ przodka %s%s%s nie jest poprawnym identyfikatorem pascala."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Nazwa klasy %s%s%s i typ przodka %s%s%s s¹ jednakowe."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Klasa o nazwie %s%s%s istnieje ju¿ w%spakiecie %s%sPlik: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Klasa %s%s%s ma tak¹ sam¹ nazwê jak%smodu³ %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa klasy %s%s%s nie jest prawid³owym identyfikatorem pascala."
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Plik %s%s%s ju¿ nale¿y do pakietu."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Plik %s%s%s nale¿y ju¿ do bie¿¹cego projektu.%sDzielenie pliku pomiêdzy projektami i pakietami to nie jest dobry pomys³."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Pakiet ma ju¿ zale¿noœæ od pakietu %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Nazwa pakietu %s%s%s%s jest nieprawid³owa.%sProszê wybraæ istniej¹cy pakiet."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Nazwa zak³adki %s%s%s jest zbyt d³uga (maks. 100 znaków)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Modu³ o nazwie %s%s%s ju¿ nale¿y do pakietu %s%s."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "W tym pakiecie jest ju¿ modu³ o nazwie %s%s%s."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr ""
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Nazwa modu³u %s%s%s nie odpowiada nazwie pliku."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Nazwa modu³u %s%s%s jest taka sama jak nazwa zainstalowanego komponentu.%sU¿ywanie jej mo¿e spowodowaæ dziwne b³êdy."
#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Nazwa pliku modu³u:"
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr ""
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Nazwa modu³u:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Modu³ o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nieprawid³owa nazwa modu³u"
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Przeskanuj modu³ w poszukiwaniu nazwy i procedury Register"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr ""
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr ""
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "O lazarusie"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr ""
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr ""
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""
#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr ""
#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr ""
#: lazarusidestrconsts.lisadditionalinformation
msgid "Additional Information"
msgstr ""
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Chcesz dodaæ %s do projektu?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Dodaj plik do pakietu"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Pakiet docelowy"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Typ pliku"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Ma procedurê Register"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "B³êdny pakiet"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "B³êdny identyfikator pakietu: %s%s%s"
#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Wirtualny modu³ (brak Ÿróde³ w pakiecie)"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pakiet jest dostêpny tylko do odczytu"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Nie znalaz³em pakietu %s%s%s."
#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Poka¿ wszystkie"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Pakiet %s jest dostêpny tylko do odczytu"
#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Nazwa modu³u:"
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Plik %s%s%s ju¿ istnieje.%sChcesz go zast¹piæ?"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr ""
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr ""
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Znalaz³em niejednoznaczny plik"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Znalaz³em dwuznaczn¹ nazwê pliku: %s%s%s%sTen plik mo¿e byæ pomylony z %s%s%s%s%sUsun¹æ dwuznaczy plik?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Znalaz³em nietypowy plik"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr ""
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr ""
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr ""
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr ""
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Automatic features"
msgstr ""
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""
#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Nie mo¿na utworzyæ kopii zapasowej pliku"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Zmiananazwy pakietu lub wersji ³amioe zale¿noœci. Czy zte zale¿noœci powinny tak¿e zostaæ zmienione?%sWciœnij tak aby zmieniæ wszystkie podane zale¿noœci.%sWybierz ignoruj aby z³amaæ zale¿noœci i kontynuowaæ."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr ""
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr ""
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""
#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr ""
#: lazarusidestrconsts.lisbottom
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr ""
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr ""
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""
#: lazarusidestrconsts.lisbreak
msgid "Break"
msgstr ""
#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr ""
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Utwórz nowy projekt"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr ""
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr ""
#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "B³¹d"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts.lisccospaces
msgid "spaces"
msgstr ""
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr ""
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr ""
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr ""
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr ""
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr ""
#: lazarusidestrconsts.lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr ""
#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr ""
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr ""
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr ""
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts.lisceproperties
msgid "Properties"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgid "Uses"
msgstr ""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts.lischangeparent
msgid "Change parent ..."
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Tablica znaków"
#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Wybierz inn¹ nazwê"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr ""
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Wybierz nazwê pliku odpluskwiacza"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr ""
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Wybierz katalog"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Wybierz katalog Ÿróde³ FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Wybierz katalog lazarusa"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Wybierz Ÿród³o programu (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr ""
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr ""
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "CzyϾ podkatalogi"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Zachowaj wszystkie pliki tekstowe"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Zachowaj wybrane pliki"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Usuñ wyselekcjonowane pliki"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Uproszczona sk³adnia (np. * zamiast .*)"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Czyœæ Ÿród³a Lazarusa (clean)"
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr ""
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr ""
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opcje interfejsu LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr ""
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr ""
#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr ""
#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Kompiluj"
#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr ""
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr ""
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Polecenie:"
#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr ""
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "domyœlnie (%s)"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr ""
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr ""
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr ""
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr ""
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Inherited"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr ""
#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr ""
#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr ""
#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr ""
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr ""
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr ""
#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
msgid "Add"
msgstr "Dodaj"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Dodaj szablon kodu"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Token %s%s%s ju¿ istnieje! "
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""
#: lazarusidestrconsts.liscodetemplchange
msgid "Change"
msgstr "Zmieñ"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentarz:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Edytuj szablon kodu"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "B³¹d"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akcja: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Wêz³y utworzone automatycznie nie mog¹ byæ zmieniane %si nie mo¿na dodawaæ rêcznie wêz³ów potomnych"
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, utworzony automatycznie"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Wêz³y utworzone automatycznie nie mog¹ byæ zmieniane"
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Podgl¹d dyrektyw CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "œcie¿ka do kompilatora"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konwertuj"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Utwórz 'Defines' dla %s katalogu"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Utwórz 'Defines' dla Free Pascal Compiler"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Utwórz 'Defines' dla katalogu Lazarusa"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Utwórz 'Defines' dla projektu %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Utwórz makra FPC i œcie¿ki dla katalogu z projektem fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "\"Define\""
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Rekursywne \"Define\""
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Usuñ element"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Katalog g³ówny %s,%sgdzie Borland instalowa³ wszystkie Ÿród³a %s.%sNa przyk³ad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "G³ówny katalog %s,%sgdzie Borland instalowa³ %s wszystkie Ÿród³a,%sktóre s¹ u¿ywane przez projekt %s.%sNa przyk³ad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Opis:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s katalog"
#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Zmieñ"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "B³¹d odczytu %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "B³¹d odczytu pliku informacji o projekcie %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "B³¹d podczas zapisywania %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "B³¹d podczas zapisywania informacji o projekcie do %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "WyjdŸ"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "WyjdŸ bez zapisywania"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Katalog"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Kompilator Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Katalog Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Projekt Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Kompilator Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Katalog Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Projekt Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Wstaw szablon kompilatora dla Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Wstaw szablon katalogów dla Delhi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Wstaw szablon projektu Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Free Pascal Compiler"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Projekt Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Wstaw szablon kompilatora dla Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Wstaw szablon katalogu Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Wstaw szablon projektu Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Katalog Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Wstaw jako potomny"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Wstaw poni¿ej"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Wstaw szablon"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "B³êdny rodzic"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "B³êdny element rodzica"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "B³¹dny poprzedni element"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s katalog g³ówny,%sgdzie Borland Zainstalowa³ wszystkie %s Ÿród³a.%sNp: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s g³ówny katalog ,%sgdzie Borland zainstalowa³ %s wszystkie Ÿród³a,%sktóre s¹ u¿ywane przez projekt %s.%snp: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Przesuñ w dó³"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Przesuñ o poziom ni¿ej"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Przesuñ o poziom wy¿ej"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Przesuñ w górê"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nazwa:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nowy element"
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Element i potomne s¹ prawid³owe tylko dla tego projektu"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Element tylko do odczytu"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nie wybrano elementu"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Rodzic nie mo¿e zawieraæ elementów"
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Poprzedni element nie mo¿e zawieraæ potomnych"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "katalog projektu %s"
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Zapisz i wyjdŸ"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Wybrany element:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Katalog projektu Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "G³ówny katalog Lazarusa"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Katalog projektu %s, który zawiera plik .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "\"Undefine\""
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "\"Undefine All\""
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Rekursywne \"Undefine\""
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "WartoϾ jako tekst"
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Zmienna:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Na"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dwukropek"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Kropka"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identyfikator"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "S³owo kluczowe"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nowa linia"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Brak"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Liczba"
#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punkt"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Œrednik"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Odstêp"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Sta³a napisowa"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Wykonaj po"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Wykonaj przed"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr ""
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr ""
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Polecenie po module publikacji"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametry wiersza poleceñ programu"
#: lazarusidestrconsts.liscomments
msgid "Comments:"
msgstr ""
#: lazarusidestrconsts.liscompany
msgid "Company:"
msgstr ""
#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Kompiluj IDE (bez linkowania)"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr ""
#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "B³¹d kompilatora"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "B³¹d: nieprawid³owy kompilator: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nazwa pliku kompilatora"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Porada: mo¿esz ustawiæ œcie¿kê kompilatora w Œrodowisko->Opcje œrodowiska->Pliki->Œcie¿ka kompilatora"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "UWAGA: brak plik konfiguracji codetools - u¿yjê opcji domyœlnych"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "UWAGA: ³adujê stary plik opcji codetools"
#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Opcje kompilatora dla projektu: %s"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (kompilacja ...)"
