lazarus/languages/lazaruside.sk.po

21927 lines
631 KiB
Plaintext

msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
"PO-Revision-Date: 2024-12-17 09:11+0100\n"
"Last-Translator: Slavko <slavino@slavino.sk>\n"
"Language-Team: Slovenský <sk@li.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: Poedit 2.2.3\n"
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
"Language: sk\n"
#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr ""
#: lazarusidestrconsts.cocoamfstbijumpback
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr "Skoč späť"
#: lazarusidestrconsts.cocoamfstbijumpforward
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr "Skoč dopredu"
#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr ""
#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr "Adresa bodu prerušenia %s"
#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr ""
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr "Neznámy bod prerušenia %s"
#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr ""
#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Použiť preddefinovanú schému"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Vložiť"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
#, fuzzy
#| msgid "Set free bookmark"
msgid "Set a free bookmark"
msgstr "Nastav voľnú záložku"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Všeobecné"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Len na čítanie"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Malé písmená, prvé veľké"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "aktívny"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Pridať operátor priradenia (:=)"
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrcustom
#, object-pascal-format
msgid "Custom %d"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Globálne"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Riadok"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlgaddhiattrgroupwrap
msgid "Wrapping"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_custom
msgid "(Custom)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_entrytype
msgid "(entry type)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_extended
msgid "(Extended)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_nbrackets
msgid "(Nested Brackets)"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Zmenený riadok"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrnestedbracket
#, object-pascal-format
msgid "Nested bracket %d"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattroutlinelevelcolor
#, object-pascal-format
msgid "Level %s"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Selected text"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwrapeol
msgid "EOL"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrwrapindent
#, fuzzy
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapindent"
msgid "Indent"
msgstr "Odsadenie"
#: lazarusidestrconsts.dlgaddhiattrwrapsubline
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapsubline"
msgid "Sub-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Pridať nový režim"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Pridať bodkočiarku"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Prispôsobiť horný riadok pre komentár vpredu"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Podľa abecedy"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
#, fuzzy
#| msgid "Always visible cursor"
msgid "Always keep caret in visible area of editor"
msgstr "Kurozr vždy viditeľný"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nejednoznačná akcia súboru:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Upozorniť pri preklade"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr ""
#: lazarusidestrconsts.dlgansicommenttab
msgid "ANSI (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Nastavenia aplikácie"
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Zahrnúť kontrolný kód"
#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr ""
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaticky vytvárané formuláre:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr ""
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Nový formulár pridať k automaticky vytváraným formulárom"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Auto zmazanie súboru"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr ""
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Pri písaní skryť ukazovateľ myši"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Automatické odsadenie"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr ""
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Automaticky odstrániť prázdne metódy"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automaticky na malé písmená"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Automatické uloženie aktívnej pracovnej plochy"
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Dostupné formuláre:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr ""
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Pozadie"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(bez podadresárov)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Rovnaké meno (v podadresári)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Za metódy"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Výber"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Odsadenie bloku"
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(upraviť klávesy)"
#: lazarusidestrconsts.dlgblockindentspaces
msgid "Amount of spaces"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttabs
msgid "Amount of tabs (tab stops)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttabs2spaces
msgid "Amount of spaces (tab stops)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Medzery/Tab ako predch.riadok"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Medzery"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Tabulátory, potom medzery"
#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr ""
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr ""
#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr ""
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr ""
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Secondary carets (multi-caret mode)"
msgstr ""
#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr ""
#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr ""
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Main or primary caret"
msgstr ""
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr ""
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Rozlišovať veľkosť písmen"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Skontrolovať voľby prekladača"
#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Výsledky"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Kontrola prekladača ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Kontrola nastavenia prekladača ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Kontrola dát prekladača ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Preklad prázdneho súboru ..."
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr ""
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Preklad prázdneho súboru"
#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Poradie tried"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Posledný"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "malé písmená"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Ukážka (maximálna dĺžka riadka = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Predpona čítania"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Prípona pre uložené"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "VEĽKÉ PÍSMENÁ"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Predpona premennej"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Predpona zápisu"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Uložiť ako - automaticky premenovať Pascal súbory na malé písmená"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Skontrolovať a automaticky uložiť súbory"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Zvoľte súbor šablón kódu (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Zobraziť zatváracie tlačítka v poznámkovom bloku"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Farebná schéma"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Makrá v štýle C (globálne)"
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Použiť ANSI reťazce"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Štýl Assembleru"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Správy"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Kontroly a tvrdenia"
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Príkazy prekladača"
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Operátory v štýle C (*=, +=, /= a -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Vytvoriť Makefile"
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Ladenie"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Ďalšie cesty debugera (žiadne):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Tvorba kódu"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""
#: lazarusidestrconsts.dlgcogdb
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Generovať ladiace informácie (pomalší preklad / zväčšuje veľkosť .exe)"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Použiť jednotku Heaptrc (kontrola únikov pamäte)"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Súbory include (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Debugger info"
msgstr "Informácie pre ladenie"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Knižnice (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linkovanie"
#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Voľby prekladača môžu byť uložené do XML súboru."
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Nezmenené"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Farby"
#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr ""
#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr ""
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametre príkazového riadka (bez mena aplikácie)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Komentáre a reťazce"
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Preklad a linkovanie"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Správy prekladača"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr ""
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Dokončovanie vlastností"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr ""
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Konfigurácia a cieľ"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Konfiguračné súbory"
#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr ""
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Ďalšie informácie pre ladenie"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Pretečenie"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analýza"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr ""
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Rozsah"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Premiestniteľná"
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Nastaviť voľby prekladača ako východzie"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "Zobraziť voľby"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Smart linkovateľná"
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Ostatné zdrojové kódy (súbory .pp/.pas, použité len IDE, nie prekladačom)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Zásobník"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Odstrániť symboly zo spustiteľného súboru"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Druh ladiacich informácií"
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automaticky"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf 2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf 2 with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf 3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Inicializovať lokálne premenné s preddefinovanými hodnotami"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Štýl jednotky"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Generovať kód pre valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Výrečnosť"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE v štýle C++"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr ""
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kurzor za EOL"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr ""
#: lazarusidestrconsts.dlgcursorskipsselection
#, fuzzy
#| msgid "Cursor skips selection"
msgid "Caret skips selection"
msgstr "Kurzor preskakuje výber"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr ""
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Používateľská prípona (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor ciest"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Typ a cesta debugera"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Predvolený font editora"
#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr ""
#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr ""
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Predvolená hodnota"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Zmazať režim"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Zmazať"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr "Zmazať vybratú pracovnú plochu"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Zmazať šablónu "
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Rady"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr ""
#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Smer"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Vypnúť anti-aliasing"
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr ""
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Späť"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tučné"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Podadresár"
#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Šablóny kódu"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr ""
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Používateľom definovaná prípona"
#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr ""
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Zobraziť"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Súbory editora"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Dokončovanie identifikátora"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Otočiť"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr ""
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Šikmé"
#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr ""
#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr ""
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Voľby editora"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""
#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Rôzne"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Off"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "On"
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tab a odsadenie"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Podčiarknuté"
#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr ""
#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr ""
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Spýtať sa"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Poznámka: Projektové súbory sú všetky súbory v adresári projektu"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Záloha"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Súbory"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Mriežka"
#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr ""
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Jazyk"
#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr ""
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Pomocné čiary"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Rôzne"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Nič"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Ostatné súbory"
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Karty pre projekt"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
#, fuzzy
#| msgid "Extra char spacing"
msgid "Extra character spacing"
msgstr "Dodatočná medzera medzi znakmi"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dodatočná medzera medzi riadkami"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external debug symbols file"
msgstr "Použiť externý súbor so symbolmi ladenia"
#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr ""
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Prípony súborov"
#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr "%s súborov"
#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Všetky súbory"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Delphi formulár"
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Delphi balíček"
#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Delphi projekt"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Delphi jednotka"
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Nastavenia plochy Lazarusu"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Súbor Lazarusu"
#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Formulár Lazarusu"
#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Include súbor Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Iný súbor Lazarusu"
#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Balíček Lazarusu"
#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Projekt Lazarusu"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Zdrojový kód projektu Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Jednotka Lazarusu"
#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr ""
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Súbor Pascalu"
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programy"
#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Súbory XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Nájsť text na kurzore"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedúra"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Záznam"
#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Opakovať"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Jednotka"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr ""
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr ""
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Farba popredia"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Pravidlá vkladania procedúr"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Zachovať poradie procedúr"
#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Spustiteľný súbor prekladača (napr. %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Adresár zdrojových kódov FPC"
#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr ""
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor formulára"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Od začiatku"
#: lazarusidestrconsts.dlgfromcursor
msgid "From c&ursor"
msgstr "Od k&urzora"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Globálne"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Generovať kód pre gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Farba zachytávača"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr ""
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Farba mriežky"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr ""
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Veľkosť mriežky X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Vodorovná veľkosť kroku mriežky"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Veľkosť mriežky Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Zvislá veľkosť kroku mriežky"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Prehliadač kódu"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Debuger"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Prostredie"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Skupinové späť"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Zobraziť pomocné čiary"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr ""
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Farba guttera"
#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr ""
#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr ""
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Polovičný posun stránky"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Veľkosti haldy a zásobníka"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Veľkosť haldy"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr ""
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Výška:"
#: lazarusidestrconsts.dlghideideonrun
#, fuzzy
#| msgid "Hide IDE windows on run"
msgid "Hide IDE windows on Run/Debug"
msgstr "Pri spustení skryť okno IDE"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr ""
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Zvýrazniť"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Font zvýraznenia"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr ""
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr ""
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Zobraziť rady pre nepoužitý parameter \"Sender\""
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Zobraziť rady pre nepoužité jednotky v základnom zdrojovom súbore"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home posúva na najbližší začiatok"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Hosťovská aplikácia"
#: lazarusidestrconsts.dlgiahadentifiercomplentryabstractprocfunc
msgid "Abstract proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrycodetemplate
msgid "Template"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryconst
msgid "Const"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryenum
msgid "Enum"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryfunc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryfunc"
msgid "Function"
msgstr "Funkcia"
#: lazarusidestrconsts.dlgiahadentifiercomplentryident
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryident"
msgid "Identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.dlgiahadentifiercomplentrykeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrykeyword"
msgid "Keyword"
msgstr "Kľúčové slovo"
#: lazarusidestrconsts.dlgiahadentifiercomplentrylabel
msgid "Label"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrylowervisibilityprocfunc
msgid "Lower visibility proc/func"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrynamespace
msgid "Namespace"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentryother
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryother"
msgid "Other"
msgstr "Ostatné"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproc
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryproc"
msgid "Procedure"
msgstr "Procedúra"
#: lazarusidestrconsts.dlgiahadentifiercomplentryproperty
msgid "Property"
msgstr ""
#: lazarusidestrconsts.dlgiahadentifiercomplentrytext
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytext"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlgiahadentifiercomplentrytype
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.dlgiahadentifiercomplentryunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryunit"
msgid "Unit"
msgstr "Jednotka"
#: lazarusidestrconsts.dlgiahadentifiercomplentryvar
msgid "Var"
msgstr ""
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Dokončovanie identifikátorov"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Pravidlá identifikátora"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr ""
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr ""
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr ""
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Vrátane systémových premenných"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr ""
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr ""
#: lazarusidestrconsts.dlgindentslineindentgroupoptions
msgid "Indent (New line)"
msgstr ""
#: lazarusidestrconsts.dlgindentstabindentgroupoptions
msgid "Indent (Tab key on Selection)"
msgstr ""
#: lazarusidestrconsts.dlgindentstabskeyoptions
msgid "Tab key"
msgstr ""
#: lazarusidestrconsts.dlgindentstabswidthsoptions
msgid "Tabs widths (Tab stop position)"
msgstr ""
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Pred metódy"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Meno konštruktora musí byť 'init' (deštruktor musí byť 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr ""
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr ""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Vložiť medzeru za"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Vložiť medzeru pred"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval v sekundách"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skákanie (tj. Skákanie na metódy)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr ""
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "Ponechať X pozíciu kurzora pri navigácii nahor/nadol"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Upraviť kláves)"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mapovanie klávesov"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Chyba mapovania klávesov"
#: lazarusidestrconsts.dlgkeyword
#, fuzzy
msgctxt "lazarusidestrconsts.dlgkeyword"
msgid "Keyword"
msgstr "Kľúčové slovo"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Pravidlá kľúčových slov"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Povoliť LABEL a GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Jazyk"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Posledný (tj. na konci kódu)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Adresár Lazarus (predvolený pre všetky projekty)"
#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr ""
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "farba ľavej a hornej"
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "1 (rýchla, priateľská k debugeru s malými obmedzeniami)"
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + rýchle optimalizácie)"
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + pomalé optimalizácie)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + agresívne optimalizácie, pozor)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization, for debugging)"
msgstr "0 (bez zvláštnych optimalizácií, pre ladenie)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Rozdeľovanie riadkov"
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Smart linkovanie"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Zobraziť čísla riadkov v behovom výpise chýb"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Zobraziť formuláre projektu"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Zobraziť rámce projektu"
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Zobraziť jednotky projektu"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Spustiteľný súbor \"Make\""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Spravovať pracovné plochy"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Okraj a gutter"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Farba markera"
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr ""
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Zmazať"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivedit
msgid "Edit list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivselect
msgid "Create or Select list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Meno"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Rozlišovať veľkosť písmen"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "aktuálne slovo"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key mappings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr ""
#: lazarusidestrconsts.dlgmatchwords
msgid "Match words"
msgstr ""
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum počítadla"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximálna dĺžka riadka:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum posledných súborov"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr ""
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum posledných projektov"
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr ""
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr ""
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Zmiešané metódy a vlastnosti"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Režim"
#: lazarusidestrconsts.dlgmodifier
msgid "Modifier"
msgstr ""
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Akcia myši"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Vľavo"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Akcia"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Akcia"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Poradie"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorita"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Myš"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Všetko"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Výber"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorita"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Ladiť"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Upozorňovanie"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Viacnásobný výber"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr ""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Pomenovanie"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Nová pracovná plocha ..."
#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Nepremenovávať automaticky"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""
#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr ""
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Nerozdeľovať riadok za"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Nerozdeľovať riadok pred"
#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr ""
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inšpektor objektov"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Výška položky (0 = auto)"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Zaujímavé"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Rýchle nastavenia"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Použiť predvolené nastavenia Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Použiť predvolené nastavenia Lazarusu"
#: lazarusidestrconsts.dlgoptdebugbackendeditdebuggerbackend
msgid "Edit debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptdebugbackendselectdebuggerbackend
msgid "Select debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptdebugbackendtheprojectoptionshavebeen
msgid "The project options have been set to use a different debugger backend"
msgstr ""
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Úrovne optimalizácie"
#: lazarusidestrconsts.dlgoptwordwrap
msgid "Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapallhl
msgid "Select all"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapcheckfixedlength
msgid "Wrap at fixed column"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapdisplaycaretatwrappositio
msgid "Display caret at wrap-position..."
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapendofline
msgid "end of line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapfixedlinelength
msgid "Fixed line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwraphomeendkey
msgid "Force default home/end keys to subline start/end"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindent
msgid "Indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentisoffset
msgctxt "lazarusidestrconsts.dlgoptwordwrapindentisoffset"
msgid "Indent relative to text"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmax
msgid "Maximum indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmaxrel
msgid "Maximum indent width (percent)"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapindentmin
msgid "Minimum indent width"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapmaximumlinelength
msgid "Maximum line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapminimumlinelength
msgid "Minimum line length"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapnonehl
msgid "Clear selection"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapsectioncolumn
msgid "Wrap column settings"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapsectionindent
msgid "Indent settings"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapstartofnextline
msgid "start of next line"
msgstr ""
#: lazarusidestrconsts.dlgoptwordwrapusewordwrap
msgid "Use Word-wrap"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Ďalšie optimalizácie"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Ostatné súbory jednotiek (-Fu) (oddelené bodkočiarkou):"
#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr ""
#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr ""
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr ""
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr ""
#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Rady pre paletu komponentov"
#: lazarusidestrconsts.dlgpascaselabelforotherwise
msgid "Color otherwise/else as case-label"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmode
msgid "Extend of type-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodeident
msgid "Identifier only"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeyandsym
msgid "All, including symbols"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeywords
msgid "Identifier, built-in and keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodenames
msgid "Identifier and built-in (types/values)"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemode
msgid "Extend of initial-value-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemodeliteral
msgid "Include literals (Number, String) in initial-value-highlight in declarations"
msgstr ""
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Predvolená prípona Pascalu"
#: lazarusidestrconsts.dlgpasexthighlightgroup
msgid "Extended Pascal Highlight Options"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight flow control statements (break, continue, exit) as keywords"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Odovzdať voľby spojovaciemu programu s \"-k\" (oddeľovač je medzera)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" types as keyword"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Predvolené"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Žiadne"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr ""
#: lazarusidestrconsts.dlgpersistentcursor
#, fuzzy
#| msgid "Persistent cursor"
msgid "Visible caret in unfocused editor"
msgstr "Trvylý kurzor"
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr ""
#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr ""
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikácia"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "Zmazať ikonu"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Vytvoriť zväzok aplikácií"
#: lazarusidestrconsts.dlgpodebugger
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Debuger"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Načítať pre&dvolené"
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formuláre"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ikona:"
#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(veľkosť: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(žiadne)"
#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr "@<ukazovateľ> vracia typovaný ukazovateľ"
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "Načítať ikonu"
#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness (Windows 10 1607+)"
msgstr ""
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Zaujímavé"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Zdroje"
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "Uložiť ikonu"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Relácia"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titulok:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Použiť zväzok aplikácií pre spustenie a ladenie"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Použiť škálovanie LCL (Hi-DPI)"
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "Použiť súbor manifestu, pre zapnutie tém (len Windows)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Uprednostniť dvoj-klik pred jedno-klikom"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Projekt"
#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Voľby projektu: %s"
#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr ""
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Súbory projektu"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "O&pýtať sa pred nahradením"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Dokončovanie vlastností"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Meno vlastnosti"
#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "Pri spustení otvoriť posledný projekt"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Zobraziť border spacing"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Zobraziť mriežku"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Prichytiť k mriežke"
#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr "Naozaj zmazať pracovnú plochu \"%s\"?"