#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Jako nazwy komponentu %s%s%s próbujesz u¿yæ s³owa kluczowego"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Nazwa komponentu %s%s%s nie jest prawid³owym identyfikatorem"
#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Otwórz pakiet..."
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Otwórz modu³"
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Katalog z konfiguracj¹ Lazarusa"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr ""
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr ""
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr ""
#: lazarusidestrconsts.liscontinue
msgid "Continue"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr ""
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr ""
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr ""
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr ""
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr ""
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "B³¹d kopiowania"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr ""
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Szukaj komunikatów FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Szukaj komunikatów Make"
#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Poka¿ wszystkie komunikaty"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Pomiñ wywo³anie kompilatora"
#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Specyficzne opcje docelowego OS"
#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr ""
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr ""
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Najpierw utwórz projekt!"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Wartoœci katalogu Code Tools"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr ""
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nie wybrano zmiennej>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Poka¿ podgl¹d"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Narzêdzia"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Zmienna: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nazwa zmiennej"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr ""
#: lazarusidestrconsts.lisctinsertmacro
msgid "Insert Macro"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr ""
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""
#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Kolumna w miejscu kursora"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Wiersz w miejscu kursora"
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr ""
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr ""
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr ""
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr ""
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr ""
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr ""
#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "B³¹d odpluskwiacza"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "B³¹d odpluskwiacza%sOoops, odpluskwiacz wszed³ w stan b³êdu%sZapisz teraz swoj¹ pracê !%sWciœnij zatrzymaj, i miejmy nadziejê ¿e wszystko bêdzie dobrze."
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (odpluskwianie ...)"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrminterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nie mo¿na za³adowaæ pliku"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Nie mo¿na za³adowaæ pliku %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr ""
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Chcesz usun¹æ niejasny plik?"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Nie mo¿na usun¹æ pliku"
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Chcesz usun¹æ poprzedni plik %s%s%s?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Nie mo¿na usun¹æ pliku %s%s%s"
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr ""
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr ""
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Katalog docelowy %s%s%s ijest niew³aœciwy.%sWybierz pe³n¹ œcie¿kê."
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Bez rozró¿niania wielkoœci liter"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignoruj dodane lub usuniête puste linie"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignoruj ró¿ne znaki koñca wiersza (np. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignoruj iloœæ znaków odstêpu"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignoruj odstêpy (ale nie znaki koñca linii)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignoruj spacje na koñcu wiersza"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignoruj spacje na pocz¹tku wiersza"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Tylko zaznaczenie"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Otwórz Diff w edytorze"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr ""
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Zmienione pliki:"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kliknij na jeden z powy¿szych elementów aby zobaczyæ diff"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "B³¹d podczas odczytu pliku: %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignoruj zmiany na dysku"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Niektóre pliki na dysku uleg³y zmianie:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr ""
#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Edytor dokumentacji"
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr ""
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopiuj wybrane komponenty do schowka"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Wytnij wybrane komponenty do schowka"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr ""
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr ""
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr ""
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Wklej wybrane komponenty ze schowka"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Wybierz komponent-rodzica"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""
#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Wybierz zestaw"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Wszystkie pakiety"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Bie¿¹cy projekt"
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Katalog bie¿¹cego projektu"
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Globalny dodatek do œcie¿ki Ÿród³ówej"
#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "cie¿ka plików do³¹czanych projektu"
#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Scie¿ka Ÿróde³ projektu"
#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Œciezka modu³ów projektu"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "ustaw tryb FPC na DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "ustaw tryb FPC na GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "ustaw tryb FPC na TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "w³¹cz IOCHECKS"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "w³¹cz OVERFLOWCHECKS"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "w³¹cz RANGECHECKS"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr ""
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "u¿yj modu³u LineInfo"
#: lazarusidestrconsts.lisedtexttoolalt
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Poprawny wois narzêdzia wymaga przynajmniej nazwy i nazwy pliku."
#: lazarusidestrconsts.lisedtexttoolctrl
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Narzêdzie edycji"
#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Insert"
#: lazarusidestrconsts.lisedtexttoolkey
msgid "Key"
msgstr "Klawisz"
#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Makra"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametry:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nazwa pliku programu:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Przeszukuj wyjœcie komunikatów Free Pascal Compiler"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Przeszukuj wyjœcie komunikatów make"
#: lazarusidestrconsts.lisedtexttoolshift
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Wymagana nazwa i nazwa pliku"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Katalog roboczy:"
#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr ""
#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr ""
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts.lisenabled
msgid "Enabled"
msgstr ""
#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr ""
#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr ""
#: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Skok przez podwójne klikniêcie na komunikacie (inaczej - przez pojedyncze)"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Nie znalaz³em katalogu"
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu ze Ÿród³ami FPC \"%s\"."
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "B³êdna nazwa pliku kompilatora"
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Plik kompilatora \"%s\" nie jest wykonywalny."
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "B³êdna nazwa pliku odpluskwiacza"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Plik odpluskwiacza \"%s\" nie jest wykonywalny."
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Katalog lazarusa \"%s\" wygl¹da na niepoprawny. Powinien zawieraæ katalogi jak lcl, debugger, designer, components, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu Lazarusa \"%s\"."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu testowego \"%s\"."
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr ""
#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "B³¹d: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "B³¹d przy tworzeniu pliku"
#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "B³¹d podczas tworzenia lrs"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "B³¹d podczas usuwania pliku"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr ""
#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "B³¹d przy inicjowaniu programu%s%s%s%s%sB³¹d: %s"
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "B³¹d w trakcie zmiany nazwy pliku"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "B³êdy"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr ""
#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr ""
#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Wykonanie przerwane"
#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr ""
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Wykonanie zatrzymane"
#: lazarusidestrconsts.lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Wykonanie zatrzymane%s"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Rozszerzona nazwa bie¿¹cego pliku w edytorze"
#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr ""
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr ""
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr ""
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Nie uda³o siê uruchomiæ narzêdzia"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Osi¹gniêto maksymaln¹ liczbê narzêdzi"
#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "W dó³"
#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "W górê"
#: lazarusidestrconsts.lisexttoolremove
msgid "Remove"
msgstr "Usuñ"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Mo¿e byæ maksymalnie %s narzêdzi."
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Nie mo¿na uruchomiæ narzêdzia %s%s%s:%s%s"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Plik %s%s%s%sdoes nie wygl¹da na tekstowy.%sChcesz go otworzyæ go pomimo tego?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Plik %s%s%s%sdoes nie wygl¹da na tekstowy.%sChcesz go otworzyæ go pomimo tego?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr ""
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Plik %s%s%s jest wirtualny."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Nie znalaz³em pliku"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Nie znalaz³em pliku %s%s%s.%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Nie znalaz³em pliku %s%s%s.%sChcesz go utworzyæ?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Nazwa pliku nie jest napisana ma³ymi literami"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "To nie jest plik tekstowy"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""
#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Opcje katalogów"
#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Dodaj podkatalogi"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Tylko pliki tekstowe"
#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""
#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "ZnajdŸ:"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Szukaj"
#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr ""
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "B³¹d formatowania"
#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "B³¹d podczas ³adowania formularza"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr ""
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "B³êdny katalog Ÿróde³ FPC"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr ""
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr ""
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Katalog ze Ÿród³ami Freepascala"
#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr ""
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr ""
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr ""
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr ""
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr ""
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr ""
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr ""
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""
#: lazarusidestrconsts.lisfrirename
msgid "Rename"
msgstr ""
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr ""
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr ""
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr ""
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr ""
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Otwórz ..."