#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr ""
#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr ""
#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr ""
#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr ""
#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr ""
#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr ""
#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr ""
#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr ""
#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Odkazy"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "&Regulárne výrazy"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Premenovať pracovnú plochu"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Premenovať"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr "Premenovať vybratú pracovnú plochu"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "N&ahradiť všetko"
#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "Na&hradiť s"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Hlásenie"
#: lazarusidestrconsts.dlgreset
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.dlgresetactivedesktopbtncaption
msgid "Restore active"
msgstr ""
#: lazarusidestrconsts.dlgresetactivedesktopbtnhint
msgid "Restore window layout of active desktop"
msgstr ""
#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr ""
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "farba pravej a dolnej"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "Kliknutie pravým vyberá"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Pravý okraj"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Pracovný adresár"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Vytváranie"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Výber"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Zobraziť (nie pre Win32, napr. 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Prostredie"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokálne"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systémové premenné"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Použiť displej"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Používateľské prepisuje"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Parametre spustenia"
#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr "Spustiť používa debuger (vypnúť pre \"release\" režim)"
#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr "Uložiť aktuálnu pracovnú plochu"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Uložiť aktuálnu pracovnú plochu ako"
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr "Uložiť aktívnu pracovnú plochu ako ..."
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr "Uložiť aktívnu pracovnú plochu ako"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Uložiť informácie editora pre zatvorené súbory"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Uložiť informácie editora len pre súbory projektu"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr ""
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Uložiť do"
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Posunúť o jedno"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr ""
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Zobraziť rady posunu"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Rolovať za koniec súboru"
#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Allow Caret to move past the end of line"
msgstr "Rolovať za koniec riadka"
#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Hľadanie prerušené používateľom."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Hľadanie ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Cesty"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Rozsah vyhľadávania"
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr ""
#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "&Vybratý text"
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Nastaviť všetky prvky na predvolené"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Nastaviť prvok na predvolené"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Premenná nastavenia vlastnosti"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Zobraziť všetky jednotky"
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr ""
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Zobraziť preložené procedúry"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Zobraziť čísla riadkov"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Zobraziť podmienky"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Zobraziť ladiace informácie"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Zobraziť rady návrhára"
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr ""
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Zobraziť všetko"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Zobraziť informácie o spustiteľnom súbore (len Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Zobraziť všeobecné informácie"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Zobraziť panel pokynov"
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Zobraziť rady"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr ""
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Zobraziť čísla riadkov"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Zobraziť poznámky"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Zobraziť spracovávané súbory"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Zobraziť použité jednotky"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Zobraziť upozornenia"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr ""
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Inteligentné tabulátory"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol za (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Počítadlo (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol pred (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Prichytiť k pomocným čiaram"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr ""
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Viacriadkové karty"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Medzera"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Rady pre základné tlačítka (Otvoriť, Uložiť, ...)"
#: lazarusidestrconsts.dlgsrcedcolorlabelinthesourceareonlyco
msgid "Label in the source are only colored if the colon \":\" is placed immediately after the label."
msgstr ""
#: lazarusidestrconsts.dlgsrcedcolormembercolorisappliedtoany
msgid "\"Member\" color is applied to any identifier behind a dot \".\"."
msgstr ""
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Počiatok"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Veľkosť zásobníka"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zastaviť po počte chýb:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineafterfirst
msgid "Align second line (after first break) with the position of the lowest matching group in the pattern, or the match position of the pattern itself."
msgstr ""
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineregex
msgid "Align second line (reg-ex):"
msgstr ""
#: lazarusidestrconsts.dlgstringcontalignmaxindentforsecondlineifb
msgid "Max indent for second line if based on reg-ex:"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Podvlastnosti"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Voľby syntaxe"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulátor odsadzuje blok"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátory na medzery"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Šírka tabulátora"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Cieľová rodina CPU"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Cieľový OS"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Cieľová platforma"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Cieľový procesor"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Voľby špecifické pre cieľ"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Adresár pre vybudovanie testovacích projektov"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr ""
#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "Hľadať &text"
#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr ""
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr "Prepnúť ako ladiacu pracovnú plochu"
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr "Prepnúť ako ladiacu pracovnú plochu"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Odstrániť zvyšné medzery"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Späť po uložení"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr ""
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limit vrátenia"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Obnoviť"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Výstupný adresár jednotky (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "Skladanie kódu"
#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr ""
#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr ""
#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr ""
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Použiť dodatočný konfiguračný súbor prekladača"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr ""
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Použiť štandardný konfiguračný súbor prekladača (fpc.cfg)"
#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr ""
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr ""
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Použiť spúšťaciu aplikáciu"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr ""
#: lazarusidestrconsts.dlguseschemedefaults
msgid "- Scheme globals -"
msgstr ""
#: lazarusidestrconsts.dlguseschemelocal
msgid "selected language"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Použiť zvýrazňovanie syntaxe"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Použiť históriu kariet pri zatváraní kariet"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Pridať jednotku do sekcie Uses"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Výrečnosť počas prekladu:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Viditeľný gutter"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Viditeľný pravý okraj"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "Iba &celé slová"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Šírka:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplikácia Win32 GUI"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Okno"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Slová"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Ukážka"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Zapísať logo FPC"
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr ""
#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr ""
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr ""
#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr ""
#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr ""
#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr ""
#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr ""
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr ""
#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr ""
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Viacnásobný výber komponentov musí byť na jednom formulári."
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Zarovnať ..."
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Zmazať výber"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Preklopiť vodorovne"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Preklopiť zvislo"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "O jednu späť"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "O jednu dopredu"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Posunúť dozadu"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Posunúť dopredu"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Uložiť formulár ako XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Mierka ..."
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Mierka"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Vybrať všetky"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Veľkosť ..."
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Veľkosť"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Voľba: Prichytiť k mriežke"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Voľba: Prichytiť k pomocným čiaram"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Na oboch stranách"
#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr ""
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr ""
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugcurrent
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr "Aktuálny"
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr ""
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr ""
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugignore
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr "Ignorovať"
#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugnew
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Nový"
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr ""
#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr ""
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr ""
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Pridať súbory"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nejednoznačný typ predka"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nejednoznačné meno triedy"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nejednoznačné meno jednotky"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Typ predka"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Porušené závislosti"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Meno triedy už existuje"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Závislosť"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr ""
#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Súbor už existuje"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Súbor je používaný"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Meno súboru/URL"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Súbor nie je jednotka"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr ""
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr ""
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Neplatný typ predka"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Neplatné meno triedy"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Neplatný súbor"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Neplatné meno súboru"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Neplatné meno jednotky"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" nie je platné meno jednotky."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Meno novej triedy:"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nový súbor"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format, fuzzy, badformat
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Nenájdený balíček pre závislosť %s%s%s.%sProsím zvoľte existujúci balíček."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Balíček/Projekt"
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Meno stránky je veľmi dlhé"
#: lazarusidestrconsts.lisa2ppalettepage
#, fuzzy
#| msgid "Palette Page:"
msgid "Palette page:"
msgstr "Stránky palety:"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Skrátené alebo úplné meno súboru"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Zobraziť všetko"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format, fuzzy, badformat
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Typ predka %s%s%s má rovnaké meno ako %sjednotka %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format, fuzzy, badformat
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Typ predka %s%s%s nie je platný identifikátor Pascalu."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Meno triedy %s%s%s a typ predka %s%s%s sú rovnaké."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Meno triedy %s%s%s už existuje v %sBalíčku %s%sSúbor: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Meno triedy %s%s%s má rovnaké meno triedy ako %sjednotka %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format, fuzzy, badformat
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Meno triedy %s%s%s nie je platný identifikátor Pascalu."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Súbor %s%s%s je časťou aktuálneho projektu.%sNie je dobrý nápad zdieľať súbory medzi projektmi a balíčkami."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format, fuzzy, badformat
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Meno súboru %s%s%s je neplatné, pretože balíček zatiaľ nemá predvolený adresár.%sProsím zadajte meno súboru s úplnou cestou."
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximálna verzia je menšia ako Minimálna verzia."
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format, fuzzy, badformat
#| msgid "The package already has a dependency on the package %s%s%s."
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Balíček už má závislosť na balíčku %s%s%s."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Meno stránky \"%s\" je príliš dlhé (max 100 znakov)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Meno jednotky %s%s%s už existuje v balíčku:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The unitname %s%s%s already exists in this package."
msgid "The unitname \"%s\" already exists in this package."
msgstr "Meno jednotky %s%s%s už v tomto balíčku existuje."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Meno jednotky %s%s%s%sa meno súboru %s%s%s sú rôzne."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Meno jednotky %s%s%s je rovnaké ako meno registrovaného komponentu.%sTakéto použitie môže spôsobiť nezvyklé chybové správy."
#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Meno jednotky:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Meno jednotky už v existuje"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Zahodiť zmeny?"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Zrušiť všetky načítania"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Zrušiť načítanie projektu"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "O ..."
#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "O %s"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentácia:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "O IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "O Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Licencia: GPL/LGPL%sLazarus je IDE pre tvorbu (grafických a konzolových) aplikácií pomocou Free Pascal. Free Pascal je (L)GPL Pascal a Object Pascal prekladač, ktorý beží vo Windows, Linux, Mac OS X, FreeBSD a iných.%sLazarus je chýbajúca časť skladačky, ktorá umožní vyvýjať programy pre všetky vyššie spomínané platformy v prostredí podobnom Delphi. IDE je RAD nástroj, ktorý zahŕňa návrhára formulárov.%sKeďže Lazarus narastá, potrebujeme viac vývojárov."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Nemôžem nájsť zoznam spolupracovníkov."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficiálne:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format, fuzzy
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "%s nemôže uchovávať TControls.%sMôžete do nej vložiť len nevizuálne komponenty."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Poďakovanie"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktivuje syntax regulárnych výrazov pre text a nahradzovanie (presne ako perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktívny"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktívny filter"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Pridať nový oddeľovač nad vybratú položku"
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Pridať nový oddeľovač pod vybratú položku"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Pridať definície simulujúce Delphi7"
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Pridať -FcUTF8"
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr ""
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr ""
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr ""
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr ""
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr ""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Pridať nový režim vybudovania, kopírovaním nastavení z \"%s\""
#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr ""
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Pridať nové makro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Pridať novú množinu"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""
#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "Pridať %s do projektu?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr ""
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""
#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Pridať súbor do balíčka"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Cieľový balíček"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Typ súboru"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Neplatný balíček"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "Neplatné ID balíčka: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Balíček je len na čítanie"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "Balíček \"%s\" nenájdený."
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Zobraziť všetko"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "Balíček %s je len na čítanie."
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Zarovnanie"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Všetky bloky vyzerajú OK."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Všetky režimy vybudovania>"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""
#: lazarusidestrconsts.lisalloptions
#, object-pascal-format, fuzzy, badformat
#| msgid "All Options"
msgid "All options of FPC%s (\"%s\")"
msgstr "Všetky voľby"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Dovoliť hľadanie na viacerých riadkoch"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format, fuzzy, badformat
#| msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Všetky úpravy v %s%s%s%sbudú stratené a súbor bude znova otvorený."
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalreadycontainsthehe
#, object-pascal-format
msgid ""
"%s already contains the help:\n"
"%s"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternatívny kláves"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternatívny kláves (ale postupnosť dvoch)"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Nájdený nejednoznačný súbor"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format, fuzzy, badformat
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Nájdený nejednoznačný súbor: %s%s%s%sTento súbor môže byť poškodený %s%s%s%s%sZmazať nejednoznačný súbor?"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor ukotvenia - nevybratý prvok"
#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr "Ukotvenia: %s"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ukotvenia vybratých prvkov"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format, fuzzy, badformat
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Pri poslednom štarte nastala chyba pri otváraní %s!%s%sOtvoriť projekt znova?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr ""
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Meno triedy &Aplikácie"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Grafická aplikácia Free Pascalu využívajúca multiplatformovú knižnicu LCL pre svoje GUI."
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Použiť"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
#, fuzzy
#| msgid "apply build flags (-B) to dependencies too"
msgid "Apply build flags (-B) to dependencies too."
msgstr "použiť príznaky budovania (-B) aj pre závislosti"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Uplatniť konvencie"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Okraj okolo prvku. Ostatné štyri okraje sú pridané k tejto hodnote."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Spýtať sa pred nahradením nájdeného textu"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr ""
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Opýtať sa na názov súboru pri novom súbore"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Zobraziť kompletnú paletu komponentov"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Automatické dokončovanie: vypnuté"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Automatické dokončovanie: zapnuté"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automaticky"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automaticky"
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "koniec riadka"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "medzera"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "koniec slova"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Dokončovanie a rady"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Automaticky zobraziť Inšpektor objektov"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Dostupné na inštaláciu"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes"
msgstr "Dostupné režimy vybudovania projektu"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Záložný súbor zlyhal"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Zmena mena alebo verzie balíčka poruší závislosti. Majú byť zmenené aj tieto závislosti?%sZvoľte Áno pre zmenu všetkých zobrazených závislostí.%sZvoľte Ignorovať pre zrušenie závislostí a pokračovanie."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "začína"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "Be less verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "Be more verbose. Can be given multiple times."
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Pred spustením vždy vybudovať"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Príkaz Vybudovať"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Na vybudovanie projektu spusťte príkaz Vybudovať súbor"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Na spustenie projektu spusťte príkaz Spustiť súbor"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Príkaz spustiť"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Keď je tento súbor aktívny v editore"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Pracovný adresár (nechajte prázdne pre cestu súboru)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Zmenené hodnoty tučne"
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Priestor na okraji"
#: lazarusidestrconsts.lisbottom
#, fuzzy
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Dole"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Spodný okraj. Táto hodnota je pridaná k základnému okraju a použitá pre medzeru pod prvkom."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Spodné ukotvenie"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Spodné okraje"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Toto je súrodenec prvku, ku ktorého spodnej strane je ukotvený. Ponechajte prázdne pre rodiča."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Rovnaká spodná medzera"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr ""
#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr ""
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Zatvoriť"
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "Na&hradiť ..."
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "Nájsť"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "S&končiť"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Odstrániť"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "P&remenovať"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "Na&hradiť"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Vybudovať"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
#, fuzzy
#| msgid "build all files of project/package/IDE"
msgid "Build all files of project/package/IDE."
msgstr "vybudovať všetky súbory projektu/balíčka/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Vybudovať"
#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr ""
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Vybudovať IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
#, fuzzy
#| msgid "build IDE with packages"
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr "vybudovať IDE aj s balíčkami"
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""
#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr "Režim vybudovania: %s"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Rozdiely medzi režimami vybudovania"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Rozdiely oproti ostatným režimom vybudovania"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Režim:"
#: lazarusidestrconsts.lisbuildmodes
#, fuzzy
#| msgid "Build modes"
msgid "Build mode"
msgstr "Režimy vybudovania"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Vybudovať nový projekt"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Číslo vybudovania"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Vybudovať"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr ""
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Zrušiť načítanie tohoto komponentu"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Zrušiť načítanie jednotky"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Zrušiť premenovanie"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Nie je možné kopírovať komponent najvyššej úrovne."
#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "Nie je možné vytvoriť súbor \"%s\""
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Nie je možné vymazať posledný režim."
#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr ""
#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Nemožno nájsť spúšťač Lazarusu: %s%s"
#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr "Nedá sa otvoriť formulár \"%s\"."
#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Zmeniť možno len triedu TComponents."
#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr ""
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Porovnať súbory (nie na vytváranie záplat)"
#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (%s súborov)"
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "Zmeniť triedu %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "žiadna trieda"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Nejednoznačný prekladač"
#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format, fuzzy
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Prosím skontrolujte testovací adresár v %sProstredie -> Voľby prostredia -> Súbory -> Adresár pre budovanie testovacích projektov"
#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Prekladač \"%s\" nie je spustiteľný súbor.%sDetaily: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "obsahuje "
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Kopírovať výstup do do schránky"
#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format, fuzzy
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Dátumy .ppu·súborov FPC sú rozdielne o viac ako hodinu.%sTo môže znamenať, že sú z rôznych inštalácií.%sSúbor1: %s%sSúbor2: %s"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "CHYBA: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Cesta k jednotkám FPC obsahuje zdrojový kód: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "symboly nového riadka"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "RADA: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Neplatný prekladač"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Neplatná cesta hľadania"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Neplatný testovací adresár"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Chýbajúca jednotka"
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr ""
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "nájdené viaceré konfigurácie prekladača: "
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg nenájdený"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "nie je ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "ppu existuje dvakrát: %s, %s"
#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Existujúci súbor .ppu je starší ako prekladač samotný:%s%s"
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr ""
#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr "Preskočiť"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "špeciálne znaky"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Všetky testy úspešné."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Nie je možné vytvoriť testovací súbor"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format, fuzzy
#| msgid "Unable to create Test pascal file \"%s\"."