#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr ""
#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr ""
#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr ""
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr ""
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr ""
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Porada: Funkcja Make Resourcestring wymaga sta³ej napisowej.%sWybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Wskazówka: funkcja Utwórz napis zasobów oczekuje sta³ej napisowej%sWybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Prze³¹cz pomiêdzy formularzem i unitem"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Poka¿ formularze"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Poka¿ modu³y"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr ""
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr ""
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr ""
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr ""
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr ""
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE Options:"
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr ""
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr ""
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr ""
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr ""
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr ""
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr ""
#: lazarusidestrconsts.lisifdok
msgid "OK"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr ""
#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr ""
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr ""
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr ""
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr ""
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildbuild
msgctxt "lazarusidestrconsts.lisinfobuildbuild"
msgid "Build"
msgstr ""
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr ""
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr ""
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr ""
#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr ""
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr ""
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informacja o %s"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr ""
#: lazarusidestrconsts.lisinstalledpackages
msgid "Installed Packages"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr ""
#: lazarusidestrconsts.lisinternalname
msgid "Internal Name:"
msgstr ""
#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr ""
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "B³êdne polecenie"
#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr ""
#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "B³êdny katalog docelowy"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "B³êdne wyra¿enie.%sWskazówka: funkcja Utwórz napis zasobów oczekuje sta³ej napisowej w pojedyñczym pliku. Wybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Nieprawid³owy identyfikator pascala"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Nazwa \"%s\" nie jest prawid?owym identyfikatorem pascala."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr ""
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "B³êdny nazwa pliku projektu."
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s nale¿y ju¿ do projektu."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s jest b³êdn¹ nazw¹ projektu.%sProszê wybraæ inn¹ (np. project1.lpi)"
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr ""
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr ""
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Polecenia u¿ytkownika"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Polecenia projektanta"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr ""
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr ""
#: lazarusidestrconsts.liskmaddbreakpoint
msgid "Add break point"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr ""
#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr ""
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr ""
#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr ""
#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr ""
#: lazarusidestrconsts.liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr ""
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr ""
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr ""
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr ""
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr ""
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr ""
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr ""
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts.liskmeditoroptions
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr ""
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr ""
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr ""
#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr ""
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr ""
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr ""
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr ""
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr ""
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr ""
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr ""
#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr ""
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr ""
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr ""
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr ""
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr ""
#: lazarusidestrconsts.liskmremovebreakpoint
msgid "Remove break point"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr ""
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr ""
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr ""
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr ""
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr ""
#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr ""
#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr ""
#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr ""
#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr ""
#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr ""
#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr ""
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr ""
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr ""
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr ""
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr ""
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr ""
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Linia poleceñ uruchamianego programu"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Katalog Lazarusa"
#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr ""
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr ""
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr ""
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr ""
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr ""
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [options] <project-filename>"
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr ""
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr ""
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr ""
#: lazarusidestrconsts.lislazarusversionstring
msgid "%s beta"
msgstr ""
#: lazarusidestrconsts.lislazbuildaboaction
msgid "Action"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr ""
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Buduj CodeTools"
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Buduj IDE"
#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Buduj JITForm"
#: lazarusidestrconsts.lislazbuildbuildoptions
msgid "Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Buduj SynEdit"
#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Anuluj"
#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "CzyϾ wszystko"
#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "CzyϾ i buduj"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "B³¹d podczas zapisu do pliku"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""
#: lazarusidestrconsts.lislazbuildlclinterface
msgid "LCL interface"
msgstr "Interfejs LCL"
#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Brak"
#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opcje:"
#: lazarusidestrconsts.lislazbuildqboapplcltarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildother
msgctxt "lazarusidestrconsts.lislazbuildqbobuildother"
msgid "Other"
msgstr "Inne"
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts.lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr ""
#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Docelowy OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""
#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr ""
#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "brakuje œcie¿ki modu³u LCL"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Typ widgetu LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr ""
#: lazarusidestrconsts.lisleft
msgid "Left"
msgstr "W lewo"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr ""
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr ""
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr ""
#: lazarusidestrconsts.lislegaltrademarks
msgid "Legal Trademarks:"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr ""
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "plik LFM"
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""
#: lazarusidestrconsts.lislfmfilenotfound
msgid "LFM file not found"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr ""
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr ""
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "WartoϾ"
#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr ""
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "WprowadŸ dane"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "WprowadŸ pwarametry uruchomieniowe"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr ""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr ""
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Utwórz plik wykonywalny"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr ""
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Utwórz ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Dodaj do sekcji"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s ju¿ istnieje.%sWybierz inn¹ nazw¹.%sU¿yj Ignoruj aby dodaæ j¹ pomimo tego."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opcje konwersji"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identyfikator u¿ytkownika"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identyfikator"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "D³ugoœæ identyfikatora:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Przedrostek identyfikatora:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Wstaw alfabetycznie"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Wstaw z uwzglêdnieniem kontekstu"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "B³êdna sekcja Resourcestring"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring ju¿ istnieje"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sekcja Resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Podgl¹d Ÿród³a"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Sta³a napisowa w Ÿródle"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Sta³e napisowe o tej samej wartoœci:"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts.lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Ustawienia odpluskwiacza ..."
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Przerwij budowanie"
#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr ""
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr ""
#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Dodaj aktywny modu³ do pakietu"
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Dodaj punkt skoku do historii"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Dodaj plik do projektu"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr ""
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""
#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Buduj"
#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Buduj wszystko"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Zbuduj plik"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Buduj Lazarusa"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "SprawdŸ plik formularz w edytorze"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "CzyϾ katalogi ..."
#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Zamknij"
#: lazarusidestrconsts.lismenucloseall
msgid "Close all editor files"
msgstr "Zamknij wszystkie pliki w edytorze"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr ""
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Edytor definicji CodeTools ..."
#: lazarusidestrconsts.lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr " ..."
#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr ""
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Oznacz jako komentarz"
#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Opcje kompilatora ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Uzupe³nij kod"
#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfiguruj dodatkowe komponenty ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr ""
#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr " ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr " ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr " ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Importuj modu³ Delphi ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "Importuj formularz Delphi ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr ""
#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopiuj"
#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""
#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr ""
#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Wytnij"
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Okno odpluskwiacza"
#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Edycja"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr " ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr ""
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr " ..."
#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Anuluj"
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Utwórz podmenu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Skasuj z szablonu"
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Skasuj element"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Wstaw z szablonu"
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Wstaw nowy element (poni¿ej)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Wstaw nowy element (powy¿ej)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Edytor Menu"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr ""
#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "[?] Nowy opis szablonu..."
#: lazarusidestrconsts.lismenueditoroptions
msgid "Editor options ..."
msgstr "Ustawienia edytora ..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Zapisz jako szablon ..."
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Wybierz menu:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Wybierz szablon:"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Podgl¹d szablonu"
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Otocz zaznaczenie ..."
#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Œ&rodowisko"
#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Wyodrêbnij procedurê ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Plik"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Wyszukaj..."
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "ZnajdŸ przeciwny koniec bloku"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "ZnajdŸ pocz¹tek bloku"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "ZnajdŸ deklaracjê przy kursorze"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr " ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "ZnajdŸ w pl&ikach ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "ZnajdŸ &nastêpny"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "ZnajdŸ poprze&dni"
#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr ""
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "IdŸ do dyrektywy include"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "IdŸ do wiersza ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "ZnajdŸ b³êdne IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "ZnajdŸ niedomkniêty blok"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "Pomo&c"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr ""
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Wyszukiwanie przyrostowe"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Zwiêksz wciêcie zaznaczenia"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Pozycja dziennika zmian"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Wstaw z tablicy znaków..."
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "S³owo kluczowe CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Bie¿¹ca data i czas"
#: lazarusidestrconsts.lismenuinsertgeneral
msgid "General"
msgstr "Ogólne"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Informacja o licencji GPL"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Informacja o licencji LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Wstaw tekst"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Nazwa u¿ytkownika"
#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr ""
#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Przeskocz do ty³u"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Przeskocz do przodu"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr ""
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr ""
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr ""
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Zaznaczenie ma³ymi literami"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Utwórz napis w zasobach ..."
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nowy formularz"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nowy ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr ""
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nowy projekt ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nowy projekt z pliku ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nowy modu³"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr ""
#: lazarusidestrconsts.lismenuopen
msgid "Open ..."
msgstr "Otwórz ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Otwórz plik przy kursorze"
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Otwórz za³adowany pakiet ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr ""
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr ""
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Otwórz projekt ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open Recent ..."
msgstr "Otwórz poprzedni ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Otwórz poprzedni pakiet ..."
#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Otwórz poprzedni projekt ..."
#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr ""
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Lista pakietów ..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr ""
#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Wklej"
#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Wstrzymaj"
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "P&rojekt"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor projektu"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opcje projektu ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Uruchom"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikuj projekt ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr ""
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Szybkie sprawdzanie sk³adni"
#: lazarusidestrconsts.lismenuquit
msgid "Quit"
msgstr "Zakoñcz"
#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Przywróæ"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Usuñ z projektu ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr " ..."
#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Zast¹p..."