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "textového vytvoriť testovací pascalovský súbor \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "nezvyčajné znaky"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Upozorňovanie"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "UPOZORNENIE: "
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "zlý oddeľovač cesty"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Kategórie"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konštanty"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(filter)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Nasledovať kurzor"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Zobraziť kategórie"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Zobraziť uzly zdrojového kódu"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr ""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centrovať stratené okno"
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrovať ovládací prvok vodorovne vzhľadom na daného súrodenca. BorderSpacing sa ignoruje."
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrovať ovládací prvok zvislo vzhľadom na daného súrodenca. BorderSpacing sa ignoruje."
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Centrovať formulár"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centrovať v okne"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Stredy"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Preferovaný ukážkový režim"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Kategória"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Zdrojový kód"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nikdy, len manuálne"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Použiteľné len v režime kategórie"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Pri nečinnosti"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Obnoviť automaticky"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Ostatné"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aktualizovať"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Pri prepínaní súboru v editore"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedúry"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Vlastnosti"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr ""
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Štýl"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Typy"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Premenné"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr ""
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr ""
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr ""
#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr ""
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr ""
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr ""
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr ""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr ""
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr ""
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Zmeniť"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Zmeniť režim vybudovania"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Zmeniť triedu"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Zmeniť kódovanie"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Zmeniť súbor"
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Zmeniť rodiča"
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Zmeniť na Unix /"
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Zmeniť na Windows \\"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Začiarknúť všetko"
#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Kontrolovať zmeny súborov na disku prostredníctvom obsahu a nie časovej pečiatky"
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ""
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Skontrolovať voľby"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ""
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr ""
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgctxt "lazarusidestrconsts.lischooseadifferentname"
msgid "Choose a different name"
msgstr "Zvoľte iné meno"
#: lazarusidestrconsts.lischooseadifferentname2
#, fuzzy
msgctxt "lazarusidestrconsts.lischooseadifferentname2"
msgid "Choose a different name"
msgstr "Zvoľte iné meno"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Zvoľte odkaz FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Zvoľte kláves ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr ""
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr ""
#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Vyberte spustiteľný súbor prekladača (%s)"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Vyberte súbor správ prekladača"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Vyberte spustiteľný súbor debugera"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Vyberte Delphi balíček (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Vyberte Delphi projekt (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Zvoliť Delphi jednotku (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Zvoľte adresár"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr ""
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Vyberte adresár zdrojových kódov FPC"
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr ""
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Vyberte adresár Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Vyberte spustiteľný súbor \"Make\""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr ""
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Zvoľte položku pre vytvorenie nového súboru"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Zvoľte položku pre vytvorenie nového balíčka"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Zvoľte položku pre vytvorenie nového projektu"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Zvoľte jednu z týchto položiek, z ktorej bude dedené"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Zvoľte zdrojový kód programu (*.pp, *.pas, *.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Zvoľte štruktúru pre uzavretie výberu"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Dokončovanie triedy"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Trieda \"%s\" nie je triedou registrovaného komponentu.%sNemožno vložiť."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Trieda nenájdená"
#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "Class %s%s%s of method %s%s%s not found."
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Nenájdená trieda %s%s%s metódy %s%s%s."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Vyčistiť adresár"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Vyčistiť podadresáre"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Ponechať všetky textové súbory"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Ponechať všetky súbory vyhovujúce filtru"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Odstrániť súbory vyhovujúce filtru"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Jednoduchá syntax (napr. * namiesto .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Vyčistiť všetko"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Vyčistiť zdrojové kódy Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Prepnúť po vybudovaní na Automaticky"
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Vyčistiť"
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Vyčistiť a vybudovať"
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Vyčistiť a vybudovať projekt"
#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr ""
#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr "Vyčistiť balíček \"%s\"."
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Vyčistiť cestu jednotky?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Vymazať"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Vyčistiť adresár?"
#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr "Vyčistiť filter"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Pre prehľadávanie súboru kliknite tu"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Kliknutím zobraziť možnosti"
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Klonovať"
#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Zatvoriť"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Zatvoriť všetky začiarknuté"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Zatvoriť súbory"
#: lazarusidestrconsts.lisclosealltabshide
#, fuzzy
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Skryť okno"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Špecifické voľby rozhrania LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponenty"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Dedičnosť"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Zoznam"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Stránky"
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "Paleta je &viditeľná"
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Nejednoznačný dodatočný konfiguračný súbor prekladača"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Volať pri:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format, fuzzy
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sKliknite na OK, ak ste si istí vykonaním."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Príkaz:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Kód"
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Prehliadač kódu"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Umiestnenie"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Voľby generovania kódu"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Pridať cestu"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Prezerať"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Potvrdiť nahradenie"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Vytvoriť položku pomoci"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Odstrániť cestu"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Popis"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Chyby"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Príklad"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Vložiť formátovaciu značku pre kód"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Vložiť formátovaciu značku pre kurzívu"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Vložiť formátovaciu značku poznámky"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Vložiť formátovaciu značku pre podčiarknuté"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Vložiť formátovaciu značku var"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Zdedené"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Vložiť odkaz ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Vložiť značku formátovania odseku"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPCDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenájdený zdedený popis)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NIČ>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Pozri aj"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Krátky popis"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Krátky"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Pridať šablónu"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Pridať šablónu kódu"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Automatické dokončovanie na"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentár:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Upraviť šablónu kódu"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr ""
#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr ""
#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr ""
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Akcia: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Automaticky vytvorené uzly nemôžu byť upravované,%sani nemôžu mať neautomaticky vytvorené podriadené uzly."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, auto generované"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "Automaticky generované uzly nemôžu byť upravované."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor definícií CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Cesta k prekladaču"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konvertovať uzol"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Vytvoriť definície pre adresár %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Vytvoriť definície pre prekladač Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Vytvoriť definície pre Free Pascal Git zdroje"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Vytvoriť definície pre projekt %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Vytvoriť FPC makrá a cesty pre adresár projektu fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definovať"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definovať rekurzívne"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Zmazať uzol"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Popis:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "%s adresár"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC Git source directory"
msgstr "Git zdrojový adresár FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Adresár"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Vložiť šablónu projektu Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Vložiť šablónu projektu Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Vložiť šablónu projektu Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Vložiť šablónu prekladača FreePascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Vložiť šablónu projektu FreePascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal Git Source Template"
msgstr "Vložiť šablónu Git zdroja FreePascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Vložiť šablónu prekladača Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Vložiť šablónu adresára Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Vložiť šablónu projektu Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Vložiť podriadený uzol"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Vložiť uzol pod"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vložiť šablónu"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Neplatný rodič"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Neplatný rodičovský uzol"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Neplatný predchádzajúci uzol"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Posunúť uzol nižšie"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Posunúť uzol o úroveň nižšie"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Posunúť uzol o úroveň vyššie"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Posunúť uzol vyššie"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Meno:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nový uzol"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Uzol je len na čítanie"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nevybraté"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Rodičovský uzol nemôže obsahovať podriadené uzly."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Predchádzajúci uzol nemôže obsahovať vnorené uzly."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Adresár projektu"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "%s adresár projektu"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Zvolený uzol:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "Git zdrojový adresár Free Pascalu. Nevyžadované, ale zlepšuje hľadanie deklarácií a ladenie."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Adresár projektu Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal Git source directory."
msgstr "Git zdrojový adresár Free Pascalu."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Cesta k prekladaču Free Pascal.%s Napríklad %s/usr/bin/%s -n%s alebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "Cesta k prekladaču Free Pascal pre tento projekt. Vyžadované len ak nastavíte FPC Git zdroj nižšie. Použité pre automaticky vytvárané makrá."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format, fuzzy, badformat
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Adresár projektu %s, ktorý obsahuje súbory .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Zrušiť definíciu"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Zrušiť všetky definície"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Zrušiť definíciu rekurzívne"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Hodnota ako text"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Premenná:"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Na"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Zátvorka"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Stĺpec"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Čiarka"
#: lazarusidestrconsts.liscodetoolsoptscomment
msgctxt "lazarusidestrconsts.liscodetoolsoptscomment"
msgid "Comment"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscommentansi
msgid "ANSI Comment: (*"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscommentbor
msgid "Curly Comment: {"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscommentslash
msgid "Slash Comment: //"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgctxt "lazarusidestrconsts.liscodetoolsoptskeyword"
msgid "Keyword"
msgstr "Kľúčové slovo"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nový riadok"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Žiadne"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Číslo"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Bod"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Bodkočiarka"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Medzerník"
#: lazarusidestrconsts.liscodetoolsoptsstring
msgid "String"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Reťazcová konštanta"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Spustiť po"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Spustiť pred"
#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All [Ctrl+Minus]"
msgstr ""
#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Zbaliť všetky triedy"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Zbaliť všetky balíčky"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Zbaliť všetky jednotky"
#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr ""
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parametre príkazového riadka"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametre príkazového riadka programu"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Preložiť"
#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Preložiť nasledujúce režimy"
#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr ""
#: lazarusidestrconsts.liscompilepackagetwiceandcheckifanyunitwascompiledaga
msgid "Compile package twice and check if any unit was compiled again."
msgstr ""
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Preložiť projekt"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Prekladač"
#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr ""
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr ""
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Chyba: neplatný prekladač: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Meno súboru prekladača"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Rada: cestu prekladača môžete nastaviť v Nástroje ->Voľby prostredia ->Súbory -> Spustiteľný súbor prekladača"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Poznámka: Nenájdený konfiguračýs úbor CodeTools - použité predvolené"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Poznámka: načítanie starého súboru volieb CodeTools: "
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Preložiť"
#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr ""
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (prekladám ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nikdy"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "Meno komponentu \"%s\" je kľúčové slovo"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Otvoriť balíček"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Otvoriť jednotku"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr ""
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr ""
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Podmienka"
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Podmienky"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Konfiguračný adresár Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Konfigurovať budovanie %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Konfigurovať \"Vybudovanie Lazarusu\""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Potvrdiť zmeny"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Potvrdiť zmazanie"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Chcete prebudovať Lazarus s profilom: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Potvrdiť nastavenia nových balíčkov pre IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Akcia"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nové balíčky"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Staré balíčky"
#: lazarusidestrconsts.lisconfirmreplace
msgid "Confirm Replace"
msgstr ""
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Konflikt"
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konzolová aplikácia"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Kód konštruktora"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "obsahuje"
#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Obsah"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Pokračovať bez načítania formulára"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Spolupracovníci"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Ovládací prvok musí mať rodiča"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr ""
#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr ""
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr ""
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr ""
#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""
#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Konvertovať Delphi balíček"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Konvertovať Delphi projekt"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Konvertovať Delphi jednotku"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Delphi funkcia"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Delphi meno"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Chyba konverzie"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Konvertovať"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Konvertovať kódovanie"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Konvertovať kódovanie projektov/balíčkov"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Konvertovať projekt alebo balíček"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Cieľ"
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr ""
#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr ""
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr ""
#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr ""
#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr ""
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr ""
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr ""
#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Žiadne"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr ""
#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Prehliadač kódu"
#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Šablóny kódu"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Návrhár"
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""
#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Správy"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr ""
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Chyba kopírovania"
#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr ""
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr ""
#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopírovanie celého formulára nie je implementované."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Kopírovať vybraté správy do schránky"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Hľadať správy FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Hľadať správy Make"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Preskočiť volanie prekladača"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Upozornenie: Dodatočný konfiguračný súbor prekladača má rovnaké meno ako jeden zo štandardných mien konfiguračných súborov prekladača FreePascal. Toto môže mať za následok spracovanie LEN dodatočného konfiguračného súboru a preskočenie štandardného."
#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Otvoriť balíček %s"
#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Otvoriť jednotku %s"
#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ""
#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Najprv vytvorte projekt!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Vytvoriť režimy \"Debug\" a \"Relese\""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Vytvoriť adresár?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Vytvoriť filter"
#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Vytvoriť uzol Pomoci"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Vytvoriť v"
#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Vytvoriť projekt"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Vytvoriť/aktualizovať súbor .po pri ukladaní súboru lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Zvoliť adresár"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Hodnoty adresárov CodeTools"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definovať šablóny"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<premenná nezvolená>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Otvoriť ukážku"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Nástroje"
#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Premenná: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Meno premennej"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Šablóny"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "prosím vyberte makro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Vybrať makro kódu"
#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Aktuálny LCL widgetset: \"%s\""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Aktuálny stav: "
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Stĺpec kurzora v aktuálnom editore"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Riadok kurzora v aktuálnom editore"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Tieto voľby sa odovzdajú prekladaču po nahradení makier."
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "vlastné voľby"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Vlastné voľby"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Vlastné voľby"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Vlastný program"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nie je zadaný debuger"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Nastaviť bod prerušenia aj tak"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format, fuzzy
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Nie je definovaný debuger.%sNastavenie bodu prerušenia nemá význam, dokiaľ nenastavíte debuger v dialógu Voľby debugera v menu."
#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Ladiť"
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr ""
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr ""
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Debuger"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format, fuzzy, badformat
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Chyba debugera %sDebuger vstúpil do chybového stavu%sUložte svoju prácu!%sPoužite Stop, a dúfajte v najlepšie, we're pulling the plug."
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Neplatný debuger"
#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (ladím ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Pridať výnimku"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Ďalšia prehľadávaná cesta"
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Bod prerušenia"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Pri spustení zmazať záznam"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Debuger"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Všeobecné voľby debugera"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Špecifické voľby debugera (závisia na type debugera)"
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Záznam udalostí"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Obslúžené"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Obslúžené debugerom"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Obslúžené programom"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorovať tieto výnimky"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Výnimky jazyka"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Obmedziť počet riadkov na"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Meno:"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Upozorniť pri výnimkách"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Výnimky OS"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Výstup"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Resetovať debuger po každom spustení"
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Zobraziť Správy pri zastavení"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signály"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Vlákno"
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr "-- Použiť predvolený debuger --"
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nemožno načítať súbor"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "Nemožno načítať súbor \"%s\"."
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Predvolené"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr ""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr ""
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Zmazať?"
#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Z&mazať všetky"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Zmazať všetky tieto súbory?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Zmazať nejednoznačný súbor?"
#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "Zmazať makro \"%s\"?"
#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Zmazať režim \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "Zmazať starý súbor \"%s\"?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr ""
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr ""
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr ""
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Pracovné plochy ..."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cieľový adresár"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Kód deštruktora"
#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr ""
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Necitlivé na veľkosť"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Súbor1"
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Súbor2"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorovať prázdne riadky pri pridávaní a odstraňovaní"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorovať rozdiely koncov riadkov (e.g. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorovať niekoľko znakov medzery"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorovať medzery (mimo znakov nového riadka)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorovať medzery na konci riadka"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorovať medzery na začiatku riadka"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Len výber"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Otvoriť rozdiel v editore"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktívy"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Adresáre"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Adresár: "
#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Zahodiť zmeny"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Zahodiť všetky zmeny"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Zahodiť zmeny a otvoriť projekt"
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Zahodiť zmeny a skončiť"
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Zahodiť zmeny, vytvoriť nový projekt"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kliknite na jednu z položiek pre zobrazenie rozdielov"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Chyba čítania súboru: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Ignorovať všetky zmeny na disku"
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Znovu načítať začiarknuté súbory z disku"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Niektoré súbory boli na disku zmenené:"
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr ""
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Rozoznávať veľké a malé písmená, napr. C a c"
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Všetky voľby ..."
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Zmeniť triedu ..."
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Definície ..."
#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Upraviť ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exportovať ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importovať ..."
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr ""
#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s neexistuje: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Nemeniť"
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "Do not check if another IDE instance is already running."
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Nezatvárať projekt"
#: lazarusidestrconsts.lisdonotcompiledependencies
#, fuzzy
#| msgid "do not compile dependencies"
msgid "Do not compile dependencies."
msgstr "neprekladať závislosti"
#: lazarusidestrconsts.lisdonotshowsplashscreen
#, fuzzy
#| msgid "Do not show splash screen"
msgid "Do not show splash screen."
msgstr "Nezobrazovať úvodnú obrazovku"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Túto správu už nezobrazovať"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""
#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Down"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Kresliť mriežku"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr ""
#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr ""
#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopírovať vybraté komponenty do schránky"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Vystrihnúť vybraté komponenty do schránky"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Presunúť komponent o jeden vzad"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Presunúť komponent o jeden vpred"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Presunúť komponent dozadu"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Presunúť komponent dopredu"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Vložiť vybraté komponenty zo schránky"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Vybrať rodičovský komponent"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Zobraziť nevizuálne komponenty"
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr ""
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr "Režim \"%s\" sa už nachádza v zozname."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Duplicitné meno"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format, fuzzy, badformat
#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Duplikované meno: Komponent pomenovaný %s%s%s už existuje v zdedených komponentoch %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr ""
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr ""
#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr ""
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Upraviť"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr ""
#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Upraviť kontextovú pomoc"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Upraviť kláves"
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr "Makrá editora"
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuálny projekt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Platný nástroj musí mať aspoň titulok a meno súboru."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Upraviť Nástroj"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Kláves"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makrá"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametre:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Meno súboru programu:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Vo výstupe hľadať správy FPC"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Vo výstupe hľadať správy make"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titulok a meno súboru sú vyžadované"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Pracovný adresár:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Všetko"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Prázdne metódy"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Nájdené prázdne metódy:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr ""
#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Len published"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Odstrániť metódy"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Prehľadávať tieto sekcie triedy:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr ""
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr ""
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr ""
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Zapnúť makrá"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr ""
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr ""
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr ""
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Uzavrieť do $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format, fuzzy, badformat
#| msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Kódovanie súboru %s%s%s%sna disku je %s. Nové kódovanie je %s."