#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Skanuj ponownie katalog Ÿróde³ FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Zresetuj odpluskwiacz"
#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr ""
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Cofnij"
#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "&Uruchom"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Uruchom plik"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Parametry uruchamiania"
#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "DojdŸ do kursora"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "Save"
msgstr "Zapisz"
#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Zapisz wszystkie"
#: lazarusidestrconsts.lismenusaveas
msgid "Save As ..."
msgstr "Zapisz jako ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Zapisz projekt"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Zapisz projekt jako ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Szukaj"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Zaznacz"
#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Zaznacz wszystko"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Zaznacz blok"
#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Zaznacz wiersz"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Zaznacz akapit"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Zaznacz do nawiasu"
#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr ""
#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Posortuj zaznaczenie ..."
#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "WejdŸ do"
#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "PrzejdŸ przez"
#: lazarusidestrconsts.lismenustop
msgid "Stop"
msgstr "Zatrzymaj"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulacje->odstêpy w zazn."
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Informacja"
#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Zamknij"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "ZawartoϾ"
#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopiuj"
#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Wytnij"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Standardowe menu Edycja"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Standardowe menu PLIK"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Standardowe menu Pomoc"
#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Zmieñ"
#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "WyjdŸ"
#: lazarusidestrconsts.lismenutemplatefile
msgid "File"
msgstr "Plik"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Wyszukaj..."
#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr ""
#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr ""
#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Nowy"
#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Otwórz ..."
#: lazarusidestrconsts.lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Otwórz poprzedni"
#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Wklej"
#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Przywróæ"
#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Zapisz"
#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Zapisz jako..."
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"
#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr ""
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Narzêdzia"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Usuñ oznaczenie komentarza"
#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Cofnij"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Zmniêksz wciêcie zaznaczenia"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Zaznaczenie wielkimi literami"
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Widok"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr ""
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Pu³apki"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Stos wywo³añ"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Przegl¹darka Ÿróde³"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr ""
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponent"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Wyjœcie odpluskwiacza"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Lista formularzy"
#: lazarusidestrconsts.lismenuviewidespeedbuttons
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "View IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Poka¿ historê skoków ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Zmienne lokalne"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Komunikaty"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspektor obiektów"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Wyniki wyszukiwania"
#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Edytor Ÿróde³"
#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Lista \"Do zrobienia\""
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Prze³¹cz modu³/formularz"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Zale¿noœci modu³ów"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "View Unit Information"
msgstr ""
#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Lista modu³ów"
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Czujki"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts.lismore
msgid "More"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr ""
#: lazarusidestrconsts.lismvdocking
msgid "Docking"
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr ""
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr ""
#: lazarusidestrconsts.lisnew
msgid "new"
msgstr ""
#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr ""
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr ""
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Utwórz nowy program."
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Utwórz nowy plik edytora.%sWybierz typ."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Utwórz nowy pusty plik tekstowy."
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Utwórz now¹ aplikacjê graficzn¹.%sPlik programu jest utrzymywany przez Lazarusa."
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Utwórz nowy modu³ pascala."
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Utwórz nowy program.%sPlik programu jest utrzymywany przez Lazarusa."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Utwórz nowy projekt.%sWybierz typ."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Utwórz standardowy pakiet.%sPakiet jest zbiorem modu³ów i komponentów."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Utwórz nowy modu³ z modu³em danych."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame"
msgstr ""
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Utwórz nowy modu³ z formularzem LCL."
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nie wybrano elementu"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Najpierw wybierz element."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""
#: lazarusidestrconsts.lisnewproject
msgid "%s - (new project)"
msgstr "%s - (nowy projekt)"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr ""
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr ""
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "noname"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr ""
#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nie znalaz³em sekcji ResourceString."
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nie znalaz³em sta³ej napisowej"
#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr ""
#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "UWAGA: Nie mog³em utworzyæ szablonu define dla Ÿróde³ Free Pascala"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "UWAGA: Nie mog³em utworzyæ szablonu define dla Ÿróde³ Lazarusa"
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nie teraz"
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr ""
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr ""
#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr ""
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr ""
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr ""
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "auto zainstalowany dynamicznie"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "auto zainstalowany statycznie"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Opis: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sOpis: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Nazwa pliku: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "zainstalowany dynamicznie"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "zainstalowany statycznie"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "brakuj¹cy"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr ""
#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Brak wybranego pakietu"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Otwórz za³adowany pakiet"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nazwa pakietu"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "[wybierz pakiet]"
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Wybierz pakiet który chcesz otworzyæ"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr ""
#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Stan"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTen pakiet jest zainstalowany, ale nie znalaz³em jego pliku lpk"
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sTen pakiet zosta³ utworzony automatycznie"
#: lazarusidestrconsts.lisok
msgid "&Ok"
msgstr ""
#: lazarusidestrconsts.lisokbtn
msgctxt "lazarusidestrconsts.lisokbtn"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lisold
msgid "old"
msgstr ""
#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr ""
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr ""
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr ""
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr ""
#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Otwórz plik"
#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr ""
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Chcesz otworzyæ pakiet?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr ""
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Chcesz otworzyæ projekt?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr ""
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr ""
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Otwórz projekt"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr ""
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr ""
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr ""
#: lazarusidestrconsts.lisoriginalfilename
msgid "Original File Name:"
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Zast¹piæ plik?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr ""
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr ""
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""
#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr ""
#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr ""
#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr ""
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Przegl¹daj"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Przesuñ œcie¿kê w dó³"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Przesuñ œcie¿kê w górê"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Szablony œcie¿ek"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Œcie¿ki poszukiwañ"
#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Wybierz katalog"
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Dodaj element"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Zastosuj zmiany"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Wywo³aj procedurê %sRegister%s bie¿¹cego modu³u"
#: lazarusidestrconsts.lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr ""
#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Kompiluj"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Chcesz kompilowaæ wszystko?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompiluj pakiet"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opcje kompilatora dla pakietu %s"
#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Opcje kompilatora"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Zmieñ ogólne opcje"
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Zmieñ opcje aby kompilowaæ pakiet"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "W³aœciwoœci plku"
#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Opcje ogólne"
#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Zainstaluj"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Zainstaluj pakiet w IDE"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "B³êdny maksymalny numer wersji"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "B³êdny minimalny numer wersji"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maksymalny nr wersji:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimalny nr wersji:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Zmieniony: %s"
#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Wiêcej ..."
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Przesuñ zale¿noœæ w dó³"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Przesuñ zale¿noœæ w górê"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pakiet %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Pakiet %s%s%s zosta³ zmieniony.%sChcesz go zapisaæ?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "pakiet %s nie jest zapisany"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Zak³adka: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Powtórnie dodaj zale¿noœæ"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Dodaj powtórnie plik"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Tylko do odczytu: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Przekompiluj wszystkie wymagane"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Przekompiluj po wyczyszczeniu"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Czy prrzekompilowaæ ten i wszystkie wymagane pakiety?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Zarejestrowane wtyczki"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Zarejestruj modu³"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Usuñ zale¿noœæ"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Chcesz usun¹æ zale¿noœæ?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "chcesz usun¹æ zale¿noœæ %s%s%s%sz pakietu %s%s%s?"
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Usuniête pliki (te pozycje nie zostan¹ zapisane do pliku lpk)"
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Usuniête wymagania (te pozycje nie zostan¹ zapisane do pliku lpk)"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Usuñ plik"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Chcesz usun¹æ plik?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Chcesz usun¹æ plik %s%s%s%sz pakietu %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Usuñ wybrany element"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Wymagane pakiety"
#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Chcesz zapisaæ zmiany?"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Zapisz pakiet"
#: lazarusidestrconsts.lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr ""
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maksymalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przyk³ad poprawnego: 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przyk³ad poprawnego: 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Odinstaluj"
#: lazarusidestrconsts.lispckeditviewpackgesource
msgid "View Package Source"
msgstr ""
#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Automatycznie utworzony"
#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Zainstalowany"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Zainstaluj przy nastêpnym uruchomieniu"
#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr ""
#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Za³adowane pakiety:"
#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Nie znalaz³em pakietu %s"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStan: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Odinstaluj przy nastêpnym uruchomieniu"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "dodaj opcje do zale¿nych pakietów i projektów"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Dodaj œcie¿ki do zale¿nych pakietów/projektów"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Autor:"
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Automatycznie zwiêksz numer wersji przy budowaniu"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatycznie przebuduj gdy trzeba"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatycznie przebuduj przy Przebuduj wszystkie"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Dodatkowe"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Opis"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Projektowy i uruchomieniowy"
#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Tylko projektowy"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integracja z IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Do³¹cz"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Nieprawid³owy typ pakietu"
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Biblioteka"
#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Licencja:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Major"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Rêczna kompilacja (nigdy automatyczna)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minor"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Obiekt"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opcje pakietu"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Typ pakietu"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Release"
#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Tylko uruchomieniowy"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Pakiet %s%s%s ma znacznik auto instalacji.%sTo oznacza, ¿e bêdzie ona automatycznie instalowany przez IDE. Instalowane pakiety%smusz¹ byæ pakietami projektowymi."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Odœwie¿/przebuduj"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "U¿ycie"
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr ""
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr ""
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr ""
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr ""
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr ""
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr ""
#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr ""
#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr ""
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr ""
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispeviewtodolist
msgid "View ToDo list"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "dodatek Œcie¿ka<6B>ród³owaKompilatora"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Katalog wyjœciowy"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Znacznik katalogu Ÿróde³ pakietu"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Œcie¿ka modu³u"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Czy naprawdê chcesz anulowaæ wszystkie zmiany do pakietu %s ponownie wczytaæ go z pliku?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nowy modu³u jest poza œcie¿k¹ do modu³ów"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikuj pakiet..."
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Chcesz przywróciæ pakiet?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Plik %s%s%s%sis jest poza œcie¿k¹ do modu³ów .%s%sCzy dodaæ %s%s%s do œcie¿ki do modu³ów?"
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Pomoc sieciowa jeszcze nie dzia³a"
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Klikniêcie prawym przyciskiem na drzewie pozycji wyœwietli menu podrêczne z wszystkimi dostêpnymi funkcjami."
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Wiêcej funkcji jest w menu podrêcznym"
#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Binarny"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Plik do³¹czany (include)"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - formularz Lazarusa jako tekst"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - zasoby Lazarusa"
#: lazarusidestrconsts.lispkgfiletypetext
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Modu³"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Wirtualny modu³"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Znaleziono nmodu³y o niejednoznacznej nazwie"
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Nie znalaz³em wymaganego pakietu. Spójrz na listê pakietów."
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatycznie zainstalowane pakiety"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sPakiety s¹ powi¹zane, tzn. jeden z nich jest u¿ywany przez drugi, ablo obydwa s¹ u¿ywane przez inny pakiet."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Zerwane zale¿noœæ"
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Zale¿noœci pakietów s¹ zapêtlone"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "B³¹d podczas usuwania"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Chcesz usun¹æ stary plik pakietu?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Chcesz usun¹æ stary plik pakietu %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Zale¿noœæ bez w³aœciciela: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "B³¹d odczytu pliku"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "B³¹d przy odczycie pakietu"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "B³¹d podczas zapisu do pliku"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "B³¹d przy zapisywaniu pakietu"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Plik nale¿y do pakietu"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Plik nale¿y do projektu"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nazwa pliku ró¿ni siê od nazwy pakietu"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Plik jest u¿ywany przez inny pakiet"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Plik o tej nazwie jest ju¿ u¿ywany w projekcie"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Nie znalaz³em pliku %s%s%s."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Plik nie zapisany"
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr ""
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr ""
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "B³êdne rozszerzenie pliku"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Nieprawid³owe rozszerzenie nazwy pakietu"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "B³êdna nazwa pakietu"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nieprawid³owa nazwa pakietu"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""
#: lazarusidestrconsts.lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Za³adowanie pakietu %s spowoduje zast¹pienie pakietu %s%sz pliku %s.%sPoprzedni pakiet by³ zmieniany.%s%sZapisaæ poprzedni pakiet %s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nowy Pakiet"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pakiet: %s"
#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Pakiet %s%s%s zosta³ zmieniny. Chcia³byœ go zapisaæ?"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Pakiet jest w konflikcie"
#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Pakiet %s%s%s nie ma prawid³owego katalogu wyjœciowego:%s%s%s%s"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Paskiet nie jest typu projektowego"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pakiet jest wymagany"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "g³ówny plik Ÿród³owy pakietu"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Pakiet o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pakiety musz¹ mieæ rozszerzenie .lpk"
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Zapisz plik przed dodaniem go do pakietu."
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Czy przebudowaæ Lazarusa?"
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Chcesz zmieniæ nazwê pliku w pakiecie?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Chcesz nadpisaæ istniej¹cy plik %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Nadpisz plik"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Chcesz zapisaæ pakiet?"
#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Zapisz pakiet %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Czy litery w nazwie pliku maj¹ byæ zmienione na ma³e: %s%s%s%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "plik konfiguracji statycznych pakietów"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Plik kompilatora dla pakietu %s nie jest wykonywalny:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Plik %s%s%s%sis ju¿ nale¿y do pakietu %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Plik %s%s%s nie jest pakietem Lazarusa."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Nazwa pliku %s%s%s nie odpowiada nazwie pakietu %s%s%s w tym pliku.%sChcesz zmieniæ nazwê pakietu na %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Plik o nazwie %s%s%s jest ju¿ czêœci¹ bie¿¹cego projektu.%sProjekt i pakiety nie powinny wspó³dzieliæ plików."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Plik %s%s%s jest u¿ywany przez%spakiet %s%s%s%sw pliku %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Nazwa pliku pakietu %s%s%s w%s%s%s%s nie jest prawid³ow¹ nazw¹ pakietu Lazarusa."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Pakiet %s jest tylko pakietem uruchomieniowym.%sTego typu pakiety nie mog¹ byæ instalowane w IDE"
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Pakiet %s%s%s zosta zaznaczony do instalacji, ale nie mo¿na go odnaleŸæ.%sCzy usun¹æ zale¿noœæ z listy pakietów do instalacji?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Pakiet %s Jest wymagany przez %s, który zosta³ zaznaczony do instalacji.%sSpójrz na listê pakietów."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Nazwa pakietu %s%s%s jest nieprawid³owa%sProszê wybraæ inn¹ nazwê (np. package1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Nazwa pakietu %s%s%s z%spliku %s%s%s jest nieprawid³owa."
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Pakiet %s jest w³aœcicielem%s%s%s%s.%sCzy chcesz zmieniæ t¹ nazwê pliku tak¿e w pakiecie?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Pakiet %s%s%s zosta³ zaznaczony.%sAktualnie Lazarus obs³uguje tylko statyczne ³¹czenie pakietów. Pe³na instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudowaæ Lazarusa?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Pakiet %s%s%s zosta³ zaznaczony do instalacji.%sAktualnie Lazarus obs³uguje tylko statyczne ³¹czenie pakietów. Pe³na instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudowaæ Lazarusa?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt wymaga pakkietu,%s%s%s.%sktóry nie zosta³ znaleziony. Spójrz na Projekt->Inspektor projektu. "
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Istniej¹ dwa modu³y z t¹ sam¹ nazw¹:%s%s1 - %s%s%s w %s%s2 oraz %s%s%s w %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Wyst¹pi³o zapêtlenie zale¿noœci w wymaganych pakietach. Spójrz na listê pakietów."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Istnieje modu³ w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Istnieje modu³ w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s%s w %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Istnieje ju¿ inny pakiet o nazwie %s%s%s.%sKonfklikt w: %s%s%s%sPlik: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Jest ju¿ pakiet %s%s%s za³adowany%sz pliku %s%s%s.%sSpójrz na Komponenty -> Lista pakietów.%sNadpisanie jest niemo¿liwe."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Znalaz³em wœród wymaganych pakietów niezapisany pakiet. Spójrz na listê pakietów."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Istnieje modu³ o nazwie takiej samej jak pakiet:%s%s1. %s%s%s w %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nie mo¿na utworzyæ katalogu"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Nie mo¿na utworzyæ kaalogu wyjœciowego %s%s%s%s dla pakietu %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Nie mo¿na utworzyæ katalogu ze Ÿród³ami %s%s%s%sdla pakietu %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Nie mo¿na utworzyæ katalogu docelowego dla Lazarusa:%s%s%s%s.%sTen katalog jest wymagany przez nowe zmienione IDE z dodatkowymi pakietami."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Nie mo¿na usun¹æ pliku %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nie mo¿na usun¹æ pliku"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Nie mo¿na usun¹æ starego pliku statusu %s%s%s%spakietu %s"
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr ""
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nie mo¿na odczytaæ pliku statusu %s%s%s%spakietu %s.%sB³¹d: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Nie mo¿na zapisaæ pakietu %s%s%s%sdo pliku %s%s%s.%sB³¹d: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nie mo¿na zapisaæ pliku statusu %s%s%s%spakietu %s.%sB³¹d: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Chcesz odinstalowaæ pakiet?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Chcesz odinstalowaæ pakiet %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Niezapisany pakiet"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr ""
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Uwaga: Plik %s%s%s%snale¿y do bie¿¹cego projektu."