#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Neplatné meno debugera"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "Súbor debugera \"%s\" nie je spustiteľný."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Testovací adresár \"%s\" nenájdený."
#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Neplatná voľba na pozícii %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "Voľba na pozícii %d nedovoľuje argument: %s"
#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "Voľba na pozícii %d vyžaduje argument: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Chyba: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Chyba vytvárania súboru"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Chyba mazania súboru"
#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Chyba v %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr ""
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr ""
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr ""
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr ""
#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format
msgid "Error: invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Chyba načítania súboru"
#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr ""
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Chyba presúvania komponentu"
#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Chyba presúvania komponentu %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Chyba otvorenia komponentu"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Chyba otvárania formulára"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Chyba analýzy toku komponentov lfm."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Chyba čítania zoznamu balíčkov zo súboru %s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Chyba čítania XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Chyba čítania XML súboru \"%s\"%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Chyba premenovania súboru"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Chyby"
#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", Chyby: %s"
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Chyba zápisu zoznamu balíčkov do súboru%s%s%s%s"
#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number"
msgid "Show every n-th line number"
msgstr "Každé n-té číslo riadku"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Príklady:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr ""
#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr ""
#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr ""
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr ""
#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr ""
#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr ""
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Vykonávanie zastavené"
#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr ""
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Skončiť"
#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr ""
#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr ""
#: lazarusidestrconsts.lisexpandall
msgid "Expand All [Ctrl+Plus]"
msgstr ""
#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Rozbaliť všetky triedy"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Rozbaliť všetky balíčky"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Rozbaliť všetky jednotky"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Úplné meno súboru aktuálneho súboru editora"
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exportovať"
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Exportovať všetko"
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Exportovať všetky položky do súboru"
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exportovať ako HTML"
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr ""
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list"
msgstr ""
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Exportovať vybraté"
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Oddeliť"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Oddeliť procedúru"
#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr ""
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Externé nástroje"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Disahnuté maximum nástrojov"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Už tam je maximum z %s nástrojov."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr ""
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr ""
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Súbor"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Súbor: "
#: lazarusidestrconsts.lisfilealreadyexists
#, object-pascal-format
msgid "File \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Prípona súboru programu"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Súborový filter"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Filtre súborov"
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Maska súboru"
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "Súbor \"%s\" je virtuálny."
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Súbor nenájdený"
#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Súbor \"%s\" nenájdený.%sChcete ho vytvoriť?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Súbor nie je malými znakmi"
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Nastavenia súboru"
#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Súbory v kódovaní ASCII alebo UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format
msgid "File %s was converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Súbory nie sú v kódovaní ASCII ani UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgid "File where debug output is written to. Default is write to the console."
msgstr "súbor, do ktorého je zapísaný výstup ladenia. Ak nie je zadaný, ladiaci výstup je vypísaný do konzoly."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filter"
#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr ""
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr ""
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr ""
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr ""
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr ""
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Množiny filtrov"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr ""
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr ""
#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Nájsť deklaráciu %s"
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "A&dresáre"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Maska súboru"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Vrátane podadre&sárov"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Viacriadkový vzor"
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "all files in &project"
msgstr "všetky súbory v &projekte"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "all &open files"
msgstr "všetky &otvorené súbory"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "&active file"
msgstr "&aktívny súbor"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "&directories"
msgstr "a&dresáre"
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "project &group"
msgstr "skupina projektov"
#: lazarusidestrconsts.lisfindfilewhere
#, fuzzy
#| msgid "Where"
msgid "Search location"
msgstr "Kde"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Nájsť kombináciu klávesov"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""
#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr ""
#: lazarusidestrconsts.lisfindoverridestoo
msgid "Find overrides too"
msgstr ""
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Opraviť súbor LFM"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Vynútiť premenovanie"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr ""
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Pre macOS (Darwin)"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Chyba formátu"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Pre Windows"
#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr ""
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Verzia FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Verzia FPC (napr. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPCDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr ""
#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr ""
#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr ""
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr ""
#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr ""
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr ""
#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr ""
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr ""
#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr ""
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Hľadať smerom do&zadu"
#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Zdrojový adresár FreePascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Hľa&dať smerom dopredu"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Ďalšie súbory pre hľadanie (napr. /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Nájsť alebo premenovať identifikátor"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Nájsť odkazy"
#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Identifikátor: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "vo všetkých balíčkoch a projektoch"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "v aktuálnej jednotke"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "v hlavnom projekte"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "v projekte/balíčku vlastniacom aktuálnu jednotku"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Neplatný identifikátor"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Premenovať všetky referencie"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Premenovanie"
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Hľadať aj v komentároch"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Funkcia"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Všeobecné"
#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr ""
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr ""
#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr ""
#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr ""
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Choď na riadok"
#: lazarusidestrconsts.lisgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
#| "\n"
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<description>%sCopyright (C) <rok> <meno autora> <kontakt>%sTento zdrojový kód je slobodný softvér; môžete ho rozširovať a/alebo upravovať podľa podmienok GNU Všeobecnej verejnej licencie, tak ako je zverejnené Nadáciou Free Software; verzie 2 licencie alebo (podľa svojho rozhodnutia) akejkoľvek neskoršej verzie. %sTento zdrojový kód je šírený v nádeji, že bude užitočný, ale BEZ AKEJKO2VEK ZÁRUKY; dokonca aj bez zahrnutej záruky PREDAJNOSTI alebo VHDODNOSTI NA PRÍSLUŠNÝ ÚČEL. Ďalšie detaily si pozrite v GNU Všeobecnej verejnej licencii. %sKópia GNU Všeobecnej verejnej licencie je dostupná cez World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Môžete ju získaj aj napísaním do Nadácie Free Software, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Skupina"
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Rozšíriť na najväčšie"
#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr ""
#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr ""
#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr ""
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Má pomoc"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Hlavičkový komentár pre triedu"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Položky pomoci"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Výber pomoci"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Pomoc pre správu FreePascal prekladača"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr ""
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Skryť okno"
#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Rada: Skontrolujte, či dva balíčky neobsahujú jednotku s rovnakým menom."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Tip: Kliknutím na \"Zobraziť voľby\" zistíte, odkiaľ pochádzajú zdedené cesty."
#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ""
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Rada: Funkcia \"Vytvoriť ResourceString\" očakáva reťazcovú konštantu.%sProsím vyberte výraz a skúste znova."
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Zobraziť formuláre"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Zobraziť jednotky"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databázy"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Voľby pomoci"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Vlastnosti:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Prehliadače"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Cesta k HTML dokumentácii FPC"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Vodorovne"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr ""
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr ""
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""
#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr ""
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "IDE bude znova preložené a reštartované počas inštalácie/odinštalácie balíčkov."
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Vitajte v Lazarus IDE.%0:sNájdená konfigurácia IDE bola predtým použitá v inej inštalácii programu Lazarus.%0:sAk máte dve alebo viac samostatných inštalácií Lazarusu, nemali by zdieľať rovnakú konfiguráciu. To môže viesť ku konfliktom a inštalácie Lazarusu sa môžu stať nepoužiteľnými.%0:s%0:sAk máte len jednu inštaláciu a skopírovali ste alebo presunuli spustiteľný súbor Lazarus, môžete túto konfiguráciu aktualizovať.%0:s%1:s%0:s%0:sVyberte si:%0:s%0:s* Informácia o aktualizácii: Použiť túto konfiguráciu a aktualizovať ju pre použitie s týmto Lazarusom v budúcnosti. Stará inštalácia ju už nebude používať.%0:s* Ignorovať: Použiť túto konfiguráciu, ale ponechať upozornenie. Môže to viesť ku konfliktom s inou inštaláciou.%0:s* Prerušiť: Ukončiť hneď. Problém potom môžete vyriešiť spustením tohto programu Lazarus so správnou konfiguráciou.%0:s%0:sDoplňujúce informácie:%0:sTáto konfigurácia je na: %2:s%0:sPatrí k inštalácii Lazarus na: %3:s%0:sAktuálne IDE bolo spustené z: %4:s%0:s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informácie o IDE"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "IDE udržiava Application.Scaled (Hi-DPI) v hlavnej jednotke."
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "IDE udržiava názov (Title) v hlavnej jednotke."
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identifikátor začína s ..."
#: lazarusidestrconsts.lisidentifiercannotbedotted
#, object-pascal-format
msgid "Identifier \"%s\" cannot be dotted"
msgstr ""
#: lazarusidestrconsts.lisidentifiercannotbeempty
msgid "Identifier cannot be empty"
msgstr ""
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identifikátor obsahuje ..."
#: lazarusidestrconsts.lisidentifierisalreadyused
#, object-pascal-format
msgid "Identifier \"%s\" is already used"
msgstr ""
#: lazarusidestrconsts.lisidentifierisalreadyused2
#, object-pascal-format
msgid "Identifier \"%s\" is already used."
msgstr ""
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerfunction
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler function."
msgstr ""
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerprocedure
#, object-pascal-format
msgid "Identifier \"%s\" is a declared compiler procedure."
msgstr ""
#: lazarusidestrconsts.lisidentifierisinvalid
#, object-pascal-format
msgid "Identifier \"%s\" is invalid"
msgstr ""
#: lazarusidestrconsts.lisidentifierisreservedword
#, object-pascal-format
msgid "Identifier \"%s\" is a reserved word"
msgstr ""
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Voľby IDE:"
#: lazarusidestrconsts.lisidetitlecustom
msgid "Custom IDE title"
msgstr ""
#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "Show custom IDE title before built-in IDE title or info"
msgstr ""
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Všetky režimy vybudovania"
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr ""
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Aktuálny režim vybudovania"
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Exportovaný súbor existuje"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Exportovaný súbor \"%s\" existuje.%sOtvoriť súbor a nahradiť len voľby prekladača?%s(Ostatné nastavenia ostanú zachované.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importovať voľby prekladača"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Načítať zo súboru"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr ""
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Uložiť do súboru"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr ""
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr ""
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr ""
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorovať všetko"
#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importovať"
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Importovať voľby prostredia"
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importovať zo súboru"
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr ""
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list"
msgstr "Importovať zoznam balíčkov"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "cesta include"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Cesty Include"
#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr ""
#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Odsadzovanie pre zdrojové súbory Pascalu"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informácie"
#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Informácie o %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informácie o použitom FPC"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Zdedená položka"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr ""
#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr ""
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format, fuzzy, badformat
#| msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Pred vytvorením čistej kópie projektu/balíčka, budú zmazané všetky súbory všetky súbory v cieľovom adresári a všetok ich obsah stratený.%s%sZmazať všetky súbory v %s%s%s?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Vložiť"
#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Vložiť makro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Vložiť meno aktuálnej procedúry."
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr ""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "V relácii"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "nainštalovaný"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""
#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Nainštalovať výber"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Nainštalovať/Odinštalovať balíčky"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compiling a package create a simple Makefile."
msgstr ""
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""
#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr ""
#: lazarusidestrconsts.lisinvaliddeclaration
msgid "Invalid Declaration"
msgstr ""
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Neplatné mazanie"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr ""
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr ""
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Neplatný výraz.%sRada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu v jednom súbore. Prosím vyberte výraz a skúste znova."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Neplatné meno súboru"
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Neplatný filter"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Neplatný viacnásobný výber"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Neplatný identifikátor Pascalu"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr ""
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Neplatné meno procedúry"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Neplatné meno súboru projektu"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Neplatný adresár publikovania"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Neplatný výber"
#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "neplatná verzia v %s"
#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s už je časťou projektu."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format, fuzzy, badformat
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s nie je platné meno projektu.%sProsím vyberte iné (napr. project1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "adresár nenájdený"
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr ""
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "História skokov"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Skoč na chybu"
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr ""
#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Skoč na procedúru %s"
#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr ""
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Ponechať"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Ponechať skonvertované súbory otvorené v editore"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Zachovať meno"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Ponechať otvorené"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr ""
#: lazarusidestrconsts.liskeepsubindentation
#, fuzzy
#| msgid "Keep indentation"
msgid "Absolute indentation"
msgstr "Ponechať odsadenie"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ponechať a pokračovať"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Kľúč"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Vlastné príkazy"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Príkazy návrhára"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Príkazy Inšpektora objektov"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Kláves (alebo postupnosť dvoch)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Zrušiť budovanie"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Pridať adresu bodu prerušenia"
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Pridať zdrojový bod prerušenia"
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Pridať pozorovanie"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Vybudovať viacej režimov"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Vybudovať projekt/program"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasický"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Vyčistiť a vybudovať"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Zatvoriť projekt"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr ""
#: lazarusidestrconsts.liskmconfigbuildfile
#, fuzzy
#| msgid "Config %sBuild File%s"
msgid "Config \"Build File\""
msgstr "Konfigurovať %sVybudovanie súboru%s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Konfigurovať vlastné komponenty"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextovo závislá pomoc"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Konvertovať Delphi balíček na Lazarus balíček"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Konvertovať Delphi projekt na Lazarus projekt"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Konvertovať Delphi jednotku na Lazarus jednotku"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Konvertovať súbor DFM na LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Kopírovať vybraté komponenty"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Vystrihnúť vybraté komponenty"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Zmazať posledný znak"
#: lazarusidestrconsts.liskmdiffeditorfiles
#, fuzzy
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "Rozdiely súborov editora"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Upraviť šablóny kódu"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Upraviť kontextovo závislú pomoc"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Uzavrieť výber"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Vyhodnotiť/Upraviť"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Nastavenie externých nástrojov"
#: lazarusidestrconsts.liskmfindincremental
#, fuzzy
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "Nájsť narastajúco"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Skontrolovať"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schéma rozloženia klávesnice"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Lazarus (predvolené)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS (štýl Apple)"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS (štýl Lazarus)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nový balíček"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nový projekt"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nový projekt zo súboru"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nová jednotka"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Otvoriť súbor balíčka"
#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr "Otvoriť nedávne"
#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr "Otvoriť nedávny balíček"
#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr "Otvoriť nedávny projekt"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Vložiť komponenty"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Prerušiť program"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publikovať projekt"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Rýchly preklad, bez linkovania"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Odstrániť aktívny súbor z projektu"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Spustiť program"
#: lazarusidestrconsts.liskmsaveall
#, fuzzy
#| msgid "SaveAll"
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "Uložiť všetky"
#: lazarusidestrconsts.liskmsaveas
#, fuzzy
#| msgid "SaveAs"
msgid "Save As"
msgstr "Uložiť ako"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Uložiť projekt"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Uložiť projekt ako"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Zastaviť program"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Prepnúť medzi Jednotkou a formulárom"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Zobraziť body prerušenia"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Zobraziť Zásobník volaní"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Prepnúť zobrazenie Prieskumník kódu"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Prepnúť zobrazenie Palety komponentov"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Prepnúť zobrazenie Výstup debugera"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Prepnúť zobrazenie Editor dokumentácie"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Zobraziť históriu"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Prepnúť zobrazenie tlačítiek IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Zobraziť lokálne premenné"
#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Prepnúť zobrazenie Správy"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Prepnúť zobrazenie Inšpektor obejktov"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Zobraziť registre"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Prepnúť zobrazenie Výsledky hľadania"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Prepnúť zobrazenie Editora zdrojových kódov"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Zobraziť vlákna"
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Zobraziť Pozorovania"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Zobraziť históriu skokov"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Zobraziť voľby projektu"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Zobraziť zdrojový kód projektu"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Zobraziť info o jednotke"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Naposledy otvorené"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Neplatné spúšťanie aplikácie"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Spustenie cieľového príkazového riadka"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Adresár Lazarus"
#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr ""
#: lazarusidestrconsts.lislazarusdiroverride
msgid "Directory to be used as a basedirectory."
msgstr ""
#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Identifikátor jazyka Lazarus (napr. en, de, sk)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Meno jazyka Lazarus (napr. english, slovak)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [voľby] <meno-suboru-projektu>"
#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr ""
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE "
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Vybudovať viac"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Spoločné nastavenia"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Potvrdiť pred vybudovaním"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definície"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Upraviť definície"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisovania súboru"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild nie je interaktívny, ruším."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Normálne IDE"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Optimalizované IDE"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Voľby:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Profil na vybudovanie"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Premenovať profil"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nové meno pre profil:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Reštartovať po vybudovaní IDE"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Zobraziť voľby a definície pre príkazový riadok"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cieľový CPU:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cieľový adresár:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Cieľový OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "Nemožno zapísať súbor \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aktualizovať revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Vyčistiť + Vybudovať všetko"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr ""
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Typ LCL Widgetu"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Pridať odkaz k zdedeným"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Kopírovať zo zdedených"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Presunúť položky do zdedených"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Jednotku %s nevlastní žiadny balíček alebo projekt.%sProsím pridajte jednotku do balíčka alebo projektu.%sNemožno vytvoriť súbor fpdoc."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Vľavo"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Ľavý·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vľavo od prvku."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ľavé ukotvenie"
#: lazarusidestrconsts.lisleftgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Vľavo"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·ľavej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Ľavé strany"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Rovnaká ľavá vzdialenosť"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Úrovne"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM súbor"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM súbor poškodený"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""
#: lazarusidestrconsts.lislgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<popis>%sCopyright (C) <rok> <meno autora> <kontakt>%sToto je slobodný program;môžete ho distribuovať a/alebo upravovať za podmienok GNU Library General Public License, tak ako ju zverejnila Free Software Foundation; buď verzie 2 Licencie alebo (podľa Vašej voľby) akejkoľvek novšej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "cesta knižnice"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr ""
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Odkaz:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "voľby spojovacieho programu"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Cieľ linkovania"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""
#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "Načítanie %s zlyhalo."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr "Maximalizovať kompatibilitu projektových súborov (LPI a LPS)"
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr ""
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr ""
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr ""
#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr ""
#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Zadajte dáta"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Zadajte parametre spustenia"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Hlavná jednotka má v sekcii Uses všetky jednotky projektu"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Hlavná jednotka je zdrojový kód Pascalu"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr ""
#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr ""
#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Aktuálny"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Urobiť spustiteľné"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make nenájdený"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Vytvoriť ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Pripojiť k výberu"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format, fuzzy, badformat
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s už existuje.%sProsím zvoľte iné meno.%sPoužite Ignorovať pre jeho pridanie."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Voľby konverzie"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Vlastný identifikátor"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Dĺžka identifikátora:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Predpona identifikátora:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Vložiť podľa abecedy"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Vložiť v závislosti na kontexte"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Neplatný výber ResourceString"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Prosím zvoľte sekciu resourcestring zo zoznamu."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "ResourceString už existuje"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Výber ResourceString:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Ukážka zdrojového kódu"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Reťazcová knštanta v zdrojovom kóde"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Reťazce s rovnakou hodnotou:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr ""
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr ""
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr ""
#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr ""
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Zrušiť budovanie"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "O FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Pridať &bod prerušenia"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Pridať aktívny súbor do balíčka ..."
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Pridať bod skoku do histórie"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Pridať editovaný súbor do projektu"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Pridať &pozorovanie ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Zalomiť riadky vo výbere"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Vybudovať súbor"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Vybudovať Lazarus s aktuálnym profilom"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Vybudovať Lazarus s profilom: %s"
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "Skontrolovať súbor LFM v editore"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Vyčistiť adresár ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Vyčistiť a vybudovať ..."
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Zatvoriť projekt"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Editor definícií CodeTools ..."
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Zakomentovať výber"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Porovnať súbory ..."
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Dokončovanie kódu"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Dokončovanie kódu (s dialógom)"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Konfigurovať budovanie + Spustiť súbor ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "Konfigurovať voliteľné komponenty ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Konfigurovať externé nástroje ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Konfigurovať \"Vybudovanie Lazarusu\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextovo závislá pomoc"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Konvertovať Delphi balíček na Lazarus balíček ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Konvertovať Delphi projekt na Lazarus projekt ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Konvertovať Delphi jednotku na Lazarus jednotku ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to LFM ..."
msgstr "Konvertovať binárny DFM na LFM ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Konvertovať kódovanie projektov/balíčkov ..."
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Okná ladenia"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Delphi konverzia"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Upraviť"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Šablóny kódu ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Upraviť kontextovo závislú pomoc"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Inštalovať/Odinštalovať balíčky ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Pridať novú položku nad vybratú položku"
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Pridať novú položku za vybratú položku"
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Pridať novú položku pred vybratú položku"
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Pridať novú položku pod vybratú položku"
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Pridať podmenu napravo od vybratej položky"
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Pridať podmenu pod vybratú položku"
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "Pridať zo šablóny ..."
#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "Prid&ať novú položku nad"
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Pridať novú položku za"
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "Prid&ať novú položku pred"
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Pridať &novú položku pod"
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Pridať obsluhu &OnClick"
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Pridať oddeľovač &za"
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Pridať oddeľovač &pred"
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Pridať podmenu"
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Pridať &podmenu pod"
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Pridať &podmenu vpravo"
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr "Položky s titulkami: %s"
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr "Najhlbšie vnorená úroveň menu: %s"
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "Zmazať položku"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "Zmazať šablónu menu ..."
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Zmazať uloženú šablónu menu"
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "Upraviť titulok"
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""
#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Akcie položky menu"
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Posunúť položku nadol"
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "Posunúť položku doľava"
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Posunúť položku doprava"
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "&Posunúť položku nahor"
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Presunúť vybratú položku nadol"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Presunúť vybranú položku doľava"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Presunúť vybranú položku doprava"
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Presunúť vybratú položku nahor"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""
#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "Odst&rániť všetky oddeľovače"
#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Uložené šablóny"
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "Uložiť menu ako šablónu ..."
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Uložiť menu ako šablónu"
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr "Oddelovače"
#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr "Položky so skratkami: %s"
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Klávesové skratky"
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Klávesové skratky"
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Popis šablóny:"
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "Šablóny"
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Uzavrieť do $IFDEF ..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Uzavrieť výber ..."
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Vyhodnotiť/Upraviť ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Oddeliť procedúru ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Súbor"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Nájsť"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Nájsť ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Nájsť zodpovedajúci koniec bloku kódu"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Nájsť začiatok bloku kódu"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Nájsť deklaráciu na kurzore"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Nájsť odkazy na identifikátor ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Nájsť v &súboroch ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Ná&jsť ďalší"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Nájsť &predchádzajúci"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Nájsť odkazy na použitú jednotku"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Voľby prostredia ..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Choď na direktívu include"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Choď na riadok ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Odhadnúť zle umiestnený IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Odhadnúť neuzavretý blok"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Pomoc"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "IDE interné"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Narastajúce hľadanie"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Zväčšiť odsadenie výberu"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "Položka ChangeLog"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Vložiť z mapy znakov ..."
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Vložiť kľúčové slovo CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Aktuálny dátum a čas"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Vložiť celé meno súboru ..."
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Vložiť všeobecné"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "GPL vyhlásenie"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "LGPL vyhlásenie"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "MIT vyhlásenie"
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Meno aktuálneho používateľa"
#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Skontrolovať ..."
#: lazarusidestrconsts.lismenujumpback
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Skoč späť"
#: lazarusidestrconsts.lismenujumpforward
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Skoč dopredu"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Skoč na"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Skoč na Implementation"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Skoč na Implementation uses"
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Skoč na Initialization"
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Skoč na Interface"
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Skoč na Interface uses"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Skoč na ďalšiu záložku"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Skoč na ďalšiu chybu"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Skoč na predchádzajúcu záložku"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Skoč na predchádzajúcu chybu"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Skoč na hlavičku procedúry"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Výber na malé písmená"
#: lazarusidestrconsts.lismenumacrolistview
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr "Makrá editora"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Vytvoriť ResourceString ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Viac-Vložiť ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nový komponent"
#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr "Nový %s"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nový formulár"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nový ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Nový balíček ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nový projekt ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Nový projekt zo súboru ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nová jednotka"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online pomoc"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Otvoriť ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Otvoriť meno súboru na pozícii kurzora"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Otvoriť priečinok ..."
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Otvoriť načítaný balíček ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Otvoriť súbor balíčka (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Otvoriť balíček aktuálnej jednotky"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Otvoriť projekt ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Otvoriť &nedávne"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Otvoriť nedávny balíček"
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Otvoriť nedávny projekt"
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Otvoriť jednotku ..."
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "&Balíček"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Graf balíčkov"
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Odkazy balíčka ..."
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Vložiť zo schránky"
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Zoznam procedúr ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inšpektor projektu"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Voľby projektu ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Spustiť"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikovať projekt ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Rýchly preklad"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Rýchla kontrola syntaxe"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Rýchla kontrola syntaxe OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Odstrániť z projektu ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Premenovať identifikátor ..."
#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr ""
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Hlásenie chyby"
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Znovu uložiť formuláre s povoleným i18n"
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Znova prezrieť zdrojové kódy FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Reštartovať debuger"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Obnoviť"
#: lazarusidestrconsts.lismenurevertconfirm
#, object-pascal-format
msgid ""
"Discard all unsaved changes in\n"
"\"%s\"?\n"
"\n"
"This action cannot be undone and will affect all editor tabs with the file."
msgstr ""
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Spustiť"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Spustiť súbor"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "&Parametre spustenia ..."
#: lazarusidestrconsts.lismenuruntocursor
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Spustiť po kurzor"
#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr ""
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Spustiť bez ladenia"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Uložiť"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Uložiť &ako ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Uložiť projekt"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Uložiť projekt ako ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Hľadať"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Vybrať"
#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Vybrať všetko"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Vybrať blok kódu"
#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Vybrať riadok"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Vybrať odsek"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Vybrať po zátvorku"
#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Vybrať slovo"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Nastav voľnú záložku"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr ""
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Zoradiť výber ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "Zdr&oj"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Zmena veľkosti písmen vo výbere"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Tabulátory na medzery vo výbere"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "O"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Prepnúť komentár vo výbere"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Nástroje"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Odkomentovať výber"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Zmenšiť odsadenie výberu"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Výber na veľké písmená"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Pridať jednotku do sekcie Uses ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Zobraziť"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Editor ukotvenia"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Prehliadač kódu"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Prieskumník kódu"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Paleta komponentov"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenty"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Záznam udalostí"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Výstup ladenia"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Formuláre ..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "História"
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "História skokov"
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Lokálne premenné"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Správy"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inšpektor objektov"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Zobraziť zdrojový kód projektu"
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registre"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Prehliadač obmedzení"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Výsledky hľadania"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Poradie tabulátora"
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Vlákna"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Prepnúť formulár/jednotka"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Závislosti jednotky"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Zobraziť informácie o jednotke ..."
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Jednotky ..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Pozorovania"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Čo potrebuje vybudovanie"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Okno"
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Ostatné karty"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor správ"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Okno správ"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Nenájdená metóda triedy"
#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Chýbajúce udalosti"
#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Chýbajúce identifikátory"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Chýbajúce balíčky"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Len pre Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Leave these units in uses sections as they are."
msgstr ""
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""
#: lazarusidestrconsts.lismissingunitsskip
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr "Preskočiť"
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Vytvoriť novú skupinu volieb"
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format
msgid "expected \":=\" after macro name but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format
msgid "expected macro name but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Presuň vybratú položku nadol"
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Presuň vybratú položku nahor"
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Nový cieľ"
#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Uložené v IDE (environmentoptions.xml)"
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Uložené v projekte (.lpi)"
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Uložené v relácii projektu (.lps)"
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Ciele: "
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""
#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", Režim: %s"
#: lazarusidestrconsts.lismodifiedlgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
#| "\n"
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr "<description>%sCopyright (C) <year> <meno autora> <contact>%sTáto knižnica je slobodný softvér; môžete ju distribuovať a/alebo upravovať podľa ustanovení GNU Library General Public License tak ako ju zverenila Free Software Foundation; buď verzie 2 Licencie alebo (podľa vašej voľby) akoukoľvek novšej verzie s nasledujúcimi úpravami:%sAko špeciálny výnimka, vlastníci autorského práva tejto knižnice Vám dovoľujú prepojiť túto knižnicu s nezávislými modulmi za účelom vytvorenia programov, pričom nezávisí na licencii týchto nezávislých modulov, a kopírovať a distribuovať výsledné programy za podmienok poskytnutých podľa Vášho rozhodnutia, ktoré sa môžu líšiť pre každý nezávislý modul. Nezávislý modul je modul, ktorý nie je odvodený alebo založený na tejto knižnici. Ak upravujete túto knižnicu, môžete rozšíriť túto výnimku pre svoju verziu knižnice, ale nie je to vaša povinnosť. Ak to nechcete urobiť, zmažte túto výnimku zo svojej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Viac"
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Viac"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr ""
#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr ""
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr ""
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr ""
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Presunúť \"%s\" o jednu pozíciu nadol"
#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Presunúť \"%s\" o jednu pozíciu nahor"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Presunúť stránku"
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr ""
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr ""
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Viac-Vložiť"
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "Voľby vloženia"
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "Ukážka"
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Text za každým riadkom"
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Text pred každým riadkom"
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "Orezať obsah schránky"
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr ""
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr ""
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Uložiť správy do súboru (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Meno"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Konflikt mena"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Meno aktívneho režimu vybudovania"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Meno novej procedúry"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nový"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nová trieda"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nová konzolová aplikácia"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Vytvoriť novú súbor editora.%sZvoľte typ."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Vytvoriť nový prázdny textový súbor."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Vytvoriť nový projekt.%sZvoľte typ."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Vytvoriť nový štandardný balíček.%sBalíček je kolekcia jednotiek ak omponentov."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Vytvoriť novú jednotku s dátovým modulom."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Vytvoriť novú jednotku s rámcom."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Vytvoriť novú jednotku s formulárom LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr ""
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nezvolená položka"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Prosím, najprv vyberte položku."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nové kódovanie:"
#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Makro %d"
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Nová stránka"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nový projekt)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr ""
#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr ""
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Bez záložných súborov"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Bez zmeny"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nie je vybratý kód"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Žiadne zdedené voľby prekladača."
#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr ""
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nie je vybrané okno IDE"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "bez mena"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr ""
#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "nie je vybratý žiadny uzol"
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr ""
#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr ""
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nenájdená sekcia ResourceString"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Filter je zvyčajne regulárny výraz. Pri Jednoduchej syntaxi je 'a' normálny znak, '*' vystupuje ako čokoľvek, '?' nahrádza jeden znak a čiarka a bodkočiarka oddeľujú možnosti. Napríklad: Jednoduchá syntax *.pas;*.pp korešponduje s ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenájdená reťazcová premenná"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""
#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr ""
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Dole"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Vľavo"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Hore"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy FreePascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr ""
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nie teraz"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Vytvoriť nový projekt"
#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Počet konvertovaných súborov: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - predvolené"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "cesta objektov"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""
#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr ""
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "Trieda \"%s\" nenájdená."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automaticky inštalovaný dynamicky"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "automaticky inštalovaný staticky"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Popis: "
#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription: %s"
msgstr "%sPopis: %s"
#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename: %s"
msgstr "Meno súboru: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "inštalovaný dynamicky"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "inštalovaný staticky"
#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense: %s"
msgstr ""
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "chýbajúci"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "zmenený"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Otvoriť načítaný balíček"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Meno balíčka"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Prosím, vyberte balíček"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "len na čítanie"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Stav"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format, fuzzy
#| msgid "%sThis package is installed, but the lpk file was not found"
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sTento balíček je nainštalovaný, ale nebol nájdený súbor lpk"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Stará trieda"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr ""
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr ""
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr ""
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hľadať iba celé slová"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Otvoriť"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Otvoriť ako súbor XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Otvoriť existujúci súbor"
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Otvoriť súbor"
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Otvoriť súbor"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Otvoriť súbor na pozícii kurzora"
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr ""
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr ""
#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Otvoriť %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Otvoriť balíček?"
#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "Otvoriť balíček %s"
#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr ""
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Otvoriť súbor balíčka"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Otvoriť projekt?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Otvoriť projekt"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Znova otvoriť projekt"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Otvoriť súbor projektu"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Otvoriť súbor ako bežný zdrojový kód"
#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format, fuzzy
#| msgid "Open the package %s?"
msgid ""
"Open the package \"%s\"?\n"
"\n"
"The \"Package\" menu has separate commands for opening packages and a list of recent ones."
msgstr "Otvoriť balíček %s?"
#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format, fuzzy
#| msgid "Open the project %s?"
msgid ""
"Open the project \"%s\"?\n"
"\n"
"The \"Project\" menu has separate commands for opening projects and a list of recent ones."
msgstr "Otvoriť projekt %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr ""
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr ""
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Voľby"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""
#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ""
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr ""
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr ""
#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
#, fuzzy
#| msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Prepísať jazyk. Napríklad --language=de. Pre možné hodnoty pozrite súbory v adresári languages."
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr ""
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, fuzzy
#| msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr "%sprepíše predvolený prekladač. napr. ppc386 ppcx64 ppcppc atď. predvolené je uložené v environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "Override the project or IDE build mode."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr "%sprepisuje CPU projektu. napr. i386 x86_64 powerpc powerpc_64 atď. predvolené: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr "%sprepisuje operačný systém projektu. napr. win32 linux. predvolené: %s"
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectwidgetsetegdefault
#, object-pascal-format
msgid "Override the project widgetset. For example: %s. Default: %s."
msgstr ""
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Balíček"
#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "balíček %s"
#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", balíček %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Informácie o balíčku"
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr ""
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Meno balíčka začína s ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Meno balíčka obsahuje ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Balíček potrebuje inštaláciu"
#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr ""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Výstupné adresáre balíčka"
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Zdrojové adresáre balíčka"
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""
#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr ""
#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr ""
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""
#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Parsery:"
#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr ""
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Vložiť zo schránky."
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Cesta"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Prezerať"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Zmazať neplatné cesty"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Posunúť cestu dole (Ctrl+Down)"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Posunúť cestu hore (Ctrl+Up)"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Cesty šablón"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Prehľadávané cesty:"
#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr ""
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Prerušiť"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Pridať súbory zo systému súborov"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Pridať do projektu"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Použiť zmeny"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr ""
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Volá procedúru %sRegister%s zvolenej jednotky"
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr ""
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Vyčistiť závislosti ..."
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr ""
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Preložiť všetko?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Preložiť balíček"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Vytvoriť Makefile"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Upraviť všeobecné voľby"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Vlastnosti súboru"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Inštalovať"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Neplatná maximálna verzia"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Neplatná minimálna verzia"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximálna verzia:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimálna verzia:"
#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Zmenené: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Posunúť závislosť dole"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Posunúť závislosť hore"
#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr ""
#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Balíček %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "Package %s%s%s has changed.%sSave package?"