#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr ""
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Nie mo¿na rejestrowaæ komponentów bez modu³u"
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr ""
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Klasa komponentu %s%s%s ju¿ zosta³a zdefiniowana"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNazwa pliku: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Nieprawid³owa klasa komponentu"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "B³êdna nazwa modu³u: %s"
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Nie znalaz³em pliku pakietu"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "procedura rejestracji jest pusta"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RejestrujModu³ by³o wzywane, ale ¿aden pakiet nie jest rejestrowany."
#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "B³¹d rejestracji"
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - komponent edycyjny u¿ywany przez Lazarusa. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL (Biblioteka Komponentów FreePascala) dostarcza bazowych klas dla object pascala."
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL (Biblioteka Komponentów Lazarusa) zawiera wszystkie bazowe komponenty do tworzenia formularzy."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr ""
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "To jest domyœlny pakiet, u¿ywany tylko dla komponentów które nie maj¹ pakietu. Te komponenty s¹ ju¿ przedawnione."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNazwa modu³u: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Nie znalaz³em modu³u: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Modu³ %s%s%s zosta³ usuniêty z pakietu"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgid "Global"
msgstr ""
#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts.lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr "SprawdŸ nazwê pliku kompilatora"
#: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "SprawdŸ katalog Ÿróde³ FPC"
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Proszê otworzyæ modu³ przed uruchomieniem."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr ""
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr ""
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr ""
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr ""
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr ""
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr ""
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ""
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ""
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""
#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Drukuj"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr ""
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""
#: lazarusidestrconsts.lisprocedure
msgid "Procedure"
msgstr ""
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr ""
#: lazarusidestrconsts.lisproductname
msgid "Product Name:"
msgstr ""
#: lazarusidestrconsts.lisproductversion
msgid "Product Version:"
msgstr ""
#: lazarusidestrconsts.lisprogram
msgid "Program"
msgstr ""
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Wykry³em program"
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Plik Ÿród³owy powinien mieæ odpowiednie rozszerzenie, jak .pas, .pp lub .lpr"
#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Dodaj plik do projektu:"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Zale¿noœæ ju¿ istnieje"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr ""
#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr ""
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "B³êdna wersja Min-Max"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "B³êdna nazwa pakietu"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "B³êdna nazwa modu³u pascala"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Nieodpowiednia wersja"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maksymalny numer wersji (opcjonalny):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimalny numer wersji (opcjonalny):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nowy wymóg"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nazwa pakietu:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Nie znalaz³em pakiet"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Nie znalaz³em zale¿noœci %s%s%s.%sWybierz istniej¹cy pakiet."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maksymalny numer wersji %s%s%s jest nieprawid³owy.%sU¿yj formatu: major.minor.release.build%sNp.: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maksymalny numer wersji jest mniejszy ni¿ minimalny."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimalny numer wersji %s%s%s jest nieprawid³owy.%sU¿yj formatu: major.minor.release.build%sNp.: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Pakiet %s%s%s jest nieprawid³owy.%sWybierz istniej¹cy pakiet."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Projekt ma ju¿ zale¿noœæ od pakietu %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Modu³ o nazwie %s%s%s ju¿ istnieje w projekcie%sw pliku: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Nazwa modu³u %s%s%s ju¿ istnieje w zaznaczeniu%sw pliku: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa modu³u %s%s%s nie jest prawid³owym identyfikatorem pascala."
#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Modu³ o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt zmieniony"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Katalog projektu"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nazwa pliku projektu"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Œcie¿ka do³¹czanych plików projektu"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Wykry³em plik z informacj¹ o projekcie"
#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr ""
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr ""
#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Œcie¿ka Ÿróde³ projektu"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Projekt %s%s%s poprawnie zbudowany. :)"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Œcie¿ka do modu³ów projektu"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "PotwierdŸ usuniêcie zale¿noœci"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Chcesz usun¹æ zale¿noœæ od %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspektor projektu- %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Usuniête wymagane pakiety"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Chcesz usun¹æ plik %s z projektu?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "B³¹d"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Unable to change the auto create form list in the program source.%sPlease fix errors first."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Spytaj o wartoϾ"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr ""
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr ""
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr ""
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Publikuj katalog projektu"
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "B³êdny filtr Exclude"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "B³êdny filtr Include"
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Modu³ pascala powinien mieæ rozszerzenie .pp lub .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr ""
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr ""
#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr ""
#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr ""
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "B³¹d odczytu"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""
#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr ""
#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "WartoϾ"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr ""
#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr ""
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Usuñ wszystkie nieprawid³owe w³aœciwoœci"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr ""
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Chcesz zmieniæ nazwê pliku?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Nie mo¿na zmieniæ nazwy pliku"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr ""
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts.lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "To jest automatycznie wygenerowany plik zasobów lazarusa"
#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Nie mo¿na za³adowaæ zasobów"
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Nie mo¿na zapisaæ zasobów"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Przywrócenie nie uda³o siê"
#: lazarusidestrconsts.lisright
msgid "Right"
msgstr "W prawo"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr ""
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr ""
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Plik nie jest wykonywalny"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Aplikacja hosta %s%s%s nie jest wykonywalna."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "IdŸ-do nie zadzia³a³o"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr ""
#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr ""
#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "Zapisz wszystkie zmienione pliki"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr ""
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr ""
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Chcesz zapisaæ zmiany w projekcie %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "zapisz bie¿¹cy plik w edytorze"
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr ""
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""
#: lazarusidestrconsts.lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Zapisz projekt %s (*.lpi)"
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr ""
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Zapisz"
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr ""
#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Zobacz komunikaty."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr ""
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Wybierz formularze Delphi (*.dfm)"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Zaznaczenie przekracza sta³¹ napisow¹."
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Narzêdzie zaznaczania"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr ""
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""
#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr ""
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr ""
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr ""
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr ""
#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Przykro mi, ten typ jeszcze nie jest obs³ugiwany"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Rosn¹co"
#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Anuluj"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Malej¹co"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domena"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignoruj odstêpy"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Wiersza"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opcje"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Akapity"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Podgl¹d"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "ZatwierdŸ"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Posortuj zaznaczenie"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "WielkoϾ liter"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "<22>ród³o zmienione"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "<22>ród³o zak³adki %s%s%s zosta³o zmienione. Chcesz je zapisaæ?"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr ""
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr ""
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr ""
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr ""
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr ""
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zatrzymaæ odpluskwianie?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr ""
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zatrzymaæ odpluskwianie?"
#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr ""
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "B³¹d strumienia"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.lisstyle
msgid "Style"
msgstr ""
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr ""
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr ""
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr ""
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "B³êdna nazwa zmiennej"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s nie jest prawid³owym identyfikatorem."
#: lazarusidestrconsts.lissvuook
msgctxt "lazarusidestrconsts.lissvuook"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Przedefiniuj zmienn¹ systemow¹"
#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Docelowy procesor"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Docelowa nazwa programu"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Docelowy system operacyjny"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr ""
#: lazarusidestrconsts.listddinserttodo
msgid "Insert ToDo"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Katalog testowy"
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Polecenie po %s%s%s nie jest wykonywalne."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Obecna œcie¿ka do modu³ów dla pliku %s%s%s%s to%s%s%s%s.%s%sBrakuje œcie¿ki do modu³ów LCL %s%s%s.%s%sWskazówka dla pocz¹tkuj¹cych:%sUtwórz aplikacjê Lazarusa i umieœæ plik w katalogu projektu."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Nie ma katalogu docelowego%s%s%s%s."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr ""
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Plik %s%s%s"
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr ""
#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr ""
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Nie znalaz³em pliku %s%s%s%s.%sCzy chcesz zlokalizowaæ go samemu ?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Nie znalaz³em pliku %s%s%s%s.%sWciœnij Ignoruj aby dalej ³adowaæ projekt,%sPorzuæ zatrzyma ³adowanie."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr ""
#: lazarusidestrconsts.listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr ""
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Plik LFM (formularz Lazarusa) zawiera nieprawid³owe w³¹œciwoœci, np. mo¿e zawieraæ pewne w³aœciwoœci lub klasy, których nie ma obecnie w LCL. Zwyczajowo naprawia siê to przezusuniêcie tych w³aœciwoœci z LFM i rêczne poprawienie kodu w pascalu."
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa %s%s%s nie jest prawid³owym identyfikatorem w pascalu."
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Plik z informacj¹ o projekcie %s%s%s%s jest taki sam jak g³ówne Ÿród³o projektu!"