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Balíček %s%s%s bol zmenený.%sUložiť balíček?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "balíček %s neuložený"
#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Stránka: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Znova pridať závislosť"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Znova pridať súbor"
#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Len na čítanie: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Znova preložiť všetky vyžadované"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Vyčistiť a znova preložiť"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Znova preložiť tento a všetky vyžadované balíčky?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrované pluginy"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registrovať jednotku"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Odstrániť závislosť"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Odstrániť závislosť \"%s\"%sz balíčka \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Odstránené vyžadované balíčky"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Odstrániť súbor"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Odstrániť súbor?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Odstrániť súbor \"%s\"%sz balíčka \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Odstrániť zvolenú položku"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Vyžadované balíčky"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Uložiť balíček"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format, fuzzy, badformat
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maximálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format, fuzzy, badformat
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Odinštalovať"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Zobraziť zdrojový kód balíčka"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Nainštalované"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Inštalovať pri ďalšom štarte"
#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sStav: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Odinštalovať pri ďalšom štarte (pokiaľ to nepotrebuje nainštalovaný balíček)"
#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Odinštalovať balíček %s"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Pridať voľby k závislostiam balíčkov a projektov"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Pridať cesty k závislým balíčkom/projektom"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Autor"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automaticky prebudovať, keď je to potrebné"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automaticky prebudovať, pri prebudovaní všetkého"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Vlastné"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "Popis/Zhrnutie"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Doba návrhu i spustenia"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrácia IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Zahrnúť"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Neplatný typ balíčka"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Knižnica"
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licencia"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Spojovací program"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Hlavná"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Manuálny preklad (nikdy automaticky)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Nižšia"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objekt"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Typ balíčka"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Poskytuje"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Vydanie"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Balíček %s%s%s má nastavený príznak autoinštalácie.%sTo znamená, že bude inštalovaný v IDE. Inštalačné balíčky %smusia byť balíčkami doby návrhu."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Tento balíček poskytuje to isté ako balíčky:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Aktualizovať / Prebudovať"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Použitie"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Balíček:"
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Zrušiť"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Postup"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr ""
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Nájdený konflikt"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Upraviť virtuálnu jednotku"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr ""
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Meno súboru:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Opraviť veľkosť písmen"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Neplatné meno jednotky"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Neplatné meno jednotky"
#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr ""
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr ""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr ""
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Odstrániť súbory"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr ""
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Uložiť balíček ako ..."
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Zobraziť hierarchiu adresárov"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Zobraziť chýbajúce súbory"
#: lazarusidestrconsts.lispeshowpropspanel
msgid "Show properties panel"
msgstr ""
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Zoradiť súbory natrvalo"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Zoradiť súbory podľa abecedy"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr ""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Meno jednotky:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr ""
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr ""
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Naozaj chcete zahodiť všetky zmeny balíčka %s a znova načítať súbor?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nová jednotka nie je v ceste jednotiek"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikovať balíček"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Obnoviť balíček?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Súbor \"%s\"%smomentálne nie je v ceste k jednotke balíčka.%sPridať \"%s\" do cesty k jednotke?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sPridanie novej závislosti projektu %s: balíček %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Nájdená nejednoznačné jednotky"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaticky inštalované balíčky"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sOba balíčky sú spojené. To znamená, že jeden balíček používa druhý alebo sú oba použité tretím balíčkom."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Porušená závislosť"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Zmazať súbor starého balíčka?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "Zmazať starý súbor balíčka \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Závislosť bez vlastníka: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Chyba čítania balíčka"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Chyba zápisu balíčka"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Súbor už v balíčku existuje"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Súbor je v projekte"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Meno súboru je iné ako z mena balíčka"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Meno súboru je použité iným balíčkom"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Meno súboru je použité projektom"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Súbor \"%s\" nenájdený."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Súbor neuložený"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíček:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíčky:"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Neplatná prípona súboru"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Neplatná prípona súboru balíčka"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Neplatné meno súboru balíčka"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Neplatné meno balíčka"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Neplatné meno balíčka"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Načítanie balíčka %s nahradí balíček %s%szo súboru %s.%sStarý balíček je zmenený.%sUložiť starý balíček %s?"
#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Balíček: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Konflikty balíčka"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "Balíček nie je pre dobu návrhu"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Balíček je vyžadovaný"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Meno balíčka už existuje"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Balíčky musia mať príponu .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Prosím, uložte súbor pred jeho pridaním do balíčka."
#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Projekt: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Prebudovať Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "Nahradiť existujúci súbor \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Nahradiť súbor"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Uložiť balíček?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Uložiť balíček %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Má byť súbor premenovaný malými písmenami na %s\"%s\"?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Preskočiť tento balíček"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Súbor \"%s\"%suž je v balíčku %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Súbor \"%s\" nie je balíček Lazarusu."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format, fuzzy, badformat
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Meno súboru %s%s%s nesúhlasí s menom balíčka %s%s%s v súbore.%sZmeňte menobalíčka na %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Meno súboru %s%s%s je časťou aktuálneho projektu.%sProjekty a balíčky nemôžu zdieľať súbory."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format, fuzzy, badformat
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Meno súboru %s%s%s je použité %sbalíčka %s%s%s%sv súbore %s%s%s."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format, fuzzy, badformat
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sNasledujúce jednotky budú pridané do sekcie uses %s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format, fuzzy, badformat
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Meno súboru balíčka %s%s%s v%s%s%s%s nie je platné meno balíčka Lazarus."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format, fuzzy
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Balíček %s je balíčkom len pre dobu behu. %sBalíčky len pre dobu behu nemožno inštalovať do IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format, fuzzy, badformat
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Balíček %s%s%s je označený na inštaláciu, ale nádá sa nájsť.%sOdstrániť závislosť zo zoznamu inštalovaných balíčkov?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format, fuzzy
#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Balíček %s je vyžadovaný balíčkom %s, ktorý je označený pre inštaláciu.%sViz graf balíčkov."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format, fuzzy, badformat
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Meno balíčka %s%s%s nie je platným menom balíčka%sProsím zvoľte iné meno (napr. balicek1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format, fuzzy, badformat
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Meno balíčka %s%s%s %ssúboru %s%s%s je neplatné."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Balíček \"%s\" bol označený.%sMomentálne Lazarus podporuje len staticky pripojené balíčky, preto odinštalácia vyžaduje prebudovanie a reštart Lazarusu.%sChcete teraz prebudovať Lazarus?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Balíček \"%s\" bol označený na inštaláciu.%sMomentálne Lazarus podporuje len staticky pripojené balíčky, preto inštalácia vyžaduje prebudovanie a reštart Lazarus.%sChcete teraz prebudovať Lazarus?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format, fuzzy, badformat
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt vyžaduje balíček %s%s%s.%sAle tento nebol nájdený. Pozrite Projekt -> Inšpektor projektu."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format, fuzzy, badformat
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Existujú dve jednotky s rovnakým menom:%s%s1. %s%s%s z %s%s2. %s%s%s z %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Existuje jednotka FPC s rovnakým menom ako balíček:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Už existuje jednotka FPC s rovnakým menom ako %s%s%s%s%s z %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Balíček so zvoleným menom %s%s%s.%suž existuje. Konfliktný balíček: %s%s%s%sSúbor: %s%s%s."
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Balíček %s%s%s načítaný %szo súboru %s%s%s už existuje.%sPozrite Balíček -> Graf balíčkov .%sNahradenie nie je možné."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Medzi vyžadovanými balíčkami sú neuloýené balíčky. Pozrite graf balíčkov."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Už existuje jednotka s rovnakým enom ako blíček:%s%s1. %s%s%s z %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Toto je virtuálny balíček. Zatiaľ nemá zdrojový kód. Prosím najprv uložte balíček."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Nemožno vytvoriť cieľový adresár pre Lazarus:%s%s%s%s.%sTento adresár je potebný pre nové, zmenené Lazarus IDE s vašimi balíčkami."
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Nemožno zapísať balíček %s%s%s%sdo súboru %s%s%s.%sChyba: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Odinštalovať balíček?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Odinštalovať balíček %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Neuložený balíček"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Použiť jednotku"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Upozornenie: Súbor \"%s\"%spatrí do aktuálneho projektu."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "ponechať"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nový"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "odstrániť"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Tento súbor nepatrí do žiadneho načítaneho balíčka."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Nemožno čítať súbor balíčka \"%s\".%sChyba: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Prehrať"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Globálne"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Odkazy balíčkov"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr ""
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr ""
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Používateľ"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr ""
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Prosím pred spustením otvorte jednotku."
#: lazarusidestrconsts.lispleaseplacetheeditorcaretonanidentifierifthisisane
msgid "Please place the editor caret on an identifier. If this is a new unit, please save the file first."
msgstr ""
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Všetko>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Zmeniť font"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Kopírovať meno metódy do schránky"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrovanie s porovnávaním akejkoľvek časti metódy"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrovanie s porovnávaním začiatku metódy"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Skoč na výber"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nič>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objekty"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Neukladať žiadne informácie o relácii"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Uložiť do súboru .lps v konfiguračnom adresári IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Uložiť do súboru .lps"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Uložiť do súboru .lps v adresári projektu"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Informácie o relácii uložiť v"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ""
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr ""
#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr ""
#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr ""
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format, fuzzy, badformat
#| msgid "primary config directory, where Lazarus stores its config files. Default is "
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "hlavný konfiguračný adresár, kde Lazarus uchováva svoje konfiguračné súbory. Predvolené je "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Priorita"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Súkromné (private)"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Súkromná metóda"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format, fuzzy, badformat
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Pred pokračovaním asi bude potrebné nainštalovať niektoré balíčky .%s%sUpozornenie:%sProjekt závisí na niektorých balíčkoch, ktoré obsahujú jednotky s procedúrou Register. Procedúra Register je bežne používaná na inštaláciu komponentov v IDE, ale nasledujúce jednotky vyzerajú akoby patrili do balíčkov, ktoré zatiaľ v IDE nainštalované nie sú. Ak sa pokúsite otvoriť v IDE formulár, ktorý používa takéto komponenty, dostanete chyby o chýbajúcich komponentoch a načítanie formulára môže vyvolať neočakávané správanie.%s%sToto nemá vplyv na otváranie súborov projektu alebo jeho zdrojových kódov.%s%sZnamená to len, že nie je dobrý nápad otvárať formulár v návrhovom zobrazení pred nainštalovaní chýbajúcich balíčkov.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedúra"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedúra s rozhraním"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program zistený"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Zdrojový kód programu musí mať príponu Pascalu ako .pas, .pp or .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Závislosť už existuje"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Pridať editované súbory"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Neplatná Min-Max verzia"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Neplatná verzia"
#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximálna Verzia (voliteľné):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimálna verzia (voliteľné)"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr ""
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nový vyžadovaný"
#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr ""
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Meno balíčka:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Balíček nenájdený"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr ""
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Závislosť \"%s\" nebola nájdená.%sProsím zvoľte existujúci balíček."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Maximálna verzia \"%s\" je neplatná.%sProsím použite formát major.minor.release.build%sNapríklad: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximálna verzia je nižšia ako Minimálna."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Minimálna·verzia·\"%s\"·je·neplatná.%sProsím·použite·formát major.minor.release.build%sNapríklad: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Projekt už má závislosť pre balíček \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Meno jednotky %s%s%s už v projekte existuje %sso súborom: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Meno jednotky %s%s%s už existuje vo výbere%sso súborom: %s%s%s."
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Meno jednotky už existuje"
#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Projekt %s"
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Projekt: "
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "projekt"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt zmenený"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Adresár projektu"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Meno súboru projektu"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Cesta k include projektu"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Informačný súbor projektu zistený"
#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt je spustiteľný"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr ""
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Projekt"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Vlastnosti Makier projektu"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Výstupný adresár projektu"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Zdrojové adresáre projektu"
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Cesta k zdrojovým kódom projektu"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Cesta k jednotkám projektu"
#: lazarusidestrconsts.lisprojectver
msgid "Project version"
msgstr ""
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Sprievodca projektom"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potvrďte zmazanie závislosti"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Zmazať závislosť pre %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Inšpektor projektu - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Odstránené vyžadované balíčky"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Odstrániť súbor %s z projektu?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr ""
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Vždy vybudovať (aj keď nezmenené)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Nemožno zmeniť zoznam automaticky vytváraných formulárov v zdrojovom kóde programu.%sNajprv opravte chyby."
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Opýtať sa na hodnotu"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""
#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr ""
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Chránené (protected)"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Chránená metóda"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Verejná metóda"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Zverejnená metóda"
#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr ""
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr ""
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Publikovať adresár projektu"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Publikovať projekt"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Uložiť .lrs súbory vo výstupnom adresári"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Upraviť virtuálnu jednotku"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Už existuje jednotka s týmto menom.%sSúbor: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Meno jednotky nie je platný identifikátor Pascalu."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Konvertovať &Delphi projekt"
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Nový projekt"
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "&Otvoriť projekt"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Otvo&riť nedávny projekt"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Zobraziť vzorové projekty"
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr ""
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Ukončiť"
#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "U&končiť Lazarus"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Skutočne odstrániť?"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Nedávne karty"
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Záznam"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Zaznamenané"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Znova"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Regulárny výraz"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr ""
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Odstrániť"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Odstrániť?"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Odstrániť všetky neplatné vlastnosti"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr ""
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Odstrániť všetky jednotky"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr ""
#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "Odstrániť %s súborov z balíčka \"%s\"?"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Odstrániť z projektu"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr ""
#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Odstrániť zvolené jednotky"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Odstrániť ich"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr ""
#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Premenovať"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Premenovať ..."
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Premenovať súbor?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Premenovanie súboru zlyhalo"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Zobraziť zoznam premenovaných identifikátorov"
#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Premenovať na %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Premenovať na malé písmená"
#: lazarusidestrconsts.lisrenamingaborted
msgid "Renaming aborted"
msgstr ""
#: lazarusidestrconsts.lisrenamingconflict
msgid "Renaming conflict"
msgstr ""
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Znova otvoriť projekt"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Znova otvoriť s iným kódovaním"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Opakovať"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Nahradiť"
#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Nahradiť celý identifikátor"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Nahradenie výberu zlyhalo."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/sk"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""
#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Chyba uloženia resource"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr ""
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Reštartovať"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Výsledok:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation"
msgstr ""
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Obnovenie zlyhalo"
#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr "Revízia: "
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Pravé ukotvenie"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Pravý okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vprav od prvku."
#: lazarusidestrconsts.lisrightgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·pravej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Pravé strany"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Rovnaká pravá vzdialenosť"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Spustiť"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Súbor nie je spustiteľný"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format, fuzzy, badformat
#| msgid "The host application %s%s%s is not executable."
msgid "The host application \"%s\" is not executable."
msgstr "Hostiteľská aplikácia %s%s%s nie je spustiteľná."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Spustiť"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Spustiť po zlyhané"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
#, fuzzy
#| msgid "Abstract methods - not yet overridden"
msgid "Abstract Methods - not yet overridden"
msgstr "Abstraktné metódy - zatiaľ neprepísané"
#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "Abstraktné metódy %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Kurzor nie je v definícii triedy"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE pracuje"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s je abstraktná trieda a má %s abstraktných metód."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Abstraktné metódy nenájdené"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Nahradiť všetky vybraté"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Nahradiť prvý vybratý"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Nič vybraté"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existuje %s abstraktných metód, ktoré možno prepípsať.%sZvoľte metódy, pre ktoré majú byť vytvorené kostry:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Neexistujú abstraktné metódy na prepísanie."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Táto metóda nemôže byť prepísaná, pretože je definovaná v aktuálnej triede"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nemožno zobraziť abstraktné metódy tejto triedy, pretože"
#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Uložiť"
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Uložiť všetko"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Uložiť všetky začiarknuté"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Uložiť všetky zmenené súbory"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissaveandexitdialog
#, fuzzy
#| msgid "Save and exit dialog"
msgid "Only Save"
msgstr "Uložiť a skončiť dialóg"
#: lazarusidestrconsts.lissaveandrebuildide
#, fuzzy
#| msgid "Save and rebuild IDE"
msgid "Rebuild IDE"
msgstr "Uložiť a prebudovať IDE"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Uložiť zmenené súbory?"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Uložiť zmeny?"
#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Uložiť zmeny do projektu %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Uložiť aktuálny súbor editora"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Uložiť súbor \"%s\"%spred zatvorením formulára \"%s\"?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Uložiť makro ako"
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr ""
#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr ""
#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Uložiť informácie o skladaní"
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Uložiť históriu skokov"
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Uložiť nastavenia"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Uložiť "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr ""
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Mierka:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr ""
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr ""
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Skenovanie"
#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Prehľadávať cesty"
#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format, fuzzy, badformat
#| msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "druhý konfiguračný adresár, v ktorom Lazarus hľadá súbory konfigurácie šablón. Predvolený je "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Pozri správy."
#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sPozrite Projekt -> Inšpektor projektu"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Vyberte položku pomoci:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Zvoľte uzol"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
#, fuzzy
#| msgid "Select Delphi form files (*.dfm)"
msgid "Select Delphi form files (*.dfm|*.fmx)"
msgstr "Zvoľte súbory formulárov Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Vybratý"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr ""
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr ""
#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Vybrať súbor"
#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr ""
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Výber presahuje reťazcovú konštantu"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Nástroj výberu"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr ""
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Nastaviť predvolené"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Nastaviť predvolené odsadzovanie)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Krátky:"
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr ""
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr ""
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Zobraziť"
#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Zobraziť strom komponentov"
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Zobraziť rozdiely medzi režimami ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Zobraziť ikony pre"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Zobraziť gutter"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Zobraziť pomoc"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Zobraziť rady v Inšpektore objektov"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Zobraziť identifikátory"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Zobraziť informačný rámček"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr ""
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Zobraziť viacero riadkov"
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Zobraziť len zmenené"
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr ""
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Zobraziť výstup"
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Zobraziť balíčky"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr ""
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr "Zobraziť filter vlastností"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Zobraziť nedávno použité identifikátory na vrchu"
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr ""
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings."
msgstr ""
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Zobraziť špeciálne znaky"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Zobraziť stavový riadok"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Zobraziť jednotky"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr ""
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr ""
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Zobraziť nepoužité jednotky ..."
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""
#: lazarusidestrconsts.lisshowversionandexit
#, fuzzy
#| msgid "show version and exit"
msgid "Show version and exit."
msgstr "zobrazí verziu a skončí"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Skrátiť na najmenšie"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Súrodenec"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Jednoduchá syntax"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Preskočiť súbor"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Preskočiť súbor a pokračovať v načítaní"
#: lazarusidestrconsts.lisskiploadinglastproject
#, fuzzy
#| msgid "Skip loading last project"
msgid "Skip loading last project."
msgstr "Preskočiť otváranie posledného projektu"
#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr ""
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Skôr menší ako rýchlejší"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Vhovujúce"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Prepáčte, tento typ zatiaľ nie je implementovaný"
#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr ""
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr ""
#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr ""
#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr ""
#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Vzostupne"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Rozlišovať veľkosť písmen"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Zostupne"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Doména"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorovať medzery"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Riadky"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Voľby"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Odseky"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Ukážka"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Prijať"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Zoradiť výber"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Slová"
#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr ""
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "Adresár zdrojových kódov \"%s\" neexistuje."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Zdrojový kód zmenený"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Zdrojový kód stránky \"%s\" bol zmenený. Uložiť?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Cesty zdrojových kódov"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Rovnaká medzera"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Zdrojový OS"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Hľadanie"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Hľadaný text"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Začať nový projekt"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr ""
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Zastaviť"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Zastaviť aktuálne ladenie a prebudovať projekt?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zastaviť ladenie?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Zastaviť ladenie?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Zastaviť pri výnimke"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zastaviť ladenie?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Ukladať oddeľovače cesty \\ a / ako"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Chyba streamovania"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Podprocedúra"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Podprocedúra na rovnakej úrovni"
#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr ""
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Úspešné"
#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Úspešne exportované do \"%s\"."
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Úspešne importované z \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Navrhnúť predvolený názov nového súboru malými písmenami"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Neplatné meno premennej"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" nie je platný identifikátor."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Prepísať systémovú premennú"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr ""
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Mód syntaxe"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tabulátor"
#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Presunúť vybraný ovládací prvok nadol v poradí tabulátora"
#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "Poradie tabulátora pre %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Rekurzívne vypočítať poradie tabulátora pre podradené ovládacie prvky"
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "rekurzívne"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Vypočítať poradie tabulátora pre ovládacie prvky na základe ich X a Y polôh"
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Presunúť vybraný ovládací prvok nahor v poradí tabulátora"
#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "Karty pre %s"
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Cieľ:"
#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", Cieľ: %s"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Cieľový CPU"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Meno cieľového súboru: (-o, prázdne = použiť výstupný adresár jednotky)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Meno cieľového súboru (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Meno súboru cieľového projektu"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Cieľový OS"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr ""
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testovací adresár"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Testovacia URL"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr ""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format, fuzzy, badformat
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Trieda %s%s%s je TControl a môže byť vložená len do ovládacieho prvku.%sNemožno vložiť."
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format, fuzzy
#| msgid "The component %s can not be deleted, because it is not owned by %s."
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "Komponent %s nemožno zmazať, pretože nie je vlastnený %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format, fuzzy, badformat
#| msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "Editor komponentu triedy %s%s%s vytvoril chybu:%s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format, fuzzy, badformat
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "Editor komponentu triedy %s%s%s%svyvolaný príkazom #%s %s%s%s%svytvoril chybu:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Komponent %s je dedí od %s.%sPre zmazanie dedeného komponentu otvorte predka a zmažte ho tam."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr ""
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Konfigurácia bude znížená/konvertovaná."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr ""
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Debuger \"%s\"%sneexistuje alebo nie je spustiteľný.%sPozrite Nástroje -> Voľby prostredia -> Voľby debugera"
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format, fuzzy, badformat
#| msgid "The destination directory%s%s%s%s does not exist."
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Cieľový adresár %s%s%s%s neexistuje."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr ""
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format, fuzzy, badformat
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Adresár %s%s%s nie je viac potrebný v ceste jednotiek.%sOdstrániť ho?"
#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "Súbor \"%s\""
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Súbor \"%s\" nie je projekt Lazarusu.%sVytvoriť nový projekt pre tento súbor \"%s\"?"
#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Súbor \"%s\" vyzerá byť programom.%sZatvoriť aktuálny projekt a vytvoriť nový projekt Lazarusu z tohoto programu?%s\"Nie\" načíta súbor ako bežný zdrojový kód."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Súbor %s vyzerá byť programovým súborom existujúceho projektu Lazarus."
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Súbor \"%s\" nebol nájdený.%sChcete ho nájsť sám?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format, fuzzy, badformat
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Súbor %s%s%s%snebol nájdený.%sZvoľte Ignorovať pre pokračovanie v načítaní projektu,%sZvoľte Zrušiť pre zastavenie načítania."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format, fuzzy, badformat
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Nasledujúce metódy použité v %s nie sú v zdrojovom kóde%s%s%s%s%s%sOdstrániť tieto odkazy?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitproceedanyway
#, object-pascal-format
msgid "The identifier is a %s.%sNew file(s) will be created, old can be deleted.%sProceed anyway?"
msgstr ""
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format, fuzzy, badformat
#| msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "Kláves %s%sis už je priradený k %s.%s%sOdstrániť staré priradenie a priradiť kláves novej funkcii%s%s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format, fuzzy, badformat
#| msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "Program %s%spotrebný pre spustenie neexistuje alebo nie je spustiteľný.%sChcete ho vytvoriť?%s%sViz nastavenia v Projekt -> Voľby projektu -> Aplikácia."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format, fuzzy, badformat
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Spúšťacia aplikácia %s%s%s%sneexistuje alebo nie je spustiteľná.%s%sViz Spustiť -> Parametre spustenia -> Lokálne"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Súbor LFM (formulár Lazarus) obsahuje neplatné vlastnosti. To znamená, napríklad, že obsahuje nejaké vlastnosti/triedy, ktoré neexistujú v aktuálnom LCL. Štandardná oprava je odstrániť tieto vlastnosti z lfm a ručne opraviť kód Pascalu."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenamecontainsapascalkeyword
#, object-pascal-format
msgid "The name \"%s\" contains a Pascal keyword."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format, fuzzy
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Nová jednotka zatiaľ nie je v ceste hľadaní jednotiek.%sPridať adresár %s?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Stará konfigurácia bude aktualizovaná."
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "Výstupný adresár \"%s\" chýba."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Výstupný adresár %s je v zozname ciest hľadania include %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Výstupný adresár %s je v zdedenom zozname ciest hľadania include %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Výstupný adresár %s je v zozname zdedených ciest hľadania is jednotiek %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Výstupný adresár %s je v zozname ciest hľadania jednotiek%s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Výstupný adresár by mal byť samostatný adresár a nemal by obsahovať žiadne zdrojové súbory."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Balíček už obsahuje jednotku s takýmto menom."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr ""
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Program \"make\" nebol nájdený.%sTento nástroj je potrebný na prebudovanie Lazarusu."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr "Spustenie aplikácie s debugerom"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr "Táto voľba môže byť neskôr zmenená v Projekt -> Voľby projektu -> Voľby prekladača -> Ladenie."
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr "Spustiť bez debugera"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr ""
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr ""
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format, fuzzy, badformat
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Informačný súbor projektu %s%s%s%sje zhodný so záladným súborom zdrojového kódu!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr ""
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Pred vybudovaním musíte projekt uložiť%sAk ste nastavili testovací adresár vo voľbách prostredia,%smôžete vytvoriť nový projekt a vybudovať ho naraz.%sUložiť projekt?"
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr ""
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr ""
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr ""
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "V adresári sú iné súbory s rovnakým menom,%sktoré sa líšia len veľkosťou písmen:%s%s%sZmazať ich?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Na disku už je súbor s rovnakým menom a podobnou koncovkou%sSúbor: %s%sNeplatný súbor: %s%s%sZmazať neplatný súbor?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Režim vybudovania s týmto názvom už existuje."
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "Formulár s menom \"%s\" už existuje"
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format, fuzzy, badformat
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Jednotka s menom %s%s%suž existuje. Identifikátory Pascal musia byť unikátne."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format, fuzzy, badformat
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Jednotka s menom %s%s%s už v projekte existuje.%s"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Musí existovať aspoň jeden režim vybudovania."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format, fuzzy, badformat
#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Zdrojová trieda %s%s%s pochádza z %s%s%s. Možno je to preklep pre TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Pri zápise zvoleného komponentu nastala chyba %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Pri konvertovaní binárneho streamu zvoleného kompoenntu nastala chyba %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Pri kopírovaní streamu komponentu dos chránky nastala chyba:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "Koreňový komponent nemôže byť zmazaný."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Tieto súbory budú zmazané"
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Tieto nastavenia sú uložené v projekte."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr ""
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr ""
#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr ""
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Jednotka %s existuje dvakrát v ceste jednotiek %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Meno súboru jednotky \"%s\" nie je malými písmenami.%sPrekladač FreePascal nehľadá všetky veľkosti. Je odporúčané použiť mena súborov s malými písmenami.%sPremenovať súbor na malé písmená?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Jednotka samotná už má meno%s%s%s. Identifikátory Pascalu musia byť unikátne."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format, fuzzy, badformat
#| msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Cesta hľadania jednotiek %s%s%s obsahuje zdrojový adresár %s%s%s balíčka %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format, fuzzy, badformat
#| msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Pracovný adresár %s%s%s neexistuje.%sProsím skontrolujte pracovný adresár v Spustiť > Parametre spustenia."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""
#: lazarusidestrconsts.listhishelpmessage
#, fuzzy
#| msgid "this help message"
msgid "This help message."
msgstr "táto pomocná správa"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr ""
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Vyzerá to ako pascalovský súbor.%sOdporúčame v·mene použiť malé písmená, aby ste predišli problémom na niektorých súborových systémoch a rôznych prekladačoch.%sPremenovať na malé písmená?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tento príkaz nemôže byť vytiahnutý.%sProsím vyberte nejaký kód pre vytiahnutie procedúry/metódy."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr ""
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Nadpis"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr ""
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titulok (nechajte prázdne pre predvolený)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Cesty:"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""
#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr ""
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr ""
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr ""
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr ""
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listop
#, fuzzy
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Hore"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Horné ukotvenie"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Horný·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·nad·prvkom."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Horné okraje"
#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·hornej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Rovnaká horná medzera"
#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr ""
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr ""
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Ďalšie adresáre:"
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Všetky jednotky balíčkov"
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Všetky jednotky editora zdrojového kódu"
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Všetky jednotky"
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "Súbor: %s"
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projekty a balíčky"
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Skenovanie ..."
#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Skenovanie: %s jednotiek ..."
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Vybraté jednotky"
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Jednotky"
#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Jednotky: %s"
#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Túto správu už nezobrazovať."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Chyba v regulárnom výraze"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Font bez UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Choď na riadok:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nenájdené"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Nahradiť tento výskyt \"%s\"%s za \"%s\"?"
#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Hľadanie: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Pokračovať v hľadaní od začiatku?"
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Pokračovať v hľadaní od konca?"
#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "Hľadaný reťazec '%s' nenájdený!"
#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format, fuzzy
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Aktuálny font editora nepodporuje UTF-8, ale systém vyzerá, že ho používa.%sTo znamená, že ne ASCII znaky môžu byť zobrazené nesprávne.%sMôžete si vybrať iný font vo voľbách editora."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Vymazať vyrovnávaciu pamäť include"
#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s bajtov"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Vložil:"
#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "V projekte:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Riadky:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Meno:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nie"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Veľkosť:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "áno"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Zobraziť hodnoty CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Nemožno konvertovať binárny strom na text"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Nemožno kopírovať komponenty do schránky"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Nemožno pridať komentár hlavičky resource do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Nemožno pridať resource T%s:FORMDATA do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format, fuzzy
#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Do projektu nemožno pridať %s, pretože projekt už obsahuje jednotku s rovnakým menom."
#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Nemožno zálohovať súbor \"%s\" na \"%s\"!"
#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNemožno zmeniť triedu %s na %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nemožno vyčistiť cieľový adresár"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Nemožno vyčistiť \"%s\".%sProsím skontrolujte prístupové práva."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Nemožno konvertovať text komponentu do binárneho formátu:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Nemožno konvertovať súbor \"%s\"%sChyba: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Nemožno konvertovať textové dáta formulára súboru %s%s%s%s%sdo binárneho streamu. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Nemožno vytvoriť dočasný LFM buffer."
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Nemožno zmazať nejednoznačný súbor \"%s\""
#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to find a valid classname in %s%s%s"
msgid "Unable to find a valid classname in \"%s\""
msgstr "Nemožno nájsť platné meno triedy v %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "Nemožno nájsť súbor \"%s\"."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Nemožno nájsť súbor \"%s\".%sAk patrí do Vášho projektu, skontrolujte cestu hľadaní v %sProjekt->Voľby prekladača ...->Cesty ->Ostatné súbory jednotiek. Ak tento súbor patrí do balíčka, skontrolujte príslušné voľby prekladača balíčka. Ak tento súbor patrí do Lazarusu, overte vyčistenie prekladu. Ak súbor patrí do FPC, potom skontrolujte fpc.cfg. Ak si nie ste istí, použite Projekt ->Voľby prekladača ...-> Test"
#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "Nemožno nájsť %s v streame LFM."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr ""
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Nemožno získať zmeny editora."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Nemožno získať zdrojový kód pre návrhára."
#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Nemožno načítať triedu komponentu %s%s%s, pretože závisí sama na sebe."
#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Nemožno otvoriť predka komponentu"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Nemožno otvoriť návrhára.%sTrieda %s nie je potomkom triedy ako TForm alebo TDataModule."
#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "Nemožno čítať %s"
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Nemožno odstrániť starý záložný súbor \"%s\"!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format, fuzzy, badformat
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Nemožno premenovať poškodený súbor %s%s%s%sna %s%s%s"
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nemožno premenovať formulár v zdrojovom kóde."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nemožno premenovať metódu, prosím opravte chyby zobrazené v okne správ."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nemožno premenovať premennú v zdrojovom kóde."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Nemožno spustiť"
#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr "Nemožno spustiť \"%s\""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Nemožno nastaviť AnchorSide prvku"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr ""
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Nemožno streamovať vybraté komponenty"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Nemožno streamovať vybraté komponenty."
#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "Nemožno streamovať %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nemožno transformovať binárny stream komponentu %s:T%s na text."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nemožno vytvoriť príkaz CreateForm v zdrojovom kóde projektu"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Zrušiť začiarknutie všetkých"
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Vrátiť"
#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "Odinštalovať %s"
#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Odinštalovať výber"
#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr ""
#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr ""
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identifikátor jednotky existuje"
#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s jednotka %s v balíčku %s"
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr ""
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Meno jednotky už v projekte existuje"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Meno jednotky začína s ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Meno jednotky obsahuje ..."
#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Výstupný adresár jednotky"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "cesta jednotiek"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Cesty jednotiek"
#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr ""
#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "Nepoužité jednotky z %s"
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Up"
#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr "Aktualizovať príkazy Application.CreateForm v hlavnej jednotke"
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr "Aktualizovať príkaz Application.Scaled v hlavnej jednotke"
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr "Aktualizovať príkaz Application.Title v hlavnej jednotke"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Aktualizácia"
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Aktualizácia konfigurácie"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr ""
#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Správa o použití (voľba -h)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Použiť"
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Použiť ANSI reťazce"
#: lazarusidestrconsts.lisuseanyway
#, object-pascal-format
msgid "Use \"%s\" anyway"
msgstr ""
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Použiť začiarkavacie políčko pre boolovské hodnoty"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Použiť komentáre vo vlastných voľbách"
#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Použiť design-time balíčky"
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr ""
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr ""
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Použiť identifikátor"
#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "Použiť identifikátor %s v %s na %s"
#: lazarusidestrconsts.lisuseinstead
#, object-pascal-format
msgid "Use \"%s\" instead"
msgstr ""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Spúšťanie aplikácie"
#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "Použiť balíček %s v balíčku %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Použiť balíček v balíčku"
#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "Použiť balíček %s v projekte"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Použiť balíček v projekte"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Pridať do zoznamu \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Odstrániť zo zoznamu \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Domovský adresár používateľa"
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Pridať jednotku do sekcie Uses"
#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "Použiť jednotku %s v jednotke %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Hodnota%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Hodnota: "
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Hodnoty"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr ""
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Premenná"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Overiť volania metód"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Verzia"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Zvislo"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Kopírovať informácie o verzii do schránky"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr ""
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Zobraziť zdrojový kód (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ""
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr "Vitajte v Lazarus IDE %s"
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Vitajte v Lazarus IDE %s%sUž existuje konfigurácia z verzie %s v%s%s"
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Čo potrebuje vybudovanie"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Keď je jednotka premenovaná, aktualizovať referencie"
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr ""
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "S vyžadovanými balíčkami"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Slovo na kurzore aktuálneho editora"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Pracovný adresár pre budovanie"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Pracovný adresár pre spustenie"
#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
msgid "Write config instead of command line parameters"
msgstr ""
#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr ""
#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr ""
#: lazarusidestrconsts.liswritewhatpackagefilesares
msgid "Write what package files are searched and found."
msgstr ""
#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Nemôžete zmeniť režim vybudovania počas prekladu."
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr ""
#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Všetko>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor kódu"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr ""
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr ""
#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr ""
#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptlevels
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Úrovne"
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr ""
#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr ""
#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr ""
#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr ""
#: lazarusidestrconsts.lvlgraphsplitnone
#, fuzzy
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Nič"
#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr ""
#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr ""
#: lazarusidestrconsts.optdispgutterchanges
msgid "Changes"
msgstr ""
#: lazarusidestrconsts.optdispgutterfolding
msgid "Folding"
msgstr ""
#: lazarusidestrconsts.optdispguttermarks
msgid "Marks"
msgstr ""
#: lazarusidestrconsts.optdispgutternocurrentlinecolor
msgid "No current line color"
msgstr ""
#: lazarusidestrconsts.optdispgutterseparator
msgid "Separator"
msgstr ""
#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
msgid "Use current line color"
msgstr ""
#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
msgid "Use current line number color"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Pridať jednotku balíčka do sekcie uses"
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Pridať obrátene"
#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Atribúty"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Automaticky zvyšovať číslo vybudovania"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Zvyšuje sa pri každom zostavení projektu."
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "Vy&budovať:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Množina znakov:"
#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr "Zatvoriť všetky stránky"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
msgstr "Zatvoriť aktuálnu stránku (Ctrl+F4)∥(Ctrl+W)"
#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr "Zatvoriť stránky vľavo"
#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr ""
#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr "Zatvoriť stránky vpravo"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Podmienené definície"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Vytvoriť novú definíciu"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Zapnúť i18n"
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string (Ctrl+F)"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr ""
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Vylúčené"
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "Vynútiť aktualizáciu súborov PO pri ďalšom vybudovaní"
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Identifikátory:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Voľby i18n"
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Originály:"
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Zahrnúť informácie o verzii do spustiteľného súboru"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Voľby jazyka"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Výber jazyka:"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Hlavná verzia:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Vedľajšia verzia:"
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria (Ctrl+N)"
msgstr ""
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Ostatné informácie"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Výstupný adresár pre .po:"
#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search (F5)"
msgstr ""
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Zdroj"
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Zmazať všetky zdroje?"
#: lazarusidestrconsts.rsresourcefilename
msgctxt "lazarusidestrconsts.rsresourcefilename"
msgid "File name"
msgstr "Názov súboru"
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revízia:"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Vybrať zdedenú položku"
#: lazarusidestrconsts.rsshowabspath
msgid "Absolute path"
msgstr ""
#: lazarusidestrconsts.rsshowfilename
msgctxt "lazarusidestrconsts.rsshowfilename"
msgid "File name"
msgstr "Názov súboru"
#: lazarusidestrconsts.rsshowpathmode
msgid "Path display mode (Ctrl+P)"
msgstr ""
#: lazarusidestrconsts.rsshowrelpath
msgid "Relative path"
msgstr ""
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Číslovanie verzií"
#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr "Zobraziť voľby"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Príkazy menu Help"
#: lazarusidestrconsts.srkmcatclipboard
msgid "Clipboard commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Príkazy Command"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Príkazy CodeTools"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Príkazy presunu kurzora"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Príkazy úpravy textu"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Príkazy menu Súbor"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""
#: lazarusidestrconsts.srkmcatlinewrap
msgid "Line wrapping"
msgstr ""
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makrá"
#: lazarusidestrconsts.srkmcatmarker
#, fuzzy
#| msgid "Text marker commands"
msgid "Text bookmark commands"
msgstr "Príkazy značkovania textu"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr ""
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Príkazy menu Balíček"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Príkazy menu Projekt"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Príkazy menu Spustiť"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Príkazy hľadania a nahradzovania textu"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Príkazy výberu textu"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Príkazy zdrojových poznámok"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Príkazy menu Nástroje"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Príkazy menu Zobraziť"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Príkaz:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "zrušiť budovanie"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Abstraktné metódy ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Pridať bod skoku"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "pridať pozorovanie"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Pripojiť k programu"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Šablóny dokončovania kódu"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""
#: lazarusidestrconsts.srkmecblockindent
#, fuzzy
#| msgid "Indent block"
msgid "Indent line/block"
msgstr "Zväčšiť odsadenie bloku"
#: lazarusidestrconsts.srkmecblockindentmove
msgid "Indent line/block (move columns)"
msgstr ""
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""
#: lazarusidestrconsts.srkmecblockunindent
#, fuzzy
#| msgid "Unindent block"
msgid "Unindent line/block"
msgstr "Zmenšiť odsadenie bloku"
#: lazarusidestrconsts.srkmecblockunindentmove
msgid "Unindent line/block (move columns)"
msgstr ""
#: lazarusidestrconsts.srkmecbreakpointproperties
msgid "show breakpoint properties"
msgstr ""
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "vybudovať program/projekt"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "vybudovať súbor"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Vybudovať Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "vybudovať viacej režimov"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Znak"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "vyčistiť a vybudovať"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Zmazať celý text"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Vymazať všetky záložky"
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Vymazať záložky pre aktuálny súbor"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnblockmoveleft
msgid "Move column-block left (delete before columns)"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnblockmoveright
msgid "Move column-block right (delete after columns)"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnblockshiftleft
msgid "Shift column-block left (delete in columns)"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnblockshiftright
msgid "Shift column-block right (delete in columns)"
msgstr ""
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Stĺpcový režim výberu"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr ""
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "konfiguračný súbor budovania"
#: lazarusidestrconsts.srkmeccopy
#, fuzzy
#| msgid "Copy selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Kopírovať výber do schránky"
#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy to clipboard (append)"
msgstr ""
#: lazarusidestrconsts.srkmeccopyaddcurrentline
#, fuzzy
#| msgid "Copy current line (Add to Clipboard)"
msgid "Copy current line to clipboard (append)"
msgstr "Kopírovať aktuálny riadok (pridať do schránky)"
#: lazarusidestrconsts.srkmeccopycurrentline
#, fuzzy
#| msgid "Copy current line"
msgid "Copy current line to clipboard"
msgstr "Kopírovať aktuálny riadok"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmeccut
#, fuzzy
#| msgid "Cut selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Vystrihnúť výber do schránky"
#: lazarusidestrconsts.srkmeccutadd
msgid "Cut to clipboard (append)"
msgstr ""
#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line to clipboard (append)"
msgstr ""
#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line to clipboard"
msgstr ""
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Zmazať po začiatok riadka"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Zmazať znak na kurzore"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Zmazať do konca riadka"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Zmazať posledný znak"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Zmazať po začiatok slova"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Zmazať aktuálny riadok"
#: lazarusidestrconsts.srkmecdeletelinekeepx
msgid "Delete current line (keep X pos)"
msgstr ""
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Zmazať do konca slova"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Odpojiť od programu"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Rozdiely"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr ""
#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Posunúť kurzor na úplný koniec"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Posunúť kurzor o na úplný začiatok"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Prázdne metódy ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "vyhodnotiť/zmeniť"
#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Oddeliť procedúru"
#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Externý nástroj %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Nastavenie externých nástrojov"
#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Nájsť text"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Nájsť druhý koniec bloku"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Nájsť začiatok bloku"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Nájsť deklaráciu"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Nájsť odkazy na identifikátor"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Nájsť v súboroch"
#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Nájsť ďalšie"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Nájsť ďalší výskyt slova"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr ""
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Nájsť predchádzajúci"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Nájsť predchádzajúci výskyt slova"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Nájsť definíciu procedúry"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "Nájsť metódu procedúry"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr ""
#: lazarusidestrconsts.srkmecfoldtoggle
msgid "Toggle Fold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format, fuzzy
#| msgid "Go to editor %d"
msgid "Go to source editor %d"
msgstr "Choď na editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Choď na direktívu include aktuálneho include súboru"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Choď na riadok číslo"
#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format
msgid "Go to bookmark %d"
msgstr "Choď na záložku %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Choď na XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Odhadnúť zle umiestnený $IFDEF"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Vložiť položku ChangeLog"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Vložiť z mapy znakov"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Vložiť kľúčové slovo CVS Author"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Vložiť kľúčové slovo CVS Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Vložiť kľúčové slovo CVS Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Vložiť kľúčové slovo CVS ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Vložiť kľúčové slovo CVS Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Vložiť kľúčové slovo CVS Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Vložiť kľúčové slovo CVS Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Vložiť kľúčové slovo CVS Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Vložiť aktuálny dátum a čas"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Vložiť celé meno súboru"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Vložiť vyhlásenie GPL"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Vložiť GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Vložiť LGPL vyhlásenie"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zalomiť·riadok·a·ponechať kurzor"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Režim vkladania"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Vložiť upravené LGPL vyhlásenie"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Vložiť aktuálne používateľské meno"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "skontrolovať"
#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Otočiť priradenie"
#: lazarusidestrconsts.srkmecjumptonextsearchresult
msgid "Jump to next search result"
msgstr ""
#: lazarusidestrconsts.srkmecjumptoprevsearchresult
msgid "Jump to previous search result"
msgstr ""
#: lazarusidestrconsts.srkmeckeymapleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "šípka vľavo"
#: lazarusidestrconsts.srkmeckeymapright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "šípka vpravo"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zalomiť riadok a presunúť kurzor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Posunúť kurzor na koniec riadka"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Riadkový režim výberu"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Posunúť kurzor na začiatok riadka"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Vytvoriť Resource String"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Choď na vyhovujúcu zátvorku"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Okno editora vľavo"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Posunúť editor úplne vľavo"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Okno editora vpravo"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Posunúť editor úplne vpraco"
#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr ""
#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr ""
#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr ""
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Viac-Vložiť"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Nasledujúca záložka"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Choď na nasledujúci editor"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normálny režim výberu"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Otvoriť súbor na pozícii kurzora"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Režim prepisovania"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Posunúť kurzor na spodok stránky"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Posunúť kurzor o stránku nižšie"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Posunúť kurzor o stránku vľavo"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Posunúť kurzor o stránku vpravo"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Posunúť kurzor na začiatok stránky"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Posunúť kurzor o jednu stránku vyššie"
#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Vložiť"
#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr "Vložiť (ako stĺpce)"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "prerušiť program"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Predchádzajúca záložka"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Choď na predchádzajúci editor"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "rýchly preklad, bez linkovania"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "odstrániť bod prerušenia"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Odstrániť prázdne metódy"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Odstrániť nepoužité jednotky"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Premenovať identifikátor"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Nahradiť text"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Hlásenie chyby ..."
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reštartovať debuger"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "spustiť program"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "spustiť súbor"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parametre spustenia"
#: lazarusidestrconsts.srkmecrunwithdebugging
msgid "run with debugging"
msgstr ""
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "spustiť bez ladenia"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolovať o riadok dole"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolovať o znak vľavo"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolovať o znak vpravo"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolovať o riadok hore"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Vybrať dole"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Vybrať všetky"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Konvertuj tabulátory na medzery vo výbere"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Vybrať po úplný koniec"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Vybrať po úplný začiatok"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr ""
#: lazarusidestrconsts.srkmecsellineend
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Vybrať do konca riadka"
#: lazarusidestrconsts.srkmecsellinestart
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Vybrať po začiatok riadka"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""
#: lazarusidestrconsts.srkmecselpagebottom
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Vybrať do konca strany"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Vybrať stránku dole"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Vybrať stránku vľavo"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Vybrať stránku vpravo"
#: lazarusidestrconsts.srkmecselpagetop
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Vybrať vrch strany"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Vybrať stránku hore"
#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr ""
#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Vybrať hore"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Vybrať slovo vľavo"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Vybrať slovo vpravo"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastav voľnú záložku"
#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format
msgid "Set bookmark %d"
msgstr "Nastav značku %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Zobraziť abstraktné metódy"
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "Zobraziť kontext kódu"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""
#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr ""
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "zastaviť program"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Prehrať makro"
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewrapcolsellineend
msgid "Column Select to wrapped line end"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewrapcolsellinestart
msgid "Column Select to wrapped line start"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewraplineend
msgid "Move cursor to wrapped line end"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewraplinestart
msgid "Move cursor to wrapped line start"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewrapsellineend
msgid "Select to wrapped line end"
msgstr ""
#: lazarusidestrconsts.srkmecsynplinewrapsellinestart
msgid "Select to wrapped line start"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
msgid "Add Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
msgid "Add Cell (case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
msgid "Add Cell (context-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
msgid "Add Cell (context & case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
msgid "Remove current Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
msgid "Grow cell on the left"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
msgid "Grow cell on the right"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
msgid "Shrink cell on the left"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
msgid "Shrink cell on the right"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
msgid "Start Syncro edit (case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
msgid "Start Syncro edit (context-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
msgid "Start Syncro edit (context & case-sensitive)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Kontrola syntaxe"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "prepnúť bod prerušenia"
#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr "zapnúť/vypnúť bod prerušenia"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Zobraziť body prerušenia"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Zobraziť Zásobník volaní"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Zobraziť Prehliadač kódu"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Zobraziť Prieskumník kódu"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Zobraziť Paletu komponentov"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Zobraziť výstup debugera"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Prepnúť medzi formulárom a jednotkou"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Zobraziť Editor dokumentácie"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Zobraziť tlačítka IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Zobraziť lokálne premenné"
#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr "Prepnúť záložku %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""
#: lazarusidestrconsts.srkmectogglememviewer
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
msgid "View Mem viewer"
msgstr ""
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Zobraziť Správy"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Režim prepínania"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Zobraziť Inšpektor objektov"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Zobraziť registre"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Zobraziť obmedzenia prehliadača"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Zobraziť Výsledky hľadania"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Zobraziť editor zdrojového kódu"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Zobraziť Pozorovania"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "neznámy príkaz editora"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Nepoužité jednotky ..."
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Zobraziť Editor ukotvenia"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Zobraziť komponenty"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Zobraziť makrá editora"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Zobraziť formuláre"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Zobraziť históriu"
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Zobraziť poradie tabulátora"
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Zobraziť vlákna"
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Zobraziť závislosti jednotiek"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Zobraziť informácie o jednotke"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Zobraziť jednotky"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Dokončovanie slov"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Posunúť kurzor o slovo vľavo"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Posunúť kurzor o slovo vpravo"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Priblížiť"
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Oddialiť"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Upraviť klávesy príkazu"
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr ""
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Skryť komentáre"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Skryť komentáre vo výbere"
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr ""
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Súbor je len na čítanie"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Súbor \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" nie je zapisovateľný."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Zamknutý"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Pridať pozorovanie v mieste kurzora"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr "Záložka &%s: %s"
#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr "Záložka &%s"
#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr "Záložka %s"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Zatvoriť všetky &ostatné stránky"
#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr "Zatvoriť všetky ostatné stránky"
#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr "Zatvoriť stránky na p&ravej strane"
#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr "Zatvoriť stránky na pravej strane"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Zatvoriť stránku"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Kopírovať názov súboru"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Klonovať do nového okna"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Klonovať do iného okna"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nové okno"
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Ladiť"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kódovanie"
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "Vyhodnotiť/Upraviť ..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Nájsť deklaráciu"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Choď na záložku"
#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Choď na záložku ..."
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Zvýrazňovač"
#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Skontrolovať ..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Otočiť priradenie"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Ukončenie riadku"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "Zamknúť stránku"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Presunúť stránku doľava"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Presunúť stránku úplne doľava"
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Presunúť stránku doprava"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Presunúť stránku úplne doprava"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Presunúť do nového okna"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Presunúť do iného okna"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nové okno"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Choď na ďalšiu záložku"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Zmenené"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Otvoriť súbor na pozícii kurzora"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Choď na predchádzajúcu záložku"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Prejsť na procedúru"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Len na čítanie"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refaktoring"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zobraziť čísla riadkov"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Zdrojový kód"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "Prepnúť záložku"
#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr "Prepnúť záložku &%s: %s"
#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr "Prepnúť záložku &%s"
#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Prepnúť záložku ..."
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Prepnúť &bod prerušenia"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Zobraziť zásobník volaní"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Zatiaľ neimplementované"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Len na čítanie"
#: lazarusidestrconsts.uepselchars
#, object-pascal-format
msgid "%d"
msgstr ""
#: lazarusidestrconsts.uepselcol
msgid "COL"
msgstr ""
#: lazarusidestrconsts.uepselcxchars
#, object-pascal-format
msgid "%d * %d"
msgstr ""
#: lazarusidestrconsts.uepselline
#, fuzzy
#| msgid "Line"
msgctxt "lazarusidestrconsts.uepselline"
msgid "LINE"
msgstr "Riadok"
#: lazarusidestrconsts.uepselnorm
msgid "DEF"
msgstr ""
#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr ""
#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr ""
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informácie o verzii"