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Projekt musi byæ zapisany przed budowaniem%sJeœli zmienisz \"katalog testowy\" w ustawieniach œrodowiska,%sbêdziesz móg³ budowaæ projekty zaraz po utworzeniu.%sChcesz zapisaæ projekt?"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "W katalogu s¹ inne pliki o tej nazwie,%sktóre ró¿ni¹ siê tylko wielkoœci¹ liter:%s%s%sChcesz je usun¹æ?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Istnieje plik z tak¹ sam¹ nazw¹ i podobnym rozszerzeniem na dysku%sPlik: %s%sNiejednoznaczny plik: %s%s%sUsun¹æ niejednoznaczny plik?"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Ju¿ jest formularz o nazwie %s%s%s"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Modu³ o nazwie %s%s%s jest ju¿ w projekcie.%sWybierz inn¹ nazwê."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Modu³ %s%s%s ju¿ istnieje.%sIgnoruj wymusi zmianê nazwy,%sAnuluj anuluje zapisywanie Ÿród³a%sPorzuæ zaœ porzuci ca³¹ operacjê zapisywania.."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "ten komunikat pomocy"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts.listhiswillhappencontinue
msgid "This will happen:%s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkcja: do³¹cz rozgranicznik œcie¿ki"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funkcja: wytnij rozgranicznik œcie¿ki"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkcja: wyodrêbnij rozszerzenie pliku"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkcja: wyodrêbnij nazwê pliku + rozszerzenie"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkcja: wyodrêbnij sam¹ nazwê pliku"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkcja: wyodrêbnij œcie¿kê pliku"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(nieznane makro: %s)"
#: lazarusidestrconsts.listodogoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listodoldescription
msgctxt "lazarusidestrconsts.listodoldescription"
msgid "Description"
msgstr "Opis"
#: lazarusidestrconsts.listodoldone
msgid "Done"
msgstr ""
#: lazarusidestrconsts.listodolfile
msgctxt "lazarusidestrconsts.listodolfile"
msgid "Module"
msgstr ""
#: lazarusidestrconsts.listodolistcaption
msgctxt "lazarusidestrconsts.listodolistcaption"
msgid "ToDo List"
msgstr "Lista \"Do zrobienia\""
#: lazarusidestrconsts.listodolistgotoline
msgid "Goto selected source line"
msgstr "PrzejdŸ do zaznaczonej linii Ÿród³a"
#: lazarusidestrconsts.listodolistoptions
msgid "ToDo options..."
msgstr "Opcje..."
#: lazarusidestrconsts.listodolistprintlist
msgid "Print todo items"
msgstr "Drukuj listê"
#: lazarusidestrconsts.listodolistrefresh
msgid "Refresh todo items"
msgstr "Odœwie¿ zawartoœæ"
#: lazarusidestrconsts.listodolline
msgid "Line"
msgstr "Wiersz"
#: lazarusidestrconsts.listodolowner
msgid "Owner"
msgstr ""
#: lazarusidestrconsts.listodolpriority
msgid "Priority"
msgstr ""
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr ""
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts.listop
msgid "Top"
msgstr ""
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr ""
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr ""
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr ""
#: lazarusidestrconsts.listtodolcategory
msgctxt "lazarusidestrconsts.listtodolcategory"
msgid "Category"
msgstr ""
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr ""
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "B³¹d w wyra¿eniu regularnym"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr ""
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line :"
msgstr "IdŸ do wiersza :"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nie znalaz³em"
#: lazarusidestrconsts.lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/Tylko do odczytu"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Zast¹piæ to wyst¹pienie %s%s%s%s przez %s%s%s%s"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Szukanie: %s"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Nie znalaz³em wyra¿enia '%s' !"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr ""
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bajtów"
#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "CzyϾ"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Do³¹czane przez:"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "w projekcie:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nazwa:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nie"
#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Œcie¿ki (tylko do odczytu)"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr ""
#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "<22>ród³o"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Modu³"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "tak"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Poka¿ wartoœci CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nie mo¿na dodaæ komentarza nag³ówka zasobu do pliku zasobów %s%s%s%s.%sPrawdopodobnie b³¹d sk³adniowy."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nie mo¿na dodaæ zasobu T%s:FORMDATA do pliku z zasobami %s%s%s%s.%sPrawdopodobnie b³¹d sk³adni."
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Nie mo¿na dodaæ %s do projektu, poniewa¿ zawiera on ju¿ modu³ o tej nazwie."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Nie mo¿na utworzyæ kopii zapasowej pliku %s%s%s jako %s%s%s!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nie mo¿na wyczyœciæ katalogu docelowego"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Nie mo¿na wyczyœciæ %s%s%s.%sSprawdŸ uprawnienia."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Nie mo¿na zamieniæ pliku %s%s%s%sB³¹d: %s"
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Nie mo¿na zaimportowaæ formularza lfm do lrs lub zapisaæ pliku lrs."
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Nie mo¿na skonwertowaæ pliku z danymi w formie tekstu z pliku%s%s%s%s%sna strumieñ dwójkowy. (%s)"
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Nie mo¿na skopiowaæ pliku %s%s%s%sdo %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Nie mo¿na utworzyæ katalogu z kopi¹ zapasow¹ %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Nie mo¿na utworzyæ katalogu %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nie mo¿na utworzyæ pliku"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Nie mo¿na utworzyæ nowej metody. Popraw b³¹d wypisany w oknie komunikatów."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Nie mo¿na usun¹æ niejednoznacznego pliku %s%s%s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Nie znalaz³em pliku %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Nie mo¿na znaleŸæ metody. Popraw b³¹d wypisany w oknie komunikatów."
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Nie mo¿na za³¹dowaæ poprzedniego pliku zasobów.%sPlik zasobów jest pierwszym plikiem do³¹czanym w%s sekcji inicjalizacji.%sNa przyk³ad {$I %s.lrs}.%sPrawdopodobnie b³¹d sk³adniowy."
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nie mo¿na czytaæ pliku"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Nie mo¿na czytaæ pliku %s%s%s!"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Nie mo¿na odczytaæ pliku %s%s%s%sB³¹d: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Nie mo¿na czytaæ pliku %s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Nie mo¿na usun¹æ starego pliku kopii zapasowej %s%s%s!"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Nie uda³o siê zmieniæ nazwy niejednoznacznego pliku %s%s%s%sna %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Nie uda³o siê zmieniæ nazwy pliku %s%s%s na %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nie uda³o siê zmieniæ nazwy formularza w Ÿródle."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nie mo¿na zmieniæ nazwy metody. Popraw b³¹d wypisany w oknie komunikatów."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nie uda³o siê zmieniæ nazwy zmiennej w Ÿródle."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Nie mo¿na zapisaæ pliku %s%s%s"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Nie mo¿na pokazaæ metody. Popraw b³¹d wypisany w oknie komunikatów."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nie mo¿na wys³aæ do strumienia %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nie mo¿na przekszta³ciæ binarnego strumienia komponentu %s:T%s na tekst."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nie mo¿na uaktualniæ polecenia CreateForm w Ÿródle"
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Nie mo¿na pisaæ do pliku %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Nie mo¿na pisaæ do pliku"
#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Nie mo¿na zapisaæ do pliku %s%s%s%sB³¹d: %s"
#: lazarusidestrconsts.lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Nie mo¿na pisaæ do pliku %s%s%s."
#: lazarusidestrconsts.lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Nie mo¿na pisaæ do pliku %s%s%s!"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr ""
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identyfikator modu³u istnieje"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""
#: lazarusidestrconsts.lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Modu³ o tej nazwie jest ju¿ w projekcie"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr ""
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr ""
#: lazarusidestrconsts.lisunitnotfound
msgid "Unit not found"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr ""
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfound2
msgid "Units not found"
msgstr ""
#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""
#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr ""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Wersja"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr ""
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr ""
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr ""
#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr ""
#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Uwaga: znalaz³em niejednoznaczny plik: %s%s%s. Plik Ÿród³owy to: %s%s%s"
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr ""
#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr ""
#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr ""
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr ""
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr ""
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr ""
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr ""
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "S³owo przy kursorze"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "B³¹d zapisu"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr ""
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Nie mo¿esz budowaæ lazarusa w czasie odpluskwiania lub kompilacji programu."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Edytor Ÿróde³"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts.rsadditionalinfo
msgid "Additional info"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "Build:"
msgstr ""
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr ""
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts.rscopyright
msgid "Copyright:"
msgstr ""
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr ""
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Inna pozycja"
#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Domyœlnie"
#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Zadokowany"
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Przywróæ po³o¿enie okna"
#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Przywraca rozmiar okna"
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "U¿yj ustawieñ menad¿era okien"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr ""
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr ""
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatic (or english)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalan"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr ""
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr ""
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "English"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finnish"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "French"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr ""
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr ""
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr ""
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italian"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr ""
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr ""
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr ""
#: lazarusidestrconsts.rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr ""
#: lazarusidestrconsts.rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr ""
#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russian"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr ""
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spanish"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr ""
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr ""
#: lazarusidestrconsts.rsmajorrevision
msgid "Major revision:"
msgstr ""
#: lazarusidestrconsts.rsminorrevision
msgid "Minor revision:"
msgstr ""
#: lazarusidestrconsts.rsok
msgid "ok"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr ""
#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr ""
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr ""
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr ""
#: lazarusidestrconsts.rsversion
msgid "Version:"
msgstr ""
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Klawisz \"%s\" jest ju¿ przypisany do \"%s\"."
#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Menu pomoc"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Sterowanie"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeTools"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Poruszanie kursorem"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Edycja tekstu"
#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Menu œrodowisko"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Menu plik"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Znaczniki"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Menu projekt"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Menu uruchom"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Wyszukiwanie i zastêpowanie"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Wybieranie tekstu"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Zak³adki edytora Ÿróde³"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Menu narzêdzia"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Menu widok"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Polecenie:"
#: lazarusidestrconsts.srkmcommand1
msgid " command1 \""
msgstr " command1 \""
#: lazarusidestrconsts.srkmcommand2
msgid " command2 \""
msgstr " command2 \""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt "
#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr "jest niezgodny z "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr ""
#: lazarusidestrconsts.srkmecaddbreakpoint
msgid "add break point"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Dodaj punkt skoku"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Dokañczenie szablonu kodu"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Zwiêksz wciêcie bloku"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Zmniejsz wciêcie bloku"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "buduj program/projekt"
#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "buduj wszystkie pliki programu/projektu"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr ""
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr ""
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Znak"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Usuñ ca³y tekst"
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""
#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Tryb wyboru kolumn"
#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr ""
#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr ""
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "konfiguruj \"buduj plik\""
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Skopiuj zaznaczenie do schowka"
#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Narzêdzie u¿ytkownika %d"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Wytnij zaznaczenie i umieϾ w schowku"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Usuñ do pocz¹tku wiersza"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Usuñ znak przy kursorze"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Usuñ do koñca wiersza"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Usuñ ostatni znak"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Usuñ do pocz¹tku s³owa"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Usuñ bie¿¹cy wiersz"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Usuñ do koñca s³owa"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Przesuñ kursor na koniec"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Przesuñ kursor na pocz¹tek"
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "General environment options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr ""
#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Wyodrêbnij procedurê"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Zewnêtrzne narzêdzie %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Ustawienia zewnêtrznych narzêdzi"
#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "ZnajdŸ tekst"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "ZnajdŸ drugi koniec bloku"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "ZnajdŸ pocz¹tek bloku"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "ZnajdŸ deklaracjê"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr ""
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "ZnajdŸ w plikach"
#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "ZnajdŸ nastêpne"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "ZnajdŸ poprzednie"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr ""
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "ZnajdŸ definicjê procedury"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "ZnajdŸ metodê-procedurê"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "PrzejdŸ do edytora %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "PrzejdŸ do $include dla wstawionego pliku"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "PrzejdŸ do linii numer..."
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "PrzejdŸ do znacznika %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "IdŸ do XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "ZnajdŸ b³êdnie umieszczone $IFDEF"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Wstaw element ChangeLog'u"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Wstaw z tablicy znaków"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Wstaw s³owo kluczowe CVS: Author"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Wstaw s³owo kluczowe CVS: Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Wstaw s³owo kluczowe CVS: Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Wstaw s³owo kluczowe CVS: ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Wstaw s³owo kluczowe CVS: Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Wstaw s³owo kluczowe CVS: Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Wstaw s³owo kluczowe CVS: Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Wstaw s³owo kluczowe CVS: Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Wstaw bie¿¹c¹ datê i czas"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Wstaw informacjê o licencji GPL"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Wstaw informacjê o licencji LGPL"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zawiñ wiersz i pozostaw kursor"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Tryb wstawiania"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Wstaw bie¿¹c¹ nazwê u¿ytkownika"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr ""
#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr ""
#: lazarusidestrconsts.srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Uaktywnij edytor Ÿród³a"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zawiñ wiersz i przenieœ kursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Przesuñ kursor na koniec wiersza"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Tryb wyboru linii"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Przesuñ kursor na pocz¹tek wiersza"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr ""
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "PrzejdŸ do pasuj¹cego nawiasu"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "PrzejdŸ do nastêpnego edytora"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normalny tryb wyboru"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Otwórz plik przy kursorze"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Tryb nadpisywania"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Przesuñ kursor na dó³ strony"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Przesuñ kursor o 1 stronê"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Przesuñ kursor w lewo o 1 stronê"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Przesuñ kursor w prawo o 1 stronê"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Przesuñ kursor na górê strony"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Przesuñ kursor o stronê wy¿ej"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Wklej tutaj"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "przerwij dzia³anie programu"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "PrzejdŸ do poprzedniego edytora"
#: lazarusidestrconsts.srkmecprocedurelist
msgid "Procedure List ..."
msgstr " ..."
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr ""
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr ""
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr ""
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr ""
#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Zast¹p tekst"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "uruchom program"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr ""
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr ""
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Przewiñ w dó³ o jedn¹ liniê"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Przewiñ w lewo o jeden znak"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Przewiñ w prawo o jeden znak"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Przewiñ w górê o jedn¹ liniê"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Wybierz w dó³"
#: lazarusidestrconsts.srkmecselectall
msgid "Select All"
msgstr ""
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Zamieñ znaki tabulacji na spacje w zaznaczonym tekœcie"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Wybierz do koñca"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Wybierz do pocz¹tku"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Wybierz do XY"
#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "WybWLewo"
#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Wybierz do koñca linii"
#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Wybierz do pocz¹tku linii"
#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Wybierz dó³ strony"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Wybierz stronê w dó³"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Wybierz stronê w lewo"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Wybierz stronê w prawo"
#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Wybierz górê strony"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Wybierz stronê w górê"
#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "WybWPrawo"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Wybierz w górê"
#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Wybierz s³owo po lewej"
#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Wybierz s³owo po prawej"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Ustaw znacznik %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "zatrzymaj program"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Sprawdzenie sk³adni"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Poka¿ pu³apki"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Poka¿ eksploratora kodu"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr ""
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Poka¿ wyjœcie debuggera"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Prze³¹cz pomiêdzy formularzem i kodem"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr ""
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Poka¿ zmienne lokalne"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Poka¿ komunikaty"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Prze³¹cz tryb"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Poka¿ inspektora obiektów"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Poka¿ wyniki wyszukiwania"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Poka¿ edytor Ÿróde³"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Poka¿ czujki"
#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "Nieznane polecenie edytora"
#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "U¿ytkownika najpierw"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr ""
#: lazarusidestrconsts.srkmecviewtodolist
msgid "View todo list"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr ""
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr ""
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Uzupe³nienie s³owa"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Przesuñ kursor o s³owo w lewo"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Przesuñ kursor o s³owo w prawo"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Zmieñ klawisze"
#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr ""
#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr ""
#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Wciœnij klawisz ..."
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Plik jest tylko do odczytu"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Plik \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" nie jest zapisywalny"
#: lazarusidestrconsts.uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "&Dodaj pu³apkê"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Dodaj &czujkê przy kursorze"
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Zak³adka"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Zamknij zak³adkê"
#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Uzupe³nij kod"
#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopiuj"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy filename"
msgstr ""
#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Wytnij"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Odpluskwanie"
#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "W³aœciwoœci edytora"
#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&ZnajdŸ deklaracjê"
#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&IdŸ do zak³adki"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts.ueminserttodo
msgid "Insert Todo"
msgstr ""
#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr ""
#: lazarusidestrconsts.uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Przesuñ zak³adkê w lewo"
#: lazarusidestrconsts.uemmoveeditorleftmost
msgid "Move Editor Leftmost"
msgstr ""
#: lazarusidestrconsts.uemmoveeditorright
msgid "Move Editor Right"
msgstr "Przesuñ zak³adkê w prawo"
#: lazarusidestrconsts.uemmoveeditorrightmost
msgid "Move Editor Rightmost"
msgstr ""
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Zmienione"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Otwórz plik przy kursorze"
#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Wklej"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr ""
#: lazarusidestrconsts.uemreadonly
msgid "Read Only"
msgstr "Tylko do odczytu"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr ""
#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr ""
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&DojdŸ do kursora"
#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Utwórz zak³adkê"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr ""
#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Informacja o module"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""
#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Poka¿ stos wywo³añ"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Jeszcze nie zaimplementowane"
#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Ostrzega³em: Jeszcze nie zaimplementowane"
#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Jeœli mo¿esz nam pomóc zrealizowaæ t¹ funkcje, napisz pod adres lazarus@miraclec.com"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "WST"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "NAD"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Tylko do odczytu"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr ""