mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-05 17:37:53 +02:00
22004 lines
696 KiB
Plaintext
22004 lines
696 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Lazarus\n"
|
|
"POT-Creation-Date: \n"
|
|
"PO-Revision-Date: 2018-11-16 10:40+0100\n"
|
|
"Last-Translator: Chronos <robie@centrum.cz>\n"
|
|
"Language-Team: Czech <vaclav@valicek.name>\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"X-Poedit-SourceCharset: UTF-8\n"
|
|
"X-Generator: Poedit 2.2\n"
|
|
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
|
"Language: cs\n"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbicommand
|
|
msgid "Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.cocoamfstbijumpback
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
|
|
msgid "Jump Back"
|
|
msgstr "Skočit zpět"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbijumpforward
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
|
|
msgid "Jump Forward"
|
|
msgstr "Skočit vpřed"
|
|
|
|
#: lazarusidestrconsts.cocoamfstbisearch
|
|
msgid "Search Instantly"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowlinktarget
|
|
msgid "Link target line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowsourcefunc
|
|
msgid "Function name"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgasmwindowsourceline
|
|
msgid "Source line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Address Breakpoint %s"
|
|
msgstr "Adresa bodu přerušení %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddress
|
|
#, object-pascal-format
|
|
msgid "at $%s"
|
|
msgstr "na $%s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
|
|
#, object-pascal-format
|
|
msgid "at $%s: from origin %s line %d"
|
|
msgstr "na $%s: z počátku %s řádky %d"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
|
|
#, object-pascal-format
|
|
msgid "at $%s: %s line %d"
|
|
msgstr "na $%s: \"%s řádek %d"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
|
|
#, object-pascal-format
|
|
msgid "Source Breakpoint %s"
|
|
msgstr "Zdrojový bod přerušení %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
|
#, object-pascal-format
|
|
msgid "Unknown Breakpoint %s"
|
|
msgstr "Neznámý bod přerušení %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
|
#, object-pascal-format
|
|
msgid "Watchpoint %s"
|
|
msgstr "Sledovací bod %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint out of scope %s"
|
|
msgstr "Neznámý sledovací bod mimo rozsah %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
|
|
#, object-pascal-format
|
|
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr "Vyvolán neznámý sledovací bod %s. Stará hodnota \"%s\", Nová hodnota \"%s\""
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchscopeended
|
|
#, object-pascal-format
|
|
msgid "Watchpoint for \"%s\" out of scope %s"
|
|
msgstr "Sledovací bod pro \"%s\" mimo rozsah %s"
|
|
|
|
#: lazarusidestrconsts.dbgeventwatchtriggered
|
|
#, object-pascal-format
|
|
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
|
|
msgstr "Sledovací bod pro \"%s\" byl vyvolán %s. Stará hodnota \"%s\", Nová hodnota \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr "Použít přednastavené schéma"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr "Nulovat všechna nastavení"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr "Nulovat všechna nastavení žlábku"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr "Nulovat všechna nastavení textu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr "Přidat bod historie"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr "Kontextová nabídka"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr "Kontextová nabídka (ladění)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr "Kontextová nabídka (tab)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr "Skočit na implementaci"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr "Skočit na implementaci / příslušný konec bloku"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr "Zpět v historii"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr "Vpřed v historii"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr "Přepnout dodatečnou Vsuvku"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nic / Přednastavené"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Vložit"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr "Pokračovat %0:s (Navaž na: %1:s)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
#, object-pascal-format
|
|
msgid "Continue %0:s"
|
|
msgstr "Pokračovat %0:s"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr "Vybrat text"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr "Vybrat text (po řádcích)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr "Vybrat text (elementy)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr "Vybrat text (po slovech)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr "Vybrat text (sloupce)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr "Vybrat text (řádky)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
#, fuzzy
|
|
#| msgid "Set free bookmark"
|
|
msgid "Set a free bookmark"
|
|
msgstr "Nastavit volnou značku"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr "Vybrat aktuální řádek (celý)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr "Vybrat aktuální řádek (text)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr "Vybrat aktuální odstavec"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr "Vybrat aktuální slovo"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr "Vynulovat přiblížení"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr "Tato stránka nezobrazuje aktuální nastavení. Viz stránka Rozšířené. Zde můžete nastavit výchozí hodnoty"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Obecné"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr "Standardní, všechny akce (body přerušení, složení) při stisknutí tlačítka myši"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr "Rozšířené, akce (body přerušení, složení) při uvolnění tlačítka myši. Výběr při současném stisknutí tlačítka myši a pohybu"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr "Rozšířené, Akce, pravý žlábek pouze poloviční"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr "Použít čísla řádků pro výběr řádků"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr "Žlábek"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right button click includes caret move"
|
|
msgstr "Klik pravým tlačítkem zahrnuje pohyb kurzoru"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr "Alt-Ctrl tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr "Alt-Ctrl kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr "Alt tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr "Alt kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr "Ctrl tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr "Ctrl kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr "Tažení výběru (kopírovat/vložit)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr "Extra-1 tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr "Extra-2 tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr "Alt dvojitý"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr "Ctrl dvojitý"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr "Dvojitý"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr "Shift dvojitý"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr "Čtyřnásobný"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr "Trojitý"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr "Prostřední tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr "Prostřední"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Extra 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Extra 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
|
|
msgid "Horizontal-Wheel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr "Levé 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr "Levé 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "Pravé"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr "Kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr "Pravé tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr "Shift-Alt-Ctrl tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr "Shift-Alt-Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr "Shift-Alt tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr "Shift-Alt kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr "Shift-Ctrl tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr "Shift-Ctrl kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr "Shift tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr "Kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr "Shift kolečko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr "Máte neuložené změny. Použitím této stránky vrátíte zpět změny provedené na pokročilé stránce"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr "Posunout vodorovně (systémová rychlost)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr "Posunout vodorovně (jeden řádek)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr "Posunout vodorovně (stránku)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr "Posunout vodorovně (půl stránky)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr "Posunout vodorovně (stránka bez jedné řádky)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Nic / Předvolené"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr "Posunout (systémová rychlost)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr "Posunout (jeden řádek)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr "Posunout (stránku)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr "Posunout (půl stránky)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr "Posunout (stránku bez jedné řádky)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr "Přiblížení"
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr "< Žádné >"
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Malé písmena, první písmeno velké"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr "aktivní"
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Přidat operátor přiřazení :="
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr "Zvýraznění závorky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr "Strom složení kódu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
|
|
msgid "Code folding (current)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcustom
|
|
#, object-pascal-format
|
|
msgid "Custom %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr "Přednastavený text"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
|
|
msgid "Default Text / Window"
|
|
msgstr "Výchozí Text / Okno"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr "Zakázané body přerušení"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr "Povolit body přerušení"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr "Chybový řádek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr "Bod vykonávání"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr "Popisovač složení kódu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr "Svinout počáteční řádek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Celkový"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr "Žlábek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr "PokudDefinováno"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Řádek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
|
msgid "Outline Colors"
|
|
msgstr "Barvy obrysu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr "Editor Syncron"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr "Editor šablon"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupwrap
|
|
msgid "Wrapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_custom
|
|
msgid "(Custom)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_entrytype
|
|
msgid "(entry type)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_extended
|
|
msgid "(Extended)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroup_suffix_nbrackets
|
|
msgid "(Nested Brackets)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr "Oddělovač žlábku"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr "Skrýt počáteční řádek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr "Vzestupně další"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
|
|
msgid "Highlight prefix"
|
|
msgstr "Zvýraznit prefix"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr "Zvýraznit aktuální slovo"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr "Postupné hledání"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr "Chybný bod přerušení"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr "Zvýraznění aktuálního řádku"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr "Číslo řádku"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr "Změněný řádek"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr "Odkaz myši"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrnestedbracket
|
|
#, object-pascal-format
|
|
msgid "Nested bracket %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevelcolor
|
|
#, object-pascal-format
|
|
msgid "Level %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
|
|
msgid "Recently used item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr "Vybraná oblast"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktivní buňka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Jiné buňky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Synchronizované buňky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktivní buňka"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Jiné buňky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Synchronizované buňky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
#, fuzzy
|
|
#| msgid "Text block"
|
|
msgid "Selected text"
|
|
msgstr "Textový blok"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr "Neznámý bod přerušení"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwindowborder
|
|
msgid "Window border"
|
|
msgstr "Okraj okna"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr "Slovní závorky"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapeol
|
|
msgid "EOL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapindent
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapindent"
|
|
msgid "Indent"
|
|
msgstr "Odsazení"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwrapsubline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrwrapsubline"
|
|
msgid "Sub-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr "Zobrazit speciální znaky"
|
|
|
|
#: lazarusidestrconsts.dlgaddnewmode
|
|
msgid "Add new mode"
|
|
msgstr "Přidat nový režim"
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Přidat středník"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Přizpůsobit vrchní linku kvůli komentářů vpředu"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Abecedně"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always keep caret in visible area of editor"
|
|
msgstr "Udržuj vždy kurzor ve viditelné oblasti editoru"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Nejednoznačná akce souboru:"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Varování při překládání"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr "Ikona pro chybu/varování/pokyn je ukázána na začátku zprávy. Stejná ikona je ukázána ve žlábku zdrojovém editoru v těchto případech."
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
#, fuzzy
|
|
#| msgid "Ansi (* *)"
|
|
msgid "ANSI (* *)"
|
|
msgstr "Ansi (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
msgid "Application settings"
|
|
msgstr "Nastavení aplikace"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include assertion code"
|
|
msgstr "Zahrnout kontrolní kód"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktop
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "Associated debug desktop"
|
|
msgid "Associated debug desktop for \"%s\""
|
|
msgstr "Přiřazená ladící plocha"
|
|
|
|
#: lazarusidestrconsts.dlgassociateddebugdesktophint
|
|
msgid "If you select the desktop, the associated debug desktop will be selected as well."
|
|
msgstr "Pokud vyberete plochu, přidružená ladící plocha bude také vybrána."
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automaticky vytvořené formuláře:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr "Hlavní .lpr jednotka vytváří každý formulář s Application.CreateForm(). Formuláře jsou také automaticky uvolněny."
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
msgid "Auto-create new forms"
|
|
msgstr "Automaticky vytvářet formuláře"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Automaticky smazat soubor"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr "Automaticky Zobrazit Prototypy Funkcí"
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgid "Hide mouse pointer when typing"
|
|
msgstr "Skrýt ukazatel myši při psaní"
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr "Automatické odsazení"
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr "(Nastavení chytrého odsazení)"
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr "Automaticky odstranit prázdné metody"
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Automaticky nastav malá písmena v názvu souboru"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr "Automaticky uložit aktivní plochu"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Save active desktop on IDE close\n"
|
|
#| "Save debug desktop on IDE close and debug end\n"
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end"
|
|
msgstr ""
|
|
"Uložit aktivní plochu při uzavření IDE\n"
|
|
"Uložit ladící plochu při uzavření IDE a ukončení ladění\n"
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Dostupné formuláře:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr "Tyto formuláře musí být vytvořeny a uvolněny v kódu programu."
|
|
|
|
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
|
|
msgid "Avoid unnecessary jumps"
|
|
msgstr "Vyhnout se nepotřebným skokům"
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Pozadí"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(podadresáře ne)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Stejné jméno (v podadresáři)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Za metodami"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr "Výběr"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr "Odsazení bloku"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr "(upravit klávesy)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentspaces
|
|
msgid "Amount of spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttabs
|
|
msgid "Amount of tabs (tab stops)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttabs2spaces
|
|
msgid "Amount of spaces (tab stops)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr "Mezery/tabulátor podle předchozího řádku"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr "Pouze pozice"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr "Mezery"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr "Taby, utnuté"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr "Taby, potom mezery"
|
|
|
|
#: lazarusidestrconsts.dlgbookmarksetscroll
|
|
msgid "Restore scroll position for bookmarks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
#, fuzzy
|
|
#| msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
|
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
|
|
msgstr "Okrajový prostor může být nastaven v editoru kotev. Červená čára je ukázána pokud rozestup > 0."
|
|
|
|
#: lazarusidestrconsts.dlgborderspacingcolor
|
|
msgid "BorderSpacing frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr "Zvýraznění závorky"
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket and quote pairs"
|
|
msgstr "Odpovídají závorky a uvozené páry"
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr "Nemůžete použit ukotvovací plochu v prostředí bez ukotvení a naopak."
|
|
|
|
#: lazarusidestrconsts.dlgcaretbackcolor
|
|
#, fuzzy
|
|
#| msgid "Multi/2nd (NotXor)"
|
|
msgid "Secondary carets (multi-caret mode)"
|
|
msgstr "Více/2. (NotXor)"
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolor
|
|
#, fuzzy
|
|
#| msgid "Caret"
|
|
msgctxt "lazarusidestrconsts.dlgcaretcolor"
|
|
msgid "Caret (Text-Cursor)"
|
|
msgstr "Kurzor"
|
|
|
|
#: lazarusidestrconsts.dlgcaretcolorinfo
|
|
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcaretforecolor
|
|
#, fuzzy
|
|
#| msgid "Color (NotXor)"
|
|
msgid "Main or primary caret"
|
|
msgstr "Barva (NotXor)"
|
|
|
|
#: lazarusidestrconsts.dlgcaretgroupoptions
|
|
msgid "Caret (Text Cursor)"
|
|
msgstr "Kurzor (Textový Kurzor)"
|
|
|
|
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
|
|
msgid "Caret (Text Cursor) past end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
|
msgid "&Case sensitive"
|
|
msgstr "&Rozlišovat velikost znaků"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Kontrolování voleb překladače"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
#, object-pascal-format
|
|
msgid "orphaned file found: %s"
|
|
msgstr "nalezen osiřelý soubor: %s"
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Výsledky"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgctxt "lazarusidestrconsts.dlgccotest"
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Test: Kontrola překladače..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Test: Kontrola nastavení překladače..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Test: Kontrola data překladače..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Test: Překládání prázdného souboru..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestrtlunits
|
|
msgid "Test: Checking RTL units ..."
|
|
msgstr "Test: Kontrola jednotek RTL ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..."
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Test: Překládání prázdného souboru"
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
#, object-pascal-format
|
|
msgid "using config file %s"
|
|
msgstr "používán konfigurační soubor %s"
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Pořadí tříd"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Poslední"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "malá písmena"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Náhled (max. délka řádku = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Prefix čtení"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Prefix uložení"
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "VELKÁ PÍSMENA"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Prefix proměnné"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Prefix nastavení"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Uložit jako - automaticky přejmenovat pascalovské soubory na malé znaky"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr "Zkontrolovat a automaticky uložit soubory"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr "Kontrolovat balíčky při vytváření formuláře"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr "Formulář může vyžaduje balíček pro práci. Instalovat takový balíček automaticky."
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Vyberte šablonu kódu (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Ukázat tlačítka pro zavření v zápisníku"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Barevné schéma"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
msgid "C style macros (global)"
|
|
msgstr "Makra ve stylu C (globální)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Použít Ansi řetězce"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style"
|
|
msgstr "Styl assembleru"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Zprávy"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr "Kontrolovaní a prosazování"
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr "Příkazy překladače"
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "Operátory ve stylu C (*=, +=, /= a -=)"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Vytvořit Makefile"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
|
msgid "Debugging"
|
|
msgstr "Ladění"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Přídavná cesta ladícího nástroje (žádná):"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Vytvoření kódu"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr "Oba"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr "Svinout"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr "Skrýt"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr "Opačné pořadí svinutí v Popup"
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
#, fuzzy
|
|
#| msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
|
msgid "Generate info for the debugger (slower / increases exe-size)"
|
|
msgstr "Vytvářet ladící informace pro GDB (pomalejší / Větší velikost exe souboru)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Použít jednotku Heaptrc (kontrola na únik paměti)"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Zahrnout soubory (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
#, fuzzy
|
|
#| msgid "Info for GDB"
|
|
msgid "Debugger info"
|
|
msgstr "Infomace pro GDB"
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Knihovny (-Fl):"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Spojování"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Volby překladače mohou být uloženy jako XML soubor."
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr "(Barva editoru)"
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr "Nezměněn"
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgctxt "lazarusidestrconsts.dlgcolors"
|
|
msgid "Colors"
|
|
msgstr "Barvy"
|
|
|
|
#: lazarusidestrconsts.dlgcolorstml
|
|
msgid "TML Setup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
|
|
#, object-pascal-format
|
|
msgid "Sample text file not found: %1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlerror
|
|
msgid "Error:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlfromfile
|
|
msgid "File:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlinfo
|
|
#, object-pascal-format
|
|
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
|
|
#, object-pascal-format
|
|
msgid "Did not find all includes: %1:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
|
|
msgid "No files found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
|
|
msgid "No sample text configured"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlok
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcolorstmlrefresh
|
|
msgid "Reload"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Parametry příkazové řádky (bez jména aplikace)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
|
|
msgstr "Najvyšší odsazení pro nový řádek pokud předpona umístěna na začátku komentáře na prvním řádku komentáře:"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr "Omezit odsazení na"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr "Předpona komentářů na zalomení řádku"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr "Shoda aktuálního řádku"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr "Shoda textu zahrnující \"*\" ze symbolu \"(*\""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr "Shoda celého řádku"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
#, object-pascal-format
|
|
msgid "Match text after token \"%s\""
|
|
msgstr "Shoda textu po symbolu \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
#, object-pascal-format
|
|
msgid "Match text including token \"%s\""
|
|
msgstr "Shoda textu zahrnující symbol \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr "Prefixovat nový řádek"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr "Zarovnat prefix na odsazení předchozího řádku"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr "Zarovnat Prefix pod začátkem komentáře na prvním řádku komentáře"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr "Neodsazovat prefix"
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments and Strings"
|
|
msgstr "Komentáře a řetězce"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend if matched or not matched"
|
|
msgstr "Rozšířit, pokud odpovídá nebo neodpovídá"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend if matched or not matched (not at EOL)"
|
|
msgstr "Rozšířit, pokud odpovídá nebo neodpovídá (ne na konci řádku)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend if matched"
|
|
msgstr "Rozšířit, pokud odpovídá"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend if matched and caret in the middle of text (not at EOL)"
|
|
msgstr "Rozšířit, pokud odpovídá a vsuvka je uprostřed textu (ne na koneci řádku)"
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr "Překlad a spojování"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr "Zprávy překladače"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr "Jazykový soubor zpráv překladače (*.msg)"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Vlastnosti dokončení"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr "Komponenta pod ukazatelem myši je první vybraná, pak u ní funguje rolovací nabídka."
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr "Konfigurace a Cíl"
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
msgid "Config files"
|
|
msgstr "Konfigurační soubory"
|
|
|
|
#: lazarusidestrconsts.dlgconsolesizenotsupported
|
|
msgid "Current debugger does not support this."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr "Ostatní ladící info"
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Přetečení"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Analyzování"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr "Kopírovat/Vložit s informací složení"
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy current word when no selection exists"
|
|
msgstr "Kopírovat aktuální slovo, když není žádný výběr"
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Rozsah"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr "Přemístitelné"
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr "Nastavit volby překladače jako výchozí"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
msgid "&Show Options"
|
|
msgstr "&Zobrazit Volby"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
msgid "Smart linkable"
|
|
msgstr "Chytré spojování"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Jiné zdroje (soubory .pp/.pas, použitou pouze IDE ne překladačem)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Zásobník"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Odstranit symboly ze spustitelného"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr "Druh ladících informací"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr "Automaticky"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
#, fuzzy
|
|
#| msgid "Dwarf2"
|
|
msgid "Dwarf 2"
|
|
msgstr "Dwarf2"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
#, fuzzy
|
|
#| msgid "Dwarf with sets"
|
|
msgid "Dwarf 2 with sets"
|
|
msgstr "Dwarf s množinami"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
#, fuzzy
|
|
#| msgid "Dwarf3 (beta)"
|
|
msgid "Dwarf 3 (beta)"
|
|
msgstr "Dwarf3 (beta)"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr "Staby"
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr "Zaneřádit proměnné (proměnné mají na začátku náhodnou hodnotu)"
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
msgid "Unit style"
|
|
msgstr "Styl jednotky"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Vytvářet kód pro valgrind"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr "Výřečnost"
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
msgid "C++ styled INLINE"
|
|
msgstr "INLINE ve stylu C++"
|
|
|
|
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
|
|
msgid "Create new Run Parameters settings"
|
|
msgstr "Vytvořit nové nastavení Parametry spuštění"
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr "Kudrnaté {}"
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr "Aktuálně respektováno oknem zpráv, historií skoků a výsledky hledání."
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Ukazatel za koncem řádku"
|
|
|
|
#: lazarusidestrconsts.dlgcursormoveclearsselection
|
|
msgid "Caret left/right clears selection (no move)"
|
|
msgstr "Kurzor levý/pravý maže výběr (bez pohybu)"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Caret skips selection"
|
|
msgstr "Kurzor přeskakuje výběr"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Caret skips tabs"
|
|
msgstr "Kurzor přeskakuje tabulátory"
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Uživatelsky definované rozšíření (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr "ladění"
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Editor cest"
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Typ a cesta ladiče"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Výchozí písmo editoru"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulttabfont
|
|
msgid "Default tab font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefaultwinpos
|
|
msgid "Default Window/Console position and size"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Výchozí hodnota"
|
|
|
|
#: lazarusidestrconsts.dlgdeletemode
|
|
msgid "Delete mode"
|
|
msgstr "Smazat režim"
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
|
|
msgid "Delete"
|
|
msgstr "Odstranit"
|
|
|
|
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
|
|
msgid "Delete selected desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Odstranit šablonu "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr "Tlačítka - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr "Pokyny"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr "Nabídky - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr "Jméno plochy"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr "%d ploch úspěšně exportováno do \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
#, object-pascal-format
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr "%d ploch úspěšně importováno z \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
msgid "Different values background"
|
|
msgstr "Odlišné hodnoty pozadí"
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Směr"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Zakázat vyhlazování grafiky"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr "Vzdálenost mezi body mřížky je nejmenší krok při posunu prvků."
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr "Použít barvu pravého okraje"
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr "Kreslit úroveň oddělovače"
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr "Barva zanořené řádky"
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr "Barva řádky"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr "Begin/End"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr "Procedure/Function"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr "Class/Struct"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr "Class/Struct (místní)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr "Try/Except"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr "Sekce jednotka"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr "Odstavec uses"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr "Var/Type"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (místní)"
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr "Kreslit jméno komponenty pod ní."
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Zpět"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Tučné"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Podadresář"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Šablony kódu"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr "Doplnit ukončovací příkaz bloku pascalu"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Uživatelsky definované rozšíření"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
#, object-pascal-format
|
|
msgid "(%s sec delay)"
|
|
msgstr "(%s sec prodleva)"
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Zobrazení"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
msgid "Editor Files"
|
|
msgstr "Soubory editoru"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
|
msgid "Identifier completion"
|
|
msgstr "Dokončení identifikátorů"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr "Převrácené"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr "Ignorovat zámky, použít nejdelší nepoužitý editor"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr "Ignorovat zámky pokud je editor aktuální"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr "Ignorovat zámky pokud je editor v aktuálním okně"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr "Zamčeno pokud je text zobrazen"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr "Odemknuté"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr "Odemčeno pokud je text vystředěný"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr "Nová záložka, existující nebo nové okno"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr "Nová záložka v novém okně"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr "Nová záložka v existujícím okně"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr "Tato volba použije nejdelší nepoužitý editor pro soubor i v případě, že je zamčen a/nebo vyžaduje rolování. Určení nejdelšího nepoužitého editoru nezohledňuje pořadí, v němž byla okna zobrazena i pokud je toto nastaveno pro \"stejná kritéria pořadí\". Tato volba bude vždy úspěšná, další volby nikdy testovány."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Tato volba zjistí, zda aktuální aktivní editor má cílový soubor a pokud ano, tak použije aktuální editor i pokud je zamčený a/nebo vyžaduje rolování."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Tato volba zjistí, zda existuje editor pro cílový soubor v aktuálním okně a pokud ano, tak použije tento editor i pokud je zamčený a/nebo vyžaduje rolování."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr "Tato volba použije zamčený (pouze zamčený) editor, který nevyžaduje rolování k zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné části obrazovky)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr "Tato volba použije libovolný nezamčený editor."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr "Tato volba použije nezamčený editor, který nevyžaduje rolování pro zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné vystředěné části obrazovky, kromě 2-5 řádek nahoře/dole)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr "Tato volba otevře novou záložku v existujícím nebo novém okně pokud není nalezena nezamčená záložka. Tato volba vždy uspěje, další volby už nejsou testovány."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v novém okně (i pokud by jiná existující okna mohla být použita pro novou záložku). Tato volba vždy uspěje, další volby již nejsou testovány."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
|
|
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v existujícím (a pouze v existujícím) okně. Záložka je otevřena pouze pokud existující okno dosud nemá editor pro cílový soubor."
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Kurzíva"
|
|
|
|
#: lazarusidestrconsts.dlgeditexportbackcolor
|
|
msgid "Use Background color in HTML export"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditmaxlength
|
|
msgid "(Edit Max Length)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr "Velikost fontu editoru"
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Volby editoru"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr "Globální nastavení schéma"
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgctxt "lazarusidestrconsts.dlgedmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Různé"
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr "Vypnuto"
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr "Zapnuto"
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr "Tab a odsazení"
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Podtržené"
|
|
|
|
#: lazarusidestrconsts.dlgelastictabs
|
|
msgid "Elastic tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgelastictabswidths
|
|
msgid "Elastic min Widths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr "Vlastnosti prvku"
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr "Klávesa End skočí k nejbližšímu konci"
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Zeptat"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Poznámky: Soubory projektu jsou všechny soubory v adresáři projektu"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Záloha"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Soubory"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Mřížka"
|
|
|
|
#: lazarusidestrconsts.dlgenvidestartup
|
|
msgid "IDE Startup"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Jazyk"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagerestarthint
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
|
|
msgid "Restart the IDE to complete the language change."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Vodící čáry"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Různé"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Žádné"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
msgid "Other Files"
|
|
msgstr "Jiné soubory"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
msgid "Tabs for project"
|
|
msgstr "Listy projektu"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr "Zaměřit zprávy při překládání"
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra character spacing"
|
|
msgstr "Dodatečné mezery znaků"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Dodatečné mezery řádku"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
#, fuzzy
|
|
#| msgid "Use external gdb debug symbols file"
|
|
msgid "Use external debug symbols file"
|
|
msgstr "Používat externí soubor ladících symbolů GDB"
|
|
|
|
#: lazarusidestrconsts.dlgfileassociationinos
|
|
msgid "Opening Files from OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Přípony souboru"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
#, object-pascal-format
|
|
msgid "%s files"
|
|
msgstr "%s souborů"
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
|
msgid "All files"
|
|
msgstr "Všechny soubory"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
|
msgid "CodeTools template file"
|
|
msgstr "Soubor šablony CodeTools"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr "Soubor DCI"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr "Formulář Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
|
msgid "Delphi package"
|
|
msgstr "Balíček Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
|
msgid "Delphi project"
|
|
msgstr "Projekt Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
|
msgid "Delphi unit"
|
|
msgstr "Jednotka Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
|
msgid "Executable"
|
|
msgstr "Spustitelný"
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
|
msgid "FPC message file"
|
|
msgstr "Soubor FPC zpráv"
|
|
|
|
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
|
|
msgid "Fppkg configuration file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr "Soubory HTML"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr "Bitmapové obrázky"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr "Pixmapové obrázky"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr "Obrázky PNG"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Nastavení plochy Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
|
msgid "Editor file types"
|
|
msgstr "Typy souborů editoru"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
|
msgid "Lazarus file"
|
|
msgstr "Soubor Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
|
msgid "Lazarus form"
|
|
msgstr "Formulář Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
|
msgid "Lazarus include file"
|
|
msgstr "Zahrnutý soubor Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
|
msgid "Lazarus other file"
|
|
msgstr "Jiný soubor Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
|
msgid "Lazarus package"
|
|
msgstr "Balíček Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
|
msgid "Lazarus project"
|
|
msgstr "Projekt Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
|
msgid "Lazarus project source"
|
|
msgstr "Zdrojový soubor projektu Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr "Sezení Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
|
msgid "Lazarus unit"
|
|
msgstr "Jednotka Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpackagelistfiles
|
|
msgid "Package list files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
|
msgid "Pascal file"
|
|
msgstr "Soubor Pascalu"
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
|
msgid "Programs"
|
|
msgstr "Programy"
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
|
msgid "XML files"
|
|
msgstr "XML soubory"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Najít text od kurzoru"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr "Díl"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr "Sekce chunk"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr "ASP"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Komentář"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr "Uzel"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr "Položka"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr "Seznam <>"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr "Objekt (zděděný, vkládaný)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (místní)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasanonprocedure
|
|
msgid "Anonymous Procedure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr "Komentář (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr "Asm"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr "Begin/End (vnořené)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr "Komentář { }"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr "Velikost znaků"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr "Class/Object"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr "public/private"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr "Except/Finally"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
msgid "For/Do"
|
|
msgstr "For/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr "{$IfDef}"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr "If/Then/Else"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr "Vnořené komentáře"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr "Begin/End (procedura)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr "Record"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecordcase
|
|
msgid "Record case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
|
|
msgid "Record case section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Repeat"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr "Komentář //"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr "Try"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Jednotka"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr "Sekce Unit"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr "{%Region}"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr "Použití"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr "Var/Type (globální)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
msgid "While/Do"
|
|
msgstr "While/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
msgid "With/Do"
|
|
msgstr "With/Do"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr "CData"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Komentář"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr "DocType"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr "Uzel"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr "Zpracování instrukcí"
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
|
|
msgid "Force DPI scaling in design-time"
|
|
msgstr "Vynutit DPI změnu měřítka pro dobu návrhu"
|
|
|
|
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
|
|
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
|
|
msgstr "Když je označeno, nastavení změny měřítka projektu bude ignorováno - pouze vlastnost Scaled formuláře/rámece/datového modulu bude brána v úvahu."
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr "Běžící instance Lazarusu nepřijímá řádné soubory."
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Popředí"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr "Změnit obsah Inspektoru objektů při kliknutí na titulek okna"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr "Ukázat vlastnosti formuláře v Inspektoru objektů kliknutím na jejich titulek okna."
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Politika vkládání procedur"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Udržovat pořadí procedur"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
#, object-pascal-format
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr "Spustitelný soubor překladače (např. %s)"
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "Zdrojový adresář FPC"
|
|
|
|
#: lazarusidestrconsts.dlgfppkgconfigurationfile
|
|
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Text-mark"
|
|
msgstr "Textová značka"
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Editor formuláře"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr "Od začátku"
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
#, fuzzy
|
|
#| msgid "&From cursor"
|
|
msgid "From c&ursor"
|
|
msgstr "&Od kurzoru"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Celkový"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Vytvářet kód pro gprof"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Barva zachytávače"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsdocked
|
|
msgid "Grayed desktops are for docked environment."
|
|
msgstr "Zašedlé plochy jsou pro prostředí s ukotvením."
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr "Zašedlé plochy jsou pro prostředí bez ukotvení."
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Barva mřížky"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr "Mřížka je tvořena malými tečkami, které pomáhají zarovnání prvků."
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Rozměr mřížky X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Velikost horizontálního kroku mřížky"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Rozměr mřížky Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Velikost svislého kroku mřížky"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Průzkumník kódu"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr "Kódové nástroje"
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Ladič"
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Prostředí"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Vrátit zpět skupinu"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Ukázat vodící čáry"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr "Když je prvek zarovnán vodorovně nebo svisle s jinými prvky, je zobrazena modrá vodící čára."
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr "Žlábek"
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr "Složeno"
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Barva žlábku"
|
|
|
|
#: lazarusidestrconsts.dlgguttercurrentlinenumber
|
|
msgid "Current Line (number)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgguttercurrentlineother
|
|
msgid "Current Line (other)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr "Barva okraje žlábku"
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr "Index oddělovače žlábku"
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Poloviční posouvání stránky"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr "Velikost haldy a zásobníku"
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
msgid "Heap size"
|
|
msgstr "Velikost haldy"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr "Výška jedné vlastnosti v mřížce."
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Výška:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
#, fuzzy
|
|
#| msgid "Hide IDE windows on run"
|
|
msgid "Hide IDE windows on Run/Debug"
|
|
msgstr "Skrýt okna IDE při spuštění"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr "Vůbec neukazovat IDE pokud běží program."
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr "Skrýt záložky v jednostránkových oknech"
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Barva zvýraznění"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Barva zvýraznění písma"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Caret"
|
|
msgstr "Nalevo od kurzoru"
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Caret"
|
|
msgstr "Napravo of kurzoru"
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Zobrazení tipů pro nepoužitý parametr \"Sender\""
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Zobrazení tipů k nepoužitým jednotkám v hlavním zdrojovém kódu"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Klávesa Home skočí k nejbližšímu startu"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Hostitelská aplikace"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryabstractprocfunc
|
|
msgid "Abstract proc/func"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrycodetemplate
|
|
msgid "Template"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryconst
|
|
msgid "Const"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryenum
|
|
msgid "Enum"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryfunc
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryfunc"
|
|
msgid "Function"
|
|
msgstr "Funkce"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryident
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryident"
|
|
msgid "Identifier"
|
|
msgstr "Identifikátor"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrykeyword
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrykeyword"
|
|
msgid "Keyword"
|
|
msgstr "Klíčové slovo"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrylabel
|
|
msgid "Label"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrylowervisibilityprocfunc
|
|
msgid "Lower visibility proc/func"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrynamespace
|
|
msgid "Namespace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryother
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryother"
|
|
msgid "Other"
|
|
msgstr "Jiné"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryproc
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryproc"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryproperty
|
|
msgid "Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrytext
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytext"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentrytype
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentrytype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryunit
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgiahadentifiercomplentryunit"
|
|
msgid "Unit"
|
|
msgstr "Jednotka"
|
|
|
|
#: lazarusidestrconsts.dlgiahadentifiercomplentryvar
|
|
msgid "Var"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
|
msgid "Identifier Completion"
|
|
msgstr "Dokončení identifikátoru"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Politika identifikátorů"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr "Volby IDE"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr "Aktivní $IFDEF kód"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr "Neaktivní $IFDEF kód"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr "Zahrnut $IFDEF kód smíšeného stavu"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr "Aktivní $IFDEF node"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr "Neaktivní $IFDEF uzel"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr "Zahrnut $IFDEF uzel smíšeného stavu"
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "A desktop with the same name already exists.\n"
|
|
#| "Please confirm the desktop name:\n"
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:"
|
|
msgstr ""
|
|
"Již existuje plocha se stejným jménem.\n"
|
|
"Prosím potvrďte jméno plochy:\n"
|
|
|
|
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
|
|
msgid "Include code templates"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
|
|
msgid "Include identifiers containing prefix"
|
|
msgstr "Zahrnout identifikátory obsahující prefix"
|
|
|
|
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
|
|
msgid "Include all keywords and operators"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Zahrnout systémové proměnné"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl
|
|
msgid "Include words"
|
|
msgstr "Zahrnout slova"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
|
|
msgid "don't include"
|
|
msgstr "nezahrnout"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
|
|
msgid "from all units"
|
|
msgstr "ze všech jednotek"
|
|
|
|
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
|
|
msgid "from current unit"
|
|
msgstr "z aktuální jednotky"
|
|
|
|
#: lazarusidestrconsts.dlgindentslineindentgroupoptions
|
|
msgid "Indent (New line)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabindentgroupoptions
|
|
msgid "Indent (Tab key on Selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabskeyoptions
|
|
msgid "Tab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgindentstabswidthsoptions
|
|
msgid "Tabs widths (Tab stop position)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Před metodami"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Jméno konstruktoru musí být 'init' (destruktor musí být 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr "Vložit části třídy"
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr "Implementace"
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr "Rozhraní"
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr "Vložit implementace metod"
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr "Vložit do sekce použitých jednotek"
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Vložit mezeru po"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Vložit mezeru před"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Interval v sekundách"
|
|
|
|
#: lazarusidestrconsts.dlgjumpcodeblockpos
|
|
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
|
|
msgstr "Svislá pozice pro skok na blok kódu v % (0=vrch, 100=spodek)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Skákání (např. metoda skákání)"
|
|
|
|
#: lazarusidestrconsts.dlgjumpsinglelinepos
|
|
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
|
|
msgstr "Svislá pozice pro skok na jednu řádku v % (0=vrch, 100=spodek)"
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr "Skočit přímo do těla metody"
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep caret X position when navigating up/down"
|
|
msgstr "Udržovat x-ovou pozici kurzoru, při navigaci nahoru/dolů"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr "(Upravit klávesu)"
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Mapování kláves"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Chyba mapování kláves"
|
|
|
|
#: lazarusidestrconsts.dlgkeyword
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgkeyword"
|
|
msgid "Keyword"
|
|
msgstr "Klíčové slovo"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Politika klíčových slov"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Povolit LABEL a GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Jazyk"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Poslední (např. na konci zdrojového kódu)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Adresář Lazarusu (výchozí pro všechny projekty)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusinstances
|
|
msgid "Lazarus instances"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "Vodící čáry Vlevo, Nahoře"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
#, fuzzy
|
|
#| msgid "1 (quick, debugger friendly)"
|
|
msgid "1 (quick, debugger friendly with small limitations)"
|
|
msgstr "1 (rychlé a přátelské k ladění)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr "2 (-O1 + rychlá optimalizace)"
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "3 (-O2 + pomalé optimalizace)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr "4 (-O3 + agresivní optimalizace, opatrně)"
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
#, fuzzy
|
|
#| msgid "0 (no optimization)"
|
|
msgid "0 (no optimization, for debugging)"
|
|
msgstr "0 (bez zvláštní optimalizace)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Dělení řádků"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
msgid "Link smart"
|
|
msgstr "Chytré spojování"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
msgid "View Project Forms"
|
|
msgstr "Zobrazit formuláře projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View Project Frames"
|
|
msgstr "Zobrazit rámce projektů"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
|
msgid "View Project Units"
|
|
msgstr "Zobrazit jednotky projektu"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr "spustitelné pomocí \"Make\""
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr "Spravovat plochy"
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Okraj a žlábek"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Barva značkovače"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
|
|
#, object-pascal-format
|
|
msgid "(%s sec delay after caret move)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupfoldcolor
|
|
msgid "Vertical-mark"
|
|
msgstr "Svislá-značka"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
msgid "Highlight all occurrences of Word under Caret"
|
|
msgstr "Zvýraznění všechny výskyty slova pod kurzorem"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
msgid "Outline (global)"
|
|
msgstr "Obrys (celkový)"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
|
|
msgid "Warning: There are no colors configured for the selected language"
|
|
msgstr "Varování: Pro vybraný jazyk nejsou nastaveny barvy"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr "Uživatelem definované zvýraznění syntaxe"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Odstranit"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
#, object-pascal-format
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr "Odstranit seznam \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivedit
|
|
msgid "Edit list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
#, fuzzy
|
|
#| msgid "Add Word or Term"
|
|
msgid "Add Word or Term by key"
|
|
msgstr "Přidat slovo nebo označení"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
#, fuzzy
|
|
#| msgid "Remove Word or Term"
|
|
msgid "Remove Word or Term by key"
|
|
msgstr "Odebrat slovo nebo označneí"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
#, fuzzy
|
|
#| msgid "Toggle Word or Term"
|
|
msgid "Toggle Word or Term by key"
|
|
msgstr "Přehodit slovo nebo označení"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivselect
|
|
msgid "Create or Select list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr "Duplikovat slovo nebo označení"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
#, object-pascal-format
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr "Označení %s už existuje. Duplicity budou odstraněny při uložení seznamu."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr "Přidat/Odebrat ve všech editorech"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr "Odstranit seznam"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Jméno"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr "Přidat seznam"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr "Rozlišovat velikost písmen"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr "Nastavit ohraničení na konci pojmu"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr "Nastavit ohraničení na začátku pojmu"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr "Ignorovat ohraničení pro pojmy delší než"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr "výběr"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr "aktuální slovo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr "Nastavení pro označení přidaná podle klíče"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr "Inteligentní shoda hranice výběru"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr "Nový seznam"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr "Žádné seznamy"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr "Vybrat ..."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
#, fuzzy
|
|
#| msgid "Key Settings"
|
|
msgid "Key mappings"
|
|
msgstr "Nastavení kláves"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr "Hlavní nastavení"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Keyword brackets on caret (global)"
|
|
msgstr "Závorky klíčového slova na pozici kurzoru (celkově)"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match whole words, if length is less or equal to:"
|
|
msgstr "Shoda celých slov, pokud délka je menší nebo stejná:"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordkeycombo
|
|
#, object-pascal-format
|
|
msgid "Markup current word by key: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr "Ignorovat klíčová slova"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
|
|
msgid "Automatically markup current word on caret move"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr "Oříznout mezery (při zvýraznění aktuálního výběru)"
|
|
|
|
#: lazarusidestrconsts.dlgmatchwords
|
|
msgid "Match words"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maximum čítače"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Max. délka řádku:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Maximum nedávných souborů"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecenthint
|
|
msgid "Value 0 means unlimited."
|
|
msgstr "Hodnota 0 znamená neomezeně."
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Maximum nedávných souborů projektů"
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
|
|
msgid "Middle-click-modifier to close all other tabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
|
|
msgid "Middle-click-modifier to close tabs on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Slučovat metody a vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgmode
|
|
msgid "Mode"
|
|
msgstr "Režim"
|
|
|
|
#: lazarusidestrconsts.dlgmodifier
|
|
msgid "Modifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr "Akce myši"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr "Jednoduchý"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr "Dvojitý"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr "Trojitý"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr "Čtyřnásobný"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr "Jakékoliv"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr "Extra 1"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr "Extra 2"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "Vlevo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr "Uprostřed"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr "Předat řízení"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "Vpravo"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr "Kolečko dolů"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
|
|
msgid "Wheel left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
|
|
msgid "Wheel right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr "Kolečko nahoru"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr "Zachytit"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr "Přesunout kurzor (extra)"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr "Reaguj při uvolnění tlačítka myši"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Akce"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr "Klik"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr "Úpravy myši"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr "Zdvojená položka"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr "Tento záznam je v konfliktu s existujícím záznamem"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr "Tlačítko"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
|
|
msgid "Caret"
|
|
msgstr "Kurzor"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr "Obsah"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr "Klik"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Akce"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr "Nahoru/dolů"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr "Volba"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Řadit"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr "Myš"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr "Pokročilé"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr "Příkaz-IDE"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr "n"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr "A"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr "A"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr "Všechno"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr "Žlábek"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr "Změny řádků"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr "Svinout strom"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr "Zasunuto [+]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr "Roztaženo [-]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr "Přehled"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
msgid "Overview Mark"
|
|
msgstr "Přehledová značka"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr "Čísla řádek"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Text"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Výběr"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr "Opt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr "Jiné akce použitím stejného tlačítka"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr "Můžou být spouštěny v závislosti na modifikační klávese, nastavení předání řízení, jednoduché/dvojité, nahoru/dolu ..."
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr "Filtrovat modifikační klávesy"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Ladění"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr "Fatální"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr "Tip"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr "Důležité"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr "Normální"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr "Poznámka"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr "Panika"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr "Čas a statistiky"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr "Výřečný"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr "Výřečně 2"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr "Výřečně 3"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Varování"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Navigation keys move all carets (column-select)"
|
|
msgstr "Kurzorové klávesy přesouvají všechny kurzory (vybraného sloupce)"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretdelskipcr
|
|
msgid "Skip delete key at EOL (do not join lines)"
|
|
msgstr "Přeskočit klávesu delete na konci řádku (nespojovat řádky)"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretgroupoptions
|
|
msgid "Multi-caret"
|
|
msgstr "Více-kurzor"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Navigation keys move all carets"
|
|
msgstr "Kurzorové klávesy přesouvají všechny kurzory"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi-caret for column selection"
|
|
msgstr "Povolit více vsuvek pro výběr sloupce"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr "vždy startovat novou instanci"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr "nepovolit více instancí"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr "otevřít soubory běžící instance"
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Vícenásobný výběr"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Jump target priority between multiple editors"
|
|
msgstr "Skočit na cílovou prioritu mezi více editory"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr "Pořadí použití kritérií pro nalezení vhodného editoru"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr "Posledně aktivní editor pro tento soubor"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr "Editor (souboru) v posledně aktivním okně"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr "Seznam priorit kritérií pro výběr editoru:"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr "Stránky a okna"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr "Záložky zápisníku"
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Pojmenování"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr "Nová plocha ..."
|
|
|
|
#: lazarusidestrconsts.dlgnewprojecttype
|
|
msgid "New Project Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
msgid "No automatic renaming"
|
|
msgstr "Automaticky nepřejmenovávat"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr "Žádná dostupná jednotka k přidání."
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr "Bez zvýrazňování"
|
|
|
|
#: lazarusidestrconsts.dlgnonformbackgroundcolor
|
|
msgid "Other Designer background (e. g. TDataModule)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr "Umístění záložky zdrojového zápisníku"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
msgid "Do not split line after"
|
|
msgstr "Nerozdělovat řádek po"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
msgid "Do not split line in front of"
|
|
msgstr "Nerozdělovat řádek před"
|
|
|
|
#: lazarusidestrconsts.dlgnsprincipalclass
|
|
msgid "NSPrincipalClass"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor objektů"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Výška položky (0 = automaticky)"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Různé"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr "Nastavení rychlosti"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr "Použít výchozí nastavení Delphi"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr "Použít výchozí nastavení Lazarusu"
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendeditdebuggerbackend
|
|
msgid "Edit debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendselectdebuggerbackend
|
|
msgid "Select debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptdebugbackendtheprojectoptionshavebeen
|
|
msgid "The project options have been set to use a different debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr "Úrovně optimalizace"
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrap
|
|
msgid "Word-wrap"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapallhl
|
|
msgid "Select all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapcheckfixedlength
|
|
msgid "Wrap at fixed column"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapdisplaycaretatwrappositio
|
|
msgid "Display caret at wrap-position..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapendofline
|
|
msgid "end of line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapfixedlinelength
|
|
msgid "Fixed line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwraphomeendkey
|
|
msgid "Force default home/end keys to subline start/end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindent
|
|
msgid "Indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentisoffset
|
|
msgctxt "lazarusidestrconsts.dlgoptwordwrapindentisoffset"
|
|
msgid "Indent relative to text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmax
|
|
msgid "Maximum indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmaxrel
|
|
msgid "Maximum indent width (percent)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapindentmin
|
|
msgid "Minimum indent width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapmaximumlinelength
|
|
msgid "Maximum line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapminimumlinelength
|
|
msgid "Minimum line length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapnonehl
|
|
msgid "Clear selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapsectioncolumn
|
|
msgid "Wrap column settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapsectionindent
|
|
msgid "Indent settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapstartofnextline
|
|
msgid "start of next line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoptwordwrapusewordwrap
|
|
msgid "Use Word-wrap"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr "Ostatní optimalizace"
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Jiné soubory jednotek (-Fu)"
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback1color
|
|
msgid "Background 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterback2color
|
|
msgid "Background 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewguttercolor
|
|
msgid "Overview Gutter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
|
|
msgid "Page"
|
|
msgstr "Strana"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr "Přepsání bloku"
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "Desktop with the name \"%s\" was found.\n"
|
|
#| "Should the old desktop be overwritten?\n"
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?"
|
|
msgstr ""
|
|
"Nalezena plocha se jménem \"%s\".\n"
|
|
"Má být stará plocha přepsána?\n"
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Popisky pro paletu komponent"
|
|
|
|
#: lazarusidestrconsts.dlgpascaselabelforotherwise
|
|
msgid "Color otherwise/else as case-label"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmode
|
|
msgid "Extend of type-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodeident
|
|
msgid "Identifier only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeyandsym
|
|
msgid "All, including symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodekeywords
|
|
msgid "Identifier, built-in and keywords"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypeattrmodenames
|
|
msgid "Identifier and built-in (types/values)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemode
|
|
msgid "Extend of initial-value-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasdeclaredtypevaluemodeliteral
|
|
msgid "Include literals (Number, String) in initial-value-highlight in declarations"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
msgid "Default Pascal extension"
|
|
msgstr "Výchozí přípona pascalu"
|
|
|
|
#: lazarusidestrconsts.dlgpasexthighlightgroup
|
|
msgid "Extended Pascal Highlight Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
#, fuzzy
|
|
#| msgid "Highlight control statements as keywords"
|
|
msgid "Highlight flow control statements (break, continue, exit) as keywords"
|
|
msgstr "Zvýraznit ovládací příkazy jako klíčová slova"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
msgid "Markup (on caret)"
|
|
msgstr "Značky (na kurzoru)"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr "Odpovídající klíčová slova"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr "Obrys"
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Předat nastavení spojovači s \"-k\", mezera je oddělovač"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
#, fuzzy
|
|
#| msgid "Highlight \"String\" keyword(s)"
|
|
msgid "Highlight \"String\" types as keyword"
|
|
msgstr "Zvýraznit klíčové slovo \"String\""
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Výchozí"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Žádné"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr "Pouze \"String\""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr "Trvalý blok"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Visible caret in unfocused editor"
|
|
msgstr "Viditelný kurzor v neaktivním editoru"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursornoblink
|
|
msgid "Caret in unfocused editor does not blink"
|
|
msgstr "Kurzor nebliká v neaktivním okně"
|
|
|
|
#: lazarusidestrconsts.dlgpoansiutf8
|
|
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Aplikace"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr "jako vyvolávající (asInvoker)"
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "&Clear Icon"
|
|
msgstr "Vyčistit ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Vytvořit aplikační balík"
|
|
|
|
#: lazarusidestrconsts.dlgpodebugger
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgpodebugger"
|
|
msgid "Debugger"
|
|
msgstr "Ladič"
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr "Načíst &defaultní"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr "DPI připravenost"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr "vypnuto"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr "Vista-8: vypnuto, 8.1+: podle monitoru"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr "Vista-8: zapnuto, 8.1+: podle monitoru"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
|
|
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
|
|
msgstr "Vista-8: zapnuto, 8.1/10+: podle monitoru/V2"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr "zapnuto"
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr "Úroveň spouštění"
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Formuláře"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr "nejvyšší možné (highestAvailable)"
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr "i18n"
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Ikona:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
#, object-pascal-format
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(velikost: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr "(žádné)"
|
|
|
|
#: lazarusidestrconsts.dlgpointertypecheck
|
|
msgid "@<pointer> returns a typed pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "&Load Icon"
|
|
msgstr "Načíst ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgpolongpathaware
|
|
msgid "Long path awareness (Windows 10 1607+)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Různé"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr "vyžaduje administrátora (requireAdministrator)"
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr "Zdroje"
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "&Save Icon"
|
|
msgstr "Uložit ikonu"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sezení"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Nadpis:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr "UI přístup (uiAccess)"
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Použít aplikační balík pro spuštění a ladění"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr "Použít změnu měřítka LCL (Hi-DPI)"
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Použít manifest (a povolit témata)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr "Raději dvojklik místo jednoho kliku"
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr "Priority"
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
#, object-pascal-format
|
|
msgid "Options for Project: %s"
|
|
msgstr "Volby pro projekt %s"
|
|
|
|
#: lazarusidestrconsts.dlgprojecttoopenorcreate
|
|
msgid "Project to Open or Create"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
msgid "Project Files"
|
|
msgstr "Soubory projektu"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt on replace"
|
|
msgstr "&Dotázat se při nahrazení"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Dokončení vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Jméno vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Otevřít poslední projekt a balíčky při startu"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Ukázat mezery od okrajů"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Zobrazit mřížku"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Přichytit k mřížce"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
#, object-pascal-format
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr "Opravdu odebrat plochu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.dlgredirappend
|
|
msgid "To file (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirinput
|
|
msgid "From file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirinputend
|
|
msgid "From file (at EOF)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrediroff
|
|
msgid "No redirection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrediroverwrite
|
|
msgid "To file (overwrite)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstderr
|
|
msgid "Redirect StdErr"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdin
|
|
msgid "Redirect StdIn"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdnotsupported
|
|
msgid "Current debugger does not support redirection."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgredirstdout
|
|
msgid "Redirect StdOut"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Odkazy"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Regulární výrazy"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr "Přejmenovat plochu"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
|
msgid "Rename"
|
|
msgstr "Přejmenování"
|
|
|
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
|
msgid "Rename selected desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Nahradit &vše"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
msgid "Replace wit&h"
|
|
msgstr "&Nahradit s"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Hlášení"
|
|
|
|
#: lazarusidestrconsts.dlgreset
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgreset"
|
|
msgid "Reset"
|
|
msgstr "Nulovat"
|
|
|
|
#: lazarusidestrconsts.dlgresetactivedesktopbtncaption
|
|
msgid "Restore active"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetactivedesktopbtnhint
|
|
msgid "Restore window layout of active desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgresetall
|
|
msgid "Reset all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "Vodící čáry Vpravo, Dole"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
msgid "Right click selects"
|
|
msgstr "Pravý klik provede výběr"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Pravý okraj"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Pracovní adresář"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr "Pravý klik provede výběr"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
msgid "Rubberband Creation"
|
|
msgstr "Vytváření vodících linek"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
|
msgid "Rubberband Selection"
|
|
msgstr "Výběr vodících linek"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "The running Lazarus instance cannot accept any files.\n"
|
|
#| "Do you want to open them in a new IDE instance?\n"
|
|
#| "\n"
|
|
#| "%s\n"
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s"
|
|
msgstr ""
|
|
"Běžící instance Lazarusu nepřijímá řádné soubory.\n"
|
|
"Chcete je otevřít v nové instanci IDE?\n"
|
|
"\n"
|
|
"%s\n"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr "Instance Lazarusu běží, ale neodpovídá."
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Prostředí"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Místní"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Systémové proměnné"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Použít zobrazení"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Uživatelské předefinování"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
msgid "Run Parameters"
|
|
msgstr "Spustit s parametry"
|
|
|
|
#: lazarusidestrconsts.dlgrunwithdebug
|
|
msgid "Run uses the debugger (disable for release-mode)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktop
|
|
msgid "Save current desktop"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr "Uložit aktuální plochu jako"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
|
|
msgid "Save active desktop as ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
|
|
msgid "Save active desktop as"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr "Uložený řádek"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Ukládat informace editoru pro zavřené soubory"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr "Soubory jsou dostupné v seznamu historie \"Otevřít nedávné\"."
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Ukládat informace editoru pouze pro soubory projektu"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr "Pouze soubory patřící do tohoto projektu."
|
|
|
|
#: lazarusidestrconsts.dlgsavein
|
|
msgid "Save in"
|
|
msgstr "Uložit v"
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
|
|
msgid "Force 1024 columns minimum for horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolnone
|
|
msgid "Do not add any permanent space to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbarpasteolpage
|
|
msgid "Always add one page to horizontal scroll range"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Posunout o jedno méně"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr "Posouvání"
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Ukázat pokyny posuvníku"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Posouvání za konec souboru"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
#, fuzzy
|
|
#| msgid "Allow caret to move past end of line"
|
|
msgid "Allow Caret to move past the end of line"
|
|
msgstr "Povolit kurzoru přesunutí za konec řádku"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr "Vyhledávací adresář \"%s\" nenalezen."
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Hledání přerušeno uživatelem."
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
msgid "Searching ..."
|
|
msgstr "Hledání ..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Cesty"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr "Rozsah hledání"
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr "Vybrat všechny dětské prvky s jejich rodičem."
|
|
|
|
#: lazarusidestrconsts.dlgselectallnoscroll
|
|
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected text"
|
|
msgstr "&Vybraný text"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
|
|
msgid "Set active"
|
|
msgstr "Nastavit aktivní"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
|
|
msgid "Set active"
|
|
msgstr "Nastavit aktivní"
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Nastavit všechny prvky na výchozí"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Nastavit prvek na výchozí"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Nastavit hodnotu vlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr "Jméno parametru pro výchozí nastavovač procedury."
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr "je prefix"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr "Pokud zaškrtnuto, pak je předpona \"Nastavit proměnnou vlastnosti\". Jinak je pevné jméno."
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr "použít const"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr "Pokud zaškrtnuto, nastavovací parametr je označen jako \"const\"."
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr "Ukázat všechny jednotky"
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of nonvisual components"
|
|
msgstr "Ukázat titulky neviditelných komponent"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Ukázat přeložené procedury"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Ukázat čísla řádků"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Ukázat podmínky"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Ukázat ladící informace"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr "Ukázat tipy návrháže"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr "Pokyn ukazuje pozici prvku nebo velikost během přesunu nebo změny jeho velikosti."
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Ukázat vše"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Ukázat spustitelné informace (pouze Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr "Ukázat jméno souboru v popisku"
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Ukázat obecné informace"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Ukázat pokyny žlábku"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Ukázat tipy"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr "Ukazují se okna"
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Ukázat čísla řádků"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr "Ukázat ikony zpráv"
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
msgid "Show notes"
|
|
msgstr "Ukázat poznámky"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Ukázat zkoušené soubory"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Ukázat použité soubory"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
msgid "Show warnings"
|
|
msgstr "Ukázat varování"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr "Ukázat jedno tlačítko v Panelu úloh"
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr "Přeskočit dopředné deklarace tříd"
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr "Lomítko //"
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Chytré záložky"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Symbol za (.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Čítač (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Symbol ve předu (.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Přichycovat k vodícím čarám"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr "Když je prvek blízko k zarovnání s jiným prvkem, přilne k zarovnané pozici."
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr "Víceřádkové tabelátory"
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Mezery"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Tipy pro hlavní tlačítka (Otevřít, Uložit, ...)"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedcolorlabelinthesourceareonlyco
|
|
msgid "Label in the source are only colored if the colon \":\" is placed immediately after the label."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrcedcolormembercolorisappliedtoany
|
|
msgid "\"Member\" color is applied to any identifier behind a dot \".\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Původ"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr "Velikost zásobníku"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Zastavit po počtu chyb:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr "Připojit text k uzavíracímu řetězci"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr "Předpona řetězců na novém řádku"
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr "Řetězec ''"
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineafterfirst
|
|
msgid "Align second line (after first break) with the position of the lowest matching group in the pattern, or the match position of the pattern itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignalignsecondlineregex
|
|
msgid "Align second line (reg-ex):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringcontalignmaxindentforsecondlineifb
|
|
msgid "Max indent for second line if based on reg-ex:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr "Rozšířit řetězce na zalomení"
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr "Podvlastnosti"
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Nastavení syntaxe"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tab odsazuje bloky"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr "Ukázat čísla záložek v zápisníku"
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tabulátor k mezerám"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Šířka záložek"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "Cílová rodina CPU"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Cílový OS"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
msgid "Target platform"
|
|
msgstr "Cílová platforma"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Cílový procesor"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr "Volby specifické pro Cíl"
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Adresář pro sestavení pokusných projektů"
|
|
|
|
#: lazarusidestrconsts.dlgtextstyle
|
|
msgid "Text-Style"
|
|
msgstr "Styl textu"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
#, fuzzy
|
|
#| msgid "&Text to find"
|
|
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
|
msgid "Search s&tring"
|
|
msgstr "Hledaný &Text"
|
|
|
|
#: lazarusidestrconsts.dlgthiselementusescolor
|
|
msgid "The element uses (and edits) the schemes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Přepnout jako ladící plochu"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Přepnout jako ladící plochu"
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr "Tip aktuální třídy/procedury"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr "Styl ořezání mezer"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr "Vsuvka nebo úprava"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr "Řádek upravený"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr "Nechat řádek"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr "Pouze pozice"
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Odstranit okrajové mezery"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Navrátit zpět po uložení"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr "Vrátit zpět / Znovu opakovat"
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Omezení vrátitelných akcí"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Obnovit"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Výstupní adresář jednotky (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr "Neuložený řádek"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
msgid "Code Folding"
|
|
msgstr "Skládání bloků kódu"
|
|
|
|
#: lazarusidestrconsts.dlguseconsolebuffer
|
|
msgid "Set Columns/Rows"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseconsolepos
|
|
msgid "Set Left/Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseconsolesize
|
|
msgid "Set Width/Height"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr "Použít přídavný Konfigurační soubor překladače"
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr "Kreslení oddělovače"
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts.dlgusehighlight
|
|
msgid "Use Highlight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlguseiconsincompletionbox
|
|
msgid "Icons in code completion box"
|
|
msgstr "Ikony v boxu doplňování kódu"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Použít spouštěcí aplikaci"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr "IME obsluhováno systémem"
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
#, object-pascal-format
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr "Chyba při nahrávání uživatelského schéma ze souboru %s"
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
#, fuzzy
|
|
#| msgid "Use (and edit) global scheme settings"
|
|
msgid "- Scheme globals -"
|
|
msgstr "Použít (a upravit) nastavení globálního schéma"
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
#, fuzzy
|
|
#| msgid "Use local scheme settings"
|
|
msgid "selected language"
|
|
msgstr "Použít nastavení místního schéma"
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Použít zvýraznění syntaxe"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr "Použít historii záložek při zavření záložky"
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr "Přidat jednotku do sekce použitých jednotek"
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Hodnota"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Užvaněnost během překládání:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Viditelný žlábek"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Viditelný pravý okraj"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr "&Pouze celková slova"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Šířka:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Win32 GUI aplikace"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgctxt "lazarusidestrconsts.dlgwindow"
|
|
msgid "Window"
|
|
msgstr "Okno"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr "Výjimky"
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Slova"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Náhled"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write FPC logo"
|
|
msgstr "Vypsat FPC logo"
|
|
|
|
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
|
|
msgid " (Ignoring project settings below)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreconverterconfiginses
|
|
msgid "Store converter config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoredispformatconfiginses
|
|
msgid "Store display formats config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreformatterconfiginses
|
|
msgid "Store formatter config in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
|
|
msgid "Store project debugger configs in session"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthedebuggerbackendselecti
|
|
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
|
|
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
|
|
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
|
|
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsuseideglobaldispformats
|
|
msgid "Use the IDEs-global display formats"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsuseprojecfdispformats
|
|
msgid "Use the projects display formats"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheidegloballistofconv
|
|
msgid "Use the IDE-Global list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheidegloballistofformatter
|
|
msgid "Use the IDE-Global list of formatters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheprojectlistofconver
|
|
msgid "Use the project list of converters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusetheprojectlistofformatter
|
|
msgid "Use the project list of formatters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
|
|
msgid "Using IDE default debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.drsusingselectedidedebuggers
|
|
msgid "Using selected IDE debugger settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Hromadně vybrané komponenty musí být z jednoho formuláře."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr "Zarovnat ..."
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr "Smazat sekci"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Zrcadlit vodorovně"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
msgid "Mirror Vertical"
|
|
msgstr "Zrcadlit svisle"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back One"
|
|
msgstr "Zpět o jeden"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward One"
|
|
msgstr "Dopředu o jedno"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to Back"
|
|
msgstr "Přesunout dozadu"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to Front"
|
|
msgstr "Přesunout dopředu"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr "Nulovat ..."
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
msgid "Save Form as XML"
|
|
msgstr "Uložit formulář jako XML"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr "Měřítko ..."
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Měřítko"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrat vše"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr "Velikost ..."
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Velikost"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Volba: Přitáhnout k mřížce"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Volba: Přitáhnout k vodícím čarám"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr "Z-pořadí"
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr "Na obou stranách"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugchangepath
|
|
msgid "Change path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
|
|
msgid "Error: The backend is not configured."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
|
|
msgid "(The configured backend's package is not installed.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
|
|
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
|
|
msgid "Hint: The backend type is OK, but not the recommended type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
|
|
msgid "Create a new recommended backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugcurrent
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuální"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
|
|
msgid "The selected backend uses the external executable:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
|
|
#, object-pascal-format
|
|
msgid "The selected backend requires an external executable: \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
|
|
#, object-pascal-format
|
|
msgid "Default for your OS/Arch is: \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugignore
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugignore"
|
|
msgid "Ignore"
|
|
msgstr "Ignorovat"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugkeepbackend
|
|
msgid "Keep backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugnew
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.initdlgdebugnew"
|
|
msgid "New"
|
|
msgstr "Nový"
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
|
|
msgid "Error: External executable is a directory, not a file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
|
|
msgid "Error: External executable not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
|
|
msgid "Error: External file is not executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
|
|
msgid "Error: No default for external executable found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
|
|
msgid "Error: No external executable specified."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugpopupinformation
|
|
#, object-pascal-format
|
|
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
|
|
msgid "Select an existing backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
|
|
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
|
|
#, object-pascal-format
|
|
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
|
|
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
|
|
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
|
|
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstatesetupok
|
|
msgid "Setup is OK."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
|
|
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr "0 = nic, 1 = vykreslit dělící linky pouze pro nejvyšší úroveň, 2 = vykreslit linky pro první dvě nejvyšší úrovně, ..."
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Přidat soubory"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Nejednoznačný typ předka"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Víceznačné jméno třídy"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Víceznačné jméno jednotky"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor type"
|
|
msgstr "Typ předka"
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Porušená závislost"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Jméno třídy již existuje"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr "Vytvořit novou komponentu"
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Závislost"
|
|
|
|
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
|
|
msgid "Directory for unit file:"
|
|
msgstr "Adresář pro soubor jednotky:"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
#, object-pascal-format
|
|
msgid "Existing file: \"%s\""
|
|
msgstr "Existující soubor: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Soubor již existuje"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr "Soubor \"%s\" již v balíčku existuje."
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Soubor je použit"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename/URL"
|
|
msgstr "Jméno souboru/URL"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Soubor není jednotka"
|
|
|
|
#: lazarusidestrconsts.lisa2picon24x24
|
|
msgid "Icon 24x24:"
|
|
msgstr "Ikona 24x24:"
|
|
|
|
#: lazarusidestrconsts.lisa2picon36x36
|
|
msgid "Icon 36x36:"
|
|
msgstr "Ikona 36x36:"
|
|
|
|
#: lazarusidestrconsts.lisa2picon48x48
|
|
msgid "Icon 48x48:"
|
|
msgstr "Ikona 48x48:"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Neplatný typ předka"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr "Neplatná kruhová závislost"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Neplatné jméno třídy"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Neplatný soubor"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Neplatné jméno souboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Neplatné jméno jednotky"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "\"%s\" není platné jméno jednotky."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Nové jméno třídy:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Nový soubor"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
#, object-pascal-format
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Pro závislost \"%s\" nebyl nalezen balíček.%sProsím vyberte existující balíček."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr "Balíček/Projekt"
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Jméno stránky je příliš dlouhé"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette page:"
|
|
msgstr "Stránka palety:"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Zkrátit nebo rozšířit jméno souboru"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Ukázat vše"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Typ předka \"%s\" má stejné jméno jako %sjednotka \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Typ předka \"%s\" není platný paskalovský identifikátor."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Jméno třídy \"%s\" a typ předka \"%s\" jsou totožné."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Jméno třídy \"%s\" již existuje v%sBalíčku %s%sSoubor: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Jméno třídy \"%s\" má stejné jméno jako %sjednotka \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
#, object-pascal-format
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Jméno třídy \"%s\" není platný identifikátor pascalu."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Soubor \"%s\" je částí aktuálního projektu.%sSdílet soubory mezi projekty a balíčky je špatný nápad."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Jméno souboru \"%s\" je nejednoznačné, protože balíček zatím nemá předvolený adresář.%sProsím zadejte jméno souboru s úplnou cestou."
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximální verze je nižší než Minimální verze."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
#, object-pascal-format
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Balíček již má závislost na balíčku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
#, object-pascal-format
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Jméno stránky \"%s\" je příliš dlouhé (max. 100 znaků)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Jméno jednotky \"%s\" již v balíčku existuje:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
#, object-pascal-format
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "Jméno jednotky \"%s\" již existuje v tomto balíčku."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Jméno jednotky \"%s\"%sa jméno souboru \"%s\" se liší."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Jméno jednotky \"%s\" je stejné jaké má registrované komponenta.%sToto použití může způsobit podivná chybová hlášení."
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit name:"
|
|
msgstr "Jméno jednotky:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Jméno jednotky už existuje"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Zrušit změny?"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Přerušit celé načítání"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr "Zrušeno"
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Přerušit načítání projektu"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr "O aplikaci"
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
#, object-pascal-format
|
|
msgid "About %s"
|
|
msgstr "Informace o %s"
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentace:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr "O IDE"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "O Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
|
|
msgstr "Licence: GPL/LGPL%sLazarus je IDE pro tvorbu (grafických a konzolových) aplikací s Free Pascalem. Free Pascal je (L)GPL Pascal a Object Pascal překladač, který běží ve Windows, Linuxu, Mac OS X, FreeBSD a jiných.%sLazarus je chybějící částí skládačky, která umožní vytvářet programy pro všechny výše uvedené platformy v prostředí podobném Delphi. IDE je RAD nástroj, který zahrnuje návrháře formulářů.%sVzhledem k tomu, že Lazarus roste, potřebujeme více vývojářů."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Nelze nalézt seznam přispěvatelů."
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr "Oficiální:"
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
#, object-pascal-format
|
|
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
|
|
msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze nevizuální komponenty."
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Poděkování"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr "Akce:"
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr "Aktivovat"
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)"
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr "Aktivovat vybrané"
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr "Aktivní"
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktivní filtr"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
|
|
msgid "Add a new separator above selected item"
|
|
msgstr "Přidat oddělovač nad vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
|
|
msgid "Add a new separator below selected item"
|
|
msgstr "Přidat oddělovač pod vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr "Přidat definice simulující Delphi7"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr "Užitečné, když má kód kontroly pro podporované verze překladače"
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
#, object-pascal-format
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr "Přidán chybějící objekt \"%s\" do zdroje pascalu."
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
#, object-pascal-format
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr "Přidána vlastnost \"%s\" pro %s."
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr "Přidat -FcUTF8"
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr "Může být potřeba pokud zdrojové soubory mají ne-ansi znaky v řetězcích."
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr "Přidat Filtr ..."
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr "Přídavek nevyhovuje aktuální zprávě"
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr "Přídavek vyhovuje aktuální zprávě"
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr "Přídavky"
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr "Přidat klíčové slovo \"do\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverload
|
|
msgid "Add modifier \"overload\""
|
|
msgstr "Přidat modifikátor \"overload\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifieroverride
|
|
msgid "Add modifier \"override\""
|
|
msgstr "Přidat modifikátor \"override\""
|
|
|
|
#: lazarusidestrconsts.lisaddmodifierreintroduce
|
|
msgid "Add modifier \"reintroduce\""
|
|
msgstr "Přidat modifikátor \"reintroduce\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
#, object-pascal-format
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr "Přidat nové sestavovací makro, kopírovat nastavení z \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewdiskfiles
|
|
msgid "Add new disk files?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
|
|
msgid "Add New Files from File System"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr "Přidat nové makro"
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr "Přidat novou sadu"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr "Přidat požadavky balíčku?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
#, fuzzy
|
|
#| msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr "přidat balíček (balíčky) do seznamu instalovaných balíčků (použijte s --build-ide k opětovnému sestavení IDE)"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr "Přidat balíček do projektu"
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr "Přidat závorky parametru"
|
|
|
|
#: lazarusidestrconsts.lisaddthefollowingfiles
|
|
msgid "Add the following files:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr "Přidat do cesty hledání \"include\"?"
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
#, object-pascal-format
|
|
msgid "Add %s to project?"
|
|
msgstr "Přidat %s do projektu?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr "Přidat do spouštěných komponent?"
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Přidat do cesty hledání jednotek?"
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr "Přidat rozhraní jednotky"
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr "Přidat jednotku (nedoporučeno)"
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
#, object-pascal-format
|
|
msgid "Add value to macro %s"
|
|
msgstr "Přidat hodnotu do makra %s"
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
msgid "Add File to Package"
|
|
msgstr "Přidat soubor do balíčku"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
msgid "Destination package"
|
|
msgstr "Cílový balíček"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
msgid "File type"
|
|
msgstr "Typ souboru"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Neplatný balíček"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
#, object-pascal-format
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Neplatné ID balíčku: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Balíček je pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Balíček \"%s\" nenalezen."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Ukázat vše"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
#, object-pascal-format
|
|
msgid "The package %s is read only."
|
|
msgstr "Balíček %s je pouze pro čtení."
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
#, object-pascal-format
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr "Filtr pojmenovaný \"%s\" už existuje."
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr "Po vyčištění (vyčistit vše nebo vyčistit běžné soubory) přepnout na automatické čištění"
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Zarovnání"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
msgid "All blocks look ok."
|
|
msgstr "Všechny bloky vypadají dobře."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr "<Všechny módy sestavení>"
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr "Všechny zděděné volby"
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "All Options"
|
|
msgid "All options of FPC%s (\"%s\")"
|
|
msgstr "Všechny možnosti"
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Povolit vyhledávání více řádků"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr "Všechny parametry této funkce jsou již v tomto volání nastaveny. Není co přidat."
|
|
|
|
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
|
|
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
#, object-pascal-format
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr "Všechny vaše úpravy v \"%s\"%sbudou ztraceny a soubor bude otevřen znovu."
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr "Alpha"
|
|
|
|
#: lazarusidestrconsts.lisalreadycontainsthehe
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"%s already contains the help:\n"
|
|
"%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr "Alternativní klávesa"
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr "Alternativní klávesa (nebo sekvence dvou kláves)"
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr "Vždy převést navrhované přednastavené jméno souboru na malá písmena"
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr "Vybrané položky se vždy vykreslí zaměřené"
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr "Vždy ignorovat"
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr "Makro s tímto názvem již existuje."
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Nalezen nejasný soubor"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
#, object-pascal-format
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Nalezen nejednoznačný soubor: \"%s\"%sTento soubor může být chybě zaměněn za \"%s\"%sSmazat nejednoznačný soubor?"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ukotvit spodní okraj ke spodnímu okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ukotvit spodní okraj k hornímu okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Editor ukotvení - nevybrán žádný ovládací prvek"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
#, object-pascal-format
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "Povolený = Včetně %s v kotvách"
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ukotvit levý okraj k levému okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ukotvit levý okraj k pravému okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ukotvit pravý okraj k levému okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ukotvit pravý okraj k pravému okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
#, object-pascal-format
|
|
msgid "Anchors of %s"
|
|
msgstr "Kotvy %s"
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Ukotvení vybraného ovládacího prvku"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ukotvit horní okraj ke spodnímu okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ukotvit horní okraj k hornímu okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."
|
|
|
|
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
|
|
#, object-pascal-format
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr "Při posledním startu došlo k chybě při načítání %s!%sNačíst znovu tento projekt?"
|
|
|
|
#: lazarusidestrconsts.lisappearance
|
|
msgid "Appearance"
|
|
msgstr "Vzhled"
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr "&Jméno třídy aplikace"
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr "Grafická aplikace Free Pascalu používající více platformní knihovny pro své uživatelské prostředí."
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Použít"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
#, fuzzy
|
|
#| msgid "apply build flags (-B) to dependencies too"
|
|
msgid "Apply build flags (-B) to dependencies too."
|
|
msgstr "příznaky sestavení (-B) použít také pro závislosti"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr "Použít konvence"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr "Upravte jméno přípony a velikost znaků pro platformu a typ souboru."
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr "Jednotka projektu nemůže být použita jinými balíčky/projekty"
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Okrajový prostor kolem ovládacího prvku. Další čtyři okrajové prostory jsou přidány k této hodnotě."
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Zeptat před nahrazením každého nalezeného textu"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr "Zeptat se před uložením sezení projektu"
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr "Dotázat se na jméno komponenty po jejím umístění na návrhový formulář."
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr "Zeptat se na jméno souboru při novém souboru"
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr "Zeptat se na jméno při vytvoření"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr "Automaticky upravit výšku hlavního okna IDE"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr "Ukázat celou paletu komponent"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr "Pokud je paleta komponent roztažena přes více řádek, zobrazit je všechny a ne pouze jednu."
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr "Automatické dokončení: vypnuto"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr "Automatické dokončení: zapnuto"
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr "Značky a párování"
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr "Automaticky"
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr "Automaticky"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr "Automaticky převést soubory .lfm na soubory zdrojů .lrs"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr "nedokončovat výběr"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr "Automaticky vyvolat po bodu"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontype
|
|
msgid "Automatically invoke on typing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
|
|
msgid "Only complete if word is longer or equal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
|
|
msgid "Only complete when at end of word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
|
|
msgid "Use completion box delay"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr "odsazení řádku"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "mezera"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr "tabulátor"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "konec slova"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr "nepřidávat znak"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr "Automaticky použít jediný možný identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
msgid "Completion and Hints"
|
|
msgstr "Doplňování a Tipy"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Automaticky ukázat"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr "Dostupné k instalaci"
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
#, fuzzy
|
|
#| msgid "Available project build modes:"
|
|
msgid "Available project build modes"
|
|
msgstr "Dostupné módy sestavení projektu:"
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr "Vytvářet zálohy změněných souborů"
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Zálohování souboru selhalo"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr "Vytvořit záložní adresář pod adresářem projektu"
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
#, object-pascal-format
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Změna jména nebo verze balíčku naruší závislosti. Měly by být změněny také tyto závislosti?%sVyberte Ano ke změně všech uvedených závislostí.%sVyberte Ignorovat k porušení závislostí a pokračování."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "začátky"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr "Za vztaženými"
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
#, fuzzy
|
|
#| msgid "be less verbose, can be given multiple times"
|
|
msgid "Be less verbose. Can be given multiple times."
|
|
msgstr "buď méně výřečný, může být dáno vícekrát"
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
#, fuzzy
|
|
#| msgid "be more verbose, can be given multiple times"
|
|
msgid "Be more verbose. Can be given multiple times."
|
|
msgstr "buď víc výřečný, může být dáno vícekrát"
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr "Nejlépe zobrazíte instalací HTML ovládacího prvku jako turbopoweriprodsgn"
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
msgid "Always build before run"
|
|
msgstr "Vždy sestavit před spuštěním"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Sestavit povel"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Při sestavení projektu vykonej příkaz Souboru sestavení"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Pro spuštění projektu spusťte příkaz Spustit soubor"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Spustit příkaz"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Když je tento soubor aktivní v editoru"
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Pracovní adresář (nechejte prázdné pro cestu souboru)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Tlustě nevýchozí hodnoty"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "Border space"
|
|
msgstr "Okrajový prostor"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dolní"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Dolní okrajový prostor. Tato hodnota je přidána k základnímu okraji a je použita pro místo pod prvkem."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Dolní ukotvení"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Spodní části"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto je sourozenec prvku, k jehož dolní straně je ukotvený. Ponechte prázdné pro ukotvení k rodiči v Delphi stylu (BorderSpacing a ReferenceSide nehrají roli)"
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Dolní prostor stejnoměrně"
|
|
|
|
#: lazarusidestrconsts.lisbrowseandselectacompiler
|
|
msgid "Browse and select a compiler (e.g. ppcx64"
|
|
msgstr "Procházet a vybrat překladač (např. ppcx64)"
|
|
|
|
#: lazarusidestrconsts.lisbtnapply
|
|
msgid "&Apply"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Zavřít"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "&Nahradit..."
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr "&Najít"
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "U&končit"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Odstranit"
|
|
|
|
#: lazarusidestrconsts.lisbtnrename
|
|
msgid "&Rename"
|
|
msgstr "&Přejmenovat"
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr "&Nahradit"
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Sestavit"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
#, fuzzy
|
|
#| msgid "build all files of project/package/IDE"
|
|
msgid "Build all files of project/package/IDE."
|
|
msgstr "sestavit všechny soubory projektu/balíčku/IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Sestavit"
|
|
|
|
#: lazarusidestrconsts.lisbuilddate
|
|
msgid "Build Date"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr "Sestavit IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
#, fuzzy
|
|
#| msgid "build IDE with packages"
|
|
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
|
|
msgstr "sestavit IDE s balíčky"
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr "Sestavování"
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr "Sestavení Lazarusu selhalo"
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
#, object-pascal-format
|
|
msgid "Build Mode: %s"
|
|
msgstr "Režim sestavení: %s"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr "Rozdíly mezi sestavovacími módy"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr "Rozdíly s ostatními sestavovacími režimy"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr "Mód:"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
#, fuzzy
|
|
#| msgid "Build modes"
|
|
msgid "Build mode"
|
|
msgstr "Režimy sestavení"
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Sestavit nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build number"
|
|
msgstr "Číslo sestavení"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Sestavit"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr "Zaneprázdněn"
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
#, object-pascal-format
|
|
msgid "%s byte"
|
|
msgstr "%s bajt"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Zrušit načítání této komponenty"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Zrušit načítání jednotky"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Zrušit přejmenování"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr "Nelze přeložit projekt"
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Nelze zkopírovat komponentu na nejvyšší úrovni."
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
#, object-pascal-format
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Nelze vytvořit soubor \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotdeletelastmode
|
|
msgid "Cannot delete last mode."
|
|
msgstr "Nelze odstranit poslední režim."
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
#, object-pascal-format
|
|
msgid "cannot execute \"%s\""
|
|
msgstr "nelze spustit \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
#, object-pascal-format
|
|
msgid "Cannot find %s"
|
|
msgstr "Nelze najít %s"
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
#, object-pascal-format
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr "nelze najít spustitelný \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
#, object-pascal-format
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Nelze nalézt spouštěč Lazarusu:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
#, object-pascal-format
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr "Nelze otevřit formulář \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
#, object-pascal-format
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr "Nelze uložit formulář \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
#, object-pascal-format
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr "Nelze nahradit makro \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr "Nelze testovat překladač během ladění/překladu."
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Změnit lze pouze třídu dědící TComponent."
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
#, object-pascal-format
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr "Nelze najít validní %s.ppu"
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr "Porovnat soubory (nevytvářet záplaty)"
|
|
|
|
#: lazarusidestrconsts.liscaptionofactivebuildmode
|
|
msgid "Caption of active build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
#, object-pascal-format
|
|
msgid "%s (%s files)"
|
|
msgstr "%s (%s souborů)"
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
#, object-pascal-format
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr "Opravdu smazat %s zdrojových souborů%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
#, object-pascal-format
|
|
msgid "Change Class of %s"
|
|
msgstr "Změnit třídu %s"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "žádná třída"
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Víceznačný překladač"
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
#, object-pascal-format
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr "Prosím zkontrolujte adresář Test v %sNástroje -> Volby -> Soubory -> Adresář pro sestavení testovacích projektů"
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
#, object-pascal-format
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Překladač \"%s\" není spustitelný soubor.%sPodrobnosti: %s"
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "obsahuje "
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Zkopírovat výstup do schránky"
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
#, object-pascal-format
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr "Data.ppu souborů FPC se liší o víc než hodinu.%sTo může znamenat, že jsou z různých instalací.%sSoubor1: %s%sSoubor2: %s"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "CHYBA: "
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr "Cesta jednotky FPC obsahuje zdrojový kód: "
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "nové řádkové symboly"
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "POKYN: "
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Neplatný překladač"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Neplatná hledací cesta"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Neplatný testovací adresář"
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Chybějící jednotka"
|
|
|
|
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
|
|
#, object-pascal-format
|
|
msgid "RTL unit not found: %s"
|
|
msgstr "Jednotka RTL nenalezena: %s"
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "nalezeno více konfigurací překladače: "
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "nenalezen žádný fpc.cfg"
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "ne ASCII"
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
#, object-pascal-format
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu existuje dvakrát: %s, %s"
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
#, object-pascal-format
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Existující soubor .ppu je starší než překladač samotný:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
|
|
#, object-pascal-format
|
|
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
|
|
msgstr "Nebyla nalezena RTL jednotka %s.%sTo typicky znamená, že %s má špatné cesty jednotek. Nebo je vaše instalace rozbitá."
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
#, object-pascal-format
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr "Ve vaší cestě je několik překladačů Free Pascalu.%s%s%sMožná jste zapomněli smazat starý překladač?"
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgctxt "lazarusidestrconsts.lisccoskip"
|
|
msgid "Skip"
|
|
msgstr "Přeskočit"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "speciální znaky"
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Všechny testy se zdařily."
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr "Nelze vytvořit testovací soubor"
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
#, object-pascal-format
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr "Nelze vytvořit Testovací Pascalovský Soubor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "neobvyklé znaky"
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Varování"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "VAROVÁNÍ: "
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "špatný oddělovač cest"
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Skupiny"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr "Složitost"
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Konstanty"
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr "Prázdné bloky"
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr "Prázdné sekce tříd"
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr "Prázdné konstruktory"
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr "Prázdné procedury"
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
msgid "(filter)"
|
|
msgstr "(filtr)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Následovat kurzor"
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr "Je kořenový ovládací prvek"
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr "Počet parametrů považován za \"příliš\""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr "Dlouhé procedury"
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr "Počet řádků procedury považován za \"dlouhý\""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr "Mnoho vnořených procedur"
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr "Mnoho parametrů"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Ukázat kategorie"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr "Ukázat uzly zdroje"
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr "Počet vnořených procedur považován za \"příliš\""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr "Centrovat ztracené okno"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Vystředit prvky vodorovně, relativně k daným sourozencům. BorderSpacing je ignorováno."
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Vystředit prvky svisle, relativně k daným sourozencům. BorderSpacing je ignorováno."
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr "Vystředit formulář"
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Vystředit v okně"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Vystředit"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Upřednostněný prezentační režim"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
|
msgid "Category"
|
|
msgstr "Skupina"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Zdroj"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Nikdy, pouze ručně"
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Použito pouze v režimu kategorie"
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Při nečinnosti"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Obnovit automaticky"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Jiné"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Aktualizovat"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Když přepínání souboru v zdrojovém editoru"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Procedury"
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr "Vlastnosti"
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr "Zveřejněné vlastnosti bez výchozích hodnot"
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr "Ukázat pozorování o"
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Styl"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr "Obklopující"
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr "K dokončení"
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr "Typy"
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr "Nepojmenované konstanty"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr "Nesetřídění členové"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr "Nesetříděná viditelnost"
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr "Použití"
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Proměnné"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr "Nesprávné odsazení"
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
|
|
#, object-pascal-format
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr "Došlo k výjimce během mazání%s\"%s:%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr "Není známo, jak kopírovat upravovací výběr tohoto formuláře"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr "Není známo, jak vyjmout upravovací výběr tohoto formuláře"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr "Není známo, jak smazat upravovací výběr tohoto formuláře"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr "Chyba při vytváření komponenty"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr "Chyba při vytváření komponenty: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr "Chyba při rušení komponenty"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr "Chyba při rušení komponenty typu %s jednotky %s:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr "Chyba při rušení prostředníka"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
#, object-pascal-format
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr "Chyba při rušení prostředníka %s jednotky %s:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
#, object-pascal-format
|
|
msgid "In file %s"
|
|
msgstr "V souboru %s"
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr "Neplatný vlastník komponenty"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm již existuje"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm Neznámý typ %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr "TCustomFormEditor.DeleteComponent Kde je TCustomNonFormDesignerForm? %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
#, object-pascal-format
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr "TCustomFormEditor.RegisterDesignerMediator již existuje: %s"
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr "Editor komponenty třídy \"%s\" vytvořil chybu: %s\"%s\""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
#, object-pascal-format
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr "Komponentě typu %s se nepodařilo nastavit vlastníka na %s:%s"
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
#, object-pascal-format
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr "Nelze vyčistit upravovací výběr formuláře%s%s"
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Změnit"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr "Změnit sestavovací mód"
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Změnit třídu"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
#, object-pascal-format
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr "Změněna souřadnice %s od %s z \"%d\" na \"%d\" uvnitř %s."
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Změnit kódování"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr "Změnit soubor"
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
msgid "Change Parent"
|
|
msgstr "Změnit rodiče"
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr "Změny nebyly uloženy"
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr "Změnit na Unix /"
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr "Změnit na Windows \\"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr "Vybrat vše"
|
|
|
|
#: lazarusidestrconsts.lischeckcompilerpath
|
|
msgid "Please make sure that the path to the compiler in the IDE options is correct."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr "Kontrolovat změny v souborech na disku raději podle obsahu než podle času"
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
#, object-pascal-format
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ". Zkontrolujte, jestli balíček %s vytváří %s.ppu, jestli tento soubor nic nemaže a jestli žádné dva balíčky nemají přístup k zdroji jednotky."
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ". Zkontrolujte, jestli je balíček %s v seznamu závislostí"
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr "Zkontrolovat zda další element ve zdrojovém kódu je \"end\". Pokud ne, vrať \"LineEnding + end; + LineEnding\"."
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr "Zkontrolovat nastavení"
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ". Zkontrolujte cestu pro balíčku %s, zkuste čisté sestavení, zkontrolujte sekci 'uses' sekce 'implementation'."
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr "Zkontrolovat další token ve zdroji a pokud je potřeba, tak přidat středník."
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
#, object-pascal-format
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr "%s Ověřte cíl (OS, CPU, typ LCL widgetu). Možná musíte přeložit balíček pro tento cíl, nebo nastavit jiný cíl pro tento projekt."
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr "Označit/Odznačit vše"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgctxt "lazarusidestrconsts.lischooseadifferentname"
|
|
msgid "Choose a different name"
|
|
msgstr "Vyberte jiné jméno"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname2
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lischooseadifferentname2"
|
|
msgid "Choose a different name"
|
|
msgstr "Vyberte jiné jméno"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr "Vyberte soubor s šablonou CodeTools"
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr "Vyberte odkaz FPDoc"
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr "Vyberte klávesu..."
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr "Vybrat jméno pro komponentu"
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr "Vyberte ukázkový soubor"
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr "Vyberte soubor FPC zpráv"
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr "Vyberte pascalovských soubor pro ukázku odsazení"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
#, object-pascal-format
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr "Vybrat spustitelné překladače (%s)"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr "Změnit soubor zpráv překladače"
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr "Vybrat spustitelné ladiče"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Vyberte balíček Delphi (.dpk)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Vyberte projekt Delphi (*.dpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Vyberte jednotku Delphi (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Vyberte adresář"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr "Vybrat spustitelné"
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Vyberte zdrojový adresář FPC"
|
|
|
|
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
|
|
msgid "Choose the fppkg configuration file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Vyberte adresář Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr "Vybrat \"make\" spustitelné"
|
|
|
|
#: lazarusidestrconsts.lischoosenameandtext
|
|
msgid "Choose name and text"
|
|
msgstr "Vyberte jméno a text"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "K vytvoření nového souboru vyberte jednu z položek"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Vyberte jednu z těchto položek k vytvoření Balíčku"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Vyberte jednu z těchto položek k vytvoření Projektu"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr "Vyberte jednu z těchto položek k zdědění z existujícího"
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Vyberte zdrojový soubor programu (*.pp,*.pas,*.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Vyberte strukturu k obklopení výběru"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Vyberte adresář na zkoušky"
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr "Detekována kruhová závislost"
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr "&Třída"
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr "Dokončení třídy"
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr "Třídy a vlastnosti existují. Hodnoty nebyly zkontrolovány."
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr "Třída \"%s\" není třídou registrované komponenty.%sNelze vložit."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Třída nenalezena"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
#, object-pascal-format
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr "Třída %s nenalezena v %s(%s,%s)"
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr "Třída \"%s\" metody \"%s\" nenalezena."
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr "Vyčistit"
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Vyčistit adresář"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Vyčistit podadresáře"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Udržovat všechny textové soubory"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Nechat soubory odpovídající filtru"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Odstranit soubory odpovídající filtru"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Jednoduchá syntaxe (např. * namísto .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr "Vyčistit vše"
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Vyčistit zdrojové soubory Lazarusu"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr "Přepnout po sestavení na automatické"
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr "Vyčistit"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Vyčistit a sestavit"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr "Vyčistit a sestavit projekt"
|
|
|
|
#: lazarusidestrconsts.liscleanuplazbuild
|
|
msgid "Clean up + lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
#, object-pascal-format
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr "Vyčistit balíček \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Vyčistit cestu jednotky?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgctxt "lazarusidestrconsts.lisclear"
|
|
msgid "Clear"
|
|
msgstr "Smazat"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr "Vyprázdnit adresář?"
|
|
|
|
#: lazarusidestrconsts.lisclearfilter
|
|
msgid "Clear filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr "Vyčistit filtr pro možnosti"
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "K procházení souboru klikněte zde"
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr "Klikni pro zobrazení vybraných"
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr "Klikni pro výběr stránky palety"
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr "Klonovat"
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "Zavřít"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr "Zavřít všechny vybrané"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr "Zavřít soubory"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr "Skrýt okno"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr "Zavření okna editoru zdrojových kódů. Chcete zavřít všechny soubory nebo schovat okno?"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr "Zavřít okno zdrojového editoru"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "Volby rozhraní LCL:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parametr"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponenty"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Dědičnost"
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr "Seznam"
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paleta"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr "Stránky"
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr "Paleta je &viditelná"
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr "Nav&rátit výchozí"
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Víceznačný přídavný konfigurační soubor překladače"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Volat při:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
#, object-pascal-format
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Příkaz:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr "Kód"
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Prohlížeč kódu"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr "Volby vytvoření kódu"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
msgid "Class section"
|
|
msgstr "Sekce třídy"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr "Umístění"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr "Nastavení vytváření kódu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Přidat cestu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Procházet"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Potvrdit nahrazení"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Vytvořit položku nápovědy"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Odstranit cestu"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
|
msgid "Description"
|
|
msgstr "Popis"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Chyby"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Příklad"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr "Nastavení FPDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Vložit tučnou formátovanou značku"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Vložit formátovací značku kódu"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Vložit značku pro kurzívu"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Vložit značku poznámky"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Vložit značku pro podtržené písmo"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Vložit značku formátování proměnné"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Zděděný"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Vložit odkaz..."
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Vložit značku formátování odstavce"
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Editor FPDoc"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr "(nenalezen zděděný popis)"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<ŽÁDNÝ>"
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Související informace"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Krátky popis"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Krátký"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
|
msgid "Ignore constants in next functions"
|
|
msgstr "Ignorovat konstanty v další funkci"
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
|
msgid "Search for unnamed char constants"
|
|
msgstr "Hledat bezejmennou znakovou konstantu"
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr "Pozorovatel kódu"
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr "Ignorovat další bezejmennou konstantu"
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
msgctxt "lazarusidestrconsts.liscodetempladd"
|
|
msgid "Add template"
|
|
msgstr "Přidat šablonu"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Přidat šablonu kódu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr "Automatické dokončení na"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Komentář:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Upravit šablonu kódu"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerroralreadyexists
|
|
msgid "A token already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplerroremptyname
|
|
msgid "The token cannot be empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetemplerrorinvalidname
|
|
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Token:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
#, object-pascal-format
|
|
msgid "Action: %s"
|
|
msgstr "Akce: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
#, object-pascal-format
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůžou mít ručně vytvořené uzly potomků."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
#, object-pascal-format
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, automaticky generováno"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Automaticky generované uzly nelze editovat."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Editor definic CodeTools"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
msgid "Compiler path"
|
|
msgstr "Cesta překladače"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Převést uzel"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Vytvořit definice pro adresář %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Vytvořit definice pro překladač Free Pascal"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
#, fuzzy
|
|
#| msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgid "Create Defines for Free Pascal Git Sources"
|
|
msgstr "Vytvořit definice pro SVN zdroje Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
#, object-pascal-format
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Vytvořit definice pro projekt %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Vytvořit FPC makra a cesty pro adresář projektu fpc"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Definovat"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Definovat rekurentně"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Odstranit uzel"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: C:/Programy/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: C:/Programy/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Popis:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
#, object-pascal-format
|
|
msgid "%s directory"
|
|
msgstr "%s adresář"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Jinak"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "JinakPokud"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
#, fuzzy
|
|
#| msgid "FPC SVN source directory"
|
|
msgid "FPC Git source directory"
|
|
msgstr "SVN zdrojový adresář FPC"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "Pokud"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr "PokudDefinováno"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "PokudNedefinováno"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Adresář"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Vložit šablonu překladače Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Vložit šablonu adresáře Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Vložit šablonu projektu Delphi 5"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Vložit šablonu překladače Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Vložit šablonu adresáře Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Vložit šablonu projektu Delphi 6"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Vložit šablonu překladače Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Vložit šablonu adresáře Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Vložit šablonu projektu Delphi 7"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Vložit šablonu překladače Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Vložit šablonu projektu Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
#, fuzzy
|
|
#| msgid "Insert Free Pascal SVN Source Template"
|
|
msgid "Insert Free Pascal Git Source Template"
|
|
msgstr "Vložit šablonu zdrojového kódu SVN Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Vložit šablonu překladače Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Vložit šablonu adresáře Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Vložit šablonu projektu Kylix 3"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Vložit uzel jako potomka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Vložit uzel pod"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Vložit šablonu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Neplatný rodič"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Neplatný rodičovský uzel"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Neplatný předchozí uzel"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
#, object-pascal-format
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Přesunout uzel dolů"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Přesunout uzel o jednu úroveň dolů"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Přesunout uzel o jednu úroveň nahoru"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Přesunout uzel nahoru"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Jméno:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "Nový uzel"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Uzel je pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "žádné vybrané"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Rodičovský uzel nemůže obsahovat dětské uzly."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Předchozí uzel nemůže obsahovat uzly potomků."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Adresář projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
#, object-pascal-format
|
|
msgid "%s project directory"
|
|
msgstr "%s adresář projektu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Vybrat uzel:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
#, fuzzy
|
|
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
|
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr "Zdrojový adresář Free Pascal SVN. Nevyžadované, ale zlepšuje hledání deklarací a ladění."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Adresář projektu Free Pascalu."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
#, fuzzy
|
|
#| msgid "The Free Pascal SVN source directory."
|
|
msgid "The Free Pascal Git source directory."
|
|
msgstr "Zdrojový adresář SVN Free Pascalu."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Cesta k překladači Free Pascal.%s Například %s/usr/bin/%s -n%s nebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
#, fuzzy
|
|
#| msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
|
|
msgstr "Cesta překladače Free Pascal pro tento projekt. Vyžadováno jen pokud je nastaven FPC SVN zdroj níže. Použito pro automatické vytvoření maker."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
#, object-pascal-format
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr "Cesta k překladači Free Pascal pro tento zdroj.%sPoužito pro automatické vytvoření maker."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
#, object-pascal-format
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "Adresář projektu %s,%skterý obsahuje soubor .dpr, dpk."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Nedefinovat"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Nedefinovat vše"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Nedefinovat rekurentně"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr "Hodnota jako cesty souboru"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Hodnota jako text"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
#, object-pascal-format
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr "%s:%shodnota \"%s\" není platná."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Proměnná:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Zavináč"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr "Závorka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr "Stříška (^)"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Dvojtečka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Čárka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomment
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptscomment"
|
|
msgid "Comment"
|
|
msgstr "Komentář"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentansi
|
|
msgid "ANSI Comment: (*"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentbor
|
|
msgid "Curly Comment: {"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscommentslash
|
|
msgid "Slash Comment: //"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identifikátor"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptskeyword"
|
|
msgid "Keyword"
|
|
msgstr "Klíčové slovo"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nový řádek"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Žádné"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Číslo"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Tečka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Středník"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Mezera"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Konstantní řetězec"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbol"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Spustit pak"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Spustit před"
|
|
|
|
#: lazarusidestrconsts.liscollapse
|
|
msgid "Collapse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
#, fuzzy
|
|
#| msgid "Collapse All (/)"
|
|
msgid "Collapse All [Ctrl+Minus]"
|
|
msgstr "Sesunout vše (/)"
|
|
|
|
#: lazarusidestrconsts.liscollapseall2
|
|
msgid "Collapse All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Sesunout všechny třídy"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Sesunout všechny balíčky"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Sesunout všechny jednotky"
|
|
|
|
#: lazarusidestrconsts.liscomboboxes
|
|
msgid "Combo Boxes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Parametry příkazové řádky"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Parametry příkazového řádku programu"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Přeložit"
|
|
|
|
#: lazarusidestrconsts.liscompileanddonotaskagain
|
|
msgid "Compile and do not ask again"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilefollowingmodes
|
|
msgid "Compile the following modes"
|
|
msgstr "Sestavit následující režimy"
|
|
|
|
#: lazarusidestrconsts.liscompilenormally
|
|
msgid "Compile normally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilepackagetwiceandcheckifanyunitwascompiledaga
|
|
msgid "Compile package twice and check if any unit was compiled again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr "Přeložit projekt"
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Překladač"
|
|
|
|
#: lazarusidestrconsts.liscompilercfgismissing
|
|
#, object-pascal-format
|
|
msgid "%s is missing."
|
|
msgstr "chybí %s."
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
#, object-pascal-format
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr "Překladač \"%s\" nepodporuje cíl %s-%s"
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
#, object-pascal-format
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Chyba: neplatný překladač: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Jméno souboru překladače"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Tip: cestu překladače můžete nastavit v Nástroje -> Nastavení -> Soubory -> Cesta překladače"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
#, object-pascal-format
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr "Nenalezen soubor zpráv překladače:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "Poznámka: Nenalezen konfigurační soubor Nástrojů Kódu - použité výchozí"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Poznámka: načítání starého souboru voleb Nástrojů Kódu: "
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Přeložit"
|
|
|
|
#: lazarusidestrconsts.liscompilewithprojectsettings
|
|
msgid "Compile with project settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr "Přeložit s -vd pro více podrobností. Kontroluje na duplicity."
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
#, object-pascal-format
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (překládání ...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr "Zobrazit dlouho řádkové tipy"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr "Rozšířit zcela vlevo"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr "Rozšířit o něco vlevo"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr "Nikdy"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr "Rozšířit pouze vpravo"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
#, object-pascal-format
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Jméno komponenty \"%s\" je klíčové slovo"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr "Zobrazit vše"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Otevřít balíček"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Otevřít jednotku"
|
|
|
|
#: lazarusidestrconsts.liscompress
|
|
msgid "Compress"
|
|
msgstr "Komprimovat"
|
|
|
|
#: lazarusidestrconsts.liscompresshint
|
|
msgid "The resulting directory will be compressed into a ZIP file."
|
|
msgstr "Výsledný adresář bude zkomprimován do ZIP souboru."
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
msgctxt "lazarusidestrconsts.liscomptest"
|
|
msgid "&Test"
|
|
msgstr "&Test"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Podmínka"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr "Podmíněné"
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Konfigurační adresář Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr "Soubor nastavení pro přídavky:"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
#, object-pascal-format
|
|
msgid "Configure Build %s"
|
|
msgstr "Nastavit sestavení %s"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr "Nastavení \"Sestavení Lazarusu\""
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr "Nastavit nástrojový panel"
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr "Nastavit Lazarus IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr "Potvrdit"
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr "Potvrzení"
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
#, object-pascal-format
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr "Lazarus se znovu sestaví s těmito profily:%sPokračovat?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Potvrdit změny"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr "Potvrzení smazání"
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
#, object-pascal-format
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Chcete znovu sestavit Lazarus s profilem: %s ?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "Potvrdit novou sadu balíčků pro IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Akce"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr "Nová sada balíčků"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr "Stará sada balíčků"
|
|
|
|
#: lazarusidestrconsts.lisconfirmreplace
|
|
msgid "Confirm Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr "Konflikt"
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr "Konflikt detekován"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Konzolová aplikace"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr "Free Pascal program příkazové řádky používající TCustomApplication pro snadnou kontrolu parametrů příkazové řádky, zpracování výjimek, atd."
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr "Kód konstruktoru"
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "obsahuje"
|
|
|
|
#: lazarusidestrconsts.liscontents
|
|
msgctxt "lazarusidestrconsts.liscontents"
|
|
msgid "Contents"
|
|
msgstr "Obsah"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr "Kontextová"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr "Pokračovat a již se znovu neptat"
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr "Pokračovat v sestavování"
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Pokračovat bez načtení formuláře"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Přispěvatelé"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Prvek potřebuje rodiče"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr "Přidat komentář po nahrazení"
|
|
|
|
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
|
|
msgid "Added MODE Delphi syntax modifier after unit name."
|
|
msgstr "Přidán modifikátor MODE pro Delphi syntaxi po názvu jednotky."
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
#, object-pascal-format
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr "Přidání příznaku pro proceduru \"Register\" v jednotce %s."
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
#, object-pascal-format
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr "\")\" chybí ve funkci nahrazení: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr "Závorka nenalezena"
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
#, object-pascal-format
|
|
msgid " { *Converted from %s* }"
|
|
msgstr " { *Převedeno z %s* }"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr "Přidá posunutí k hornímu okraji prvků uvnitř vizuálních kontejnerů"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr "Posunutí okrajů"
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
#, object-pascal-format
|
|
msgid "Deleted file %s"
|
|
msgstr "Odstranit soubor %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
#, object-pascal-format
|
|
msgid "Added defines %s in custom options"
|
|
msgstr "Přidán(a/y) definice %s ve vlastních volbách"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
#, object-pascal-format
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr "Přidán balík %s jako závislost."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
#, object-pascal-format
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr "Přidána jednotka \"%s\" do sekce používaných jednotek."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr "Všechny podadresáře budou prohledány pna soubory jednotek"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr "BeginCodeTools selhalo!"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr "Kategorie:"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
#, object-pascal-format
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr "Kódování změněno z %s na UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr "Převod přerušen."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr "Převod připraven."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
#, object-pascal-format
|
|
msgid "Conversion took: %s"
|
|
msgstr "Převod zabral: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr "Převod balíčku Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr "Převod projektu Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr "Převod jednotky Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr "*** Převádím soubory jednotek nalezené během převodu ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr "*** Převádím soubory jednotek patřící projektu/balíku ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
#, object-pascal-format
|
|
msgid "Error=\"%s\""
|
|
msgstr "Chyba=\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr "Během převodu jednotky nastala chyba. Pokračuji s formuláři už převedených jednotek..."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr "Převod jednotky selhal"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
#, object-pascal-format
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr "Selhal převod jednotky \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
#, object-pascal-format
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr "Opravena velikost znaků jednotky \"%s\" na \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr "Nalezeny všechny soubory jednotky"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr "Funkce Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
#, object-pascal-format
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr "%s(%s,%s) chybějící zahrnuté soubory"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr "Jméno Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr "Jméno balíčku existuje"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
#, object-pascal-format
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr "Balík %s je vyžadování v Lazarusu! Nainstalujte jej později."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
#, object-pascal-format
|
|
msgid "Omitted unit %s from project"
|
|
msgstr "Jednotka %s vypuštěna z projektu"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
#, object-pascal-format
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr "Jednotka \"%s\" byla odstraněna z uses sekce."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr "*** Opravování formulářových souborů ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr "Nahrazena jednotka \"%s\" jednotkou \"%s\" v sekci používaných jednotek."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
#, object-pascal-format
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr "Již existuje balíček se jménem \"%s\"%sProsím, zavřete nejdříve tento balíček."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr "Jméno jednotky existuje v LCL"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
#, object-pascal-format
|
|
msgid "Units to replace in %s"
|
|
msgstr "Jednotky k nahrazení v %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
#, object-pascal-format
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr "LCL již má jednotku s názvem %s. Odstranit místní soubor %s?"
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr "soubor .dproj není ještě podporován. Soubor je použit Delphi 2007 a novějšími. Prosím vyberte .dpr soubor pro projekt nebo .dpk soubor pro balíčky."
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Chyba převodu"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Převést"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert Encoding"
|
|
msgstr "Převést kódování"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr "Převést kódování projektů/balíčků"
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr "Jiné volby ovlivňující převod"
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Převést projekt nebo balíček"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr "Cíl"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr "Více-platformní"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr "Více-platformní proti Pouze pro Windows"
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr "Převaděč přidá podmíněný překlad k podpoře různých cílů"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr "Použít stejný formulářový DFM soubor"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr "Stejný DFM soubor pro Lazarus i Delphi místo kopírování do LFM"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr "Podporovat Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr "Použít podmíněný překlad k podpoře Delphi"
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
#, object-pascal-format
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr "Pevné jméno jednotky z %s na %s."
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr "Nahrazování funkcí"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr "Některé funkce Delphi mohou být nahrazeny funkcemi LCL"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr "Funkce / procedury k nahrazení"
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr "Levé posunutí"
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr "Nové jméno"
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr "Rodičovský kontejner"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
#, object-pascal-format
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr "Problémy během pokusu o nalezení všech jednotek ze souboru projektu %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
#, object-pascal-format
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr "Problémy během opravování include souborů v souborů %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
#, object-pascal-format
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr "Problémy během opravování souboru formuláře %s"
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr "Opravování include souborů : "
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
#, object-pascal-format
|
|
msgid "Replaced call %s with %s"
|
|
msgstr "Nahrazeno volání %s s %s"
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
#, object-pascal-format
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr "Počet parametrů nahrazující funkce musí být >= 1: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
#, object-pascal-format
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr "\"$\" by měl být následován číslem: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr "Zastaveno, protože již existuje balíček se stejným jménem"
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
#, object-pascal-format
|
|
msgid "This log was saved to %s"
|
|
msgstr "Tento záznam byl uložen do %s"
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr "Horní posunutí"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr "Nahrazení typu"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr "Neznámé typy v souboru formuláře (DFM/LFM)"
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr "Typy k nahrazení"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr "Nahrazení jednotky"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr "Jména jednotek v sekci \"uses\" zdrojové jednotky"
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr "Jednoty k nahrazení"
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr "Neznámé vlastnosti"
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
#, object-pascal-format
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr "Uživatelsky vybrané k ukončení převodu se souborem %s"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr "Přidat/Nastavit/Odebrat nástrojový panel(y)"
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr "Přidat oddělovač"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr "Přidat vybranou položku do nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr "Dostupné příkazy"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr "Styl okraje nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Žádné"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr "Jednoduchý"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Průzkumník kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Šablony kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr "&Nastavit"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr "Opravdu chcete odstranit vybraný panel nástrojů?"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr "Musí být nejméně jeden nástrojový panel!"
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr "Návrhář"
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr "Obecná nastavení Coolbaru"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr "Styl uchopení nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr "Jednoduchý"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr "Dvojitý"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr "Vodorovné řádky"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr "Svislé řádky"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr "Zachycovač"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr "Tlačítko"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr "Šířka uchopení"
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr "Hlavní nabídka IDE"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Zprávy"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr "Přesunout vybranou položku nástrojového panelu dolů"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr "Přesunout vybranou položku nástrojového panelu nahoru"
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr "CoolBar IDE"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr "Editor balíčků"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr "Soubory editoru balíčků"
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr "Odstranit vybranou položku z nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr "Obnovit výchozí"
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr "Prosím nejdříve vyberte nástrojový panel!"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr "Zdrojová záložka"
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr "Příkazy nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr "Coolbar je &viditelný"
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr "Šířka Coolbaru"
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr "Kopírovat Všechny Položky Do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr "Kopírovat Všechny/Původní Zprávy do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr "Kopírovat Všechny Zobrazené Zprávy do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr "Zkopírovat popis do schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Chyba kopírování"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
#, object-pascal-format
|
|
msgid "Copy Filename %s"
|
|
msgstr "Kopírovat jméno souboru %s"
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr "Kopírovat Cestu Souboru do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyfilesfailed
|
|
msgid "Copying files failed."
|
|
msgstr "Kopírování souborů selhalo."
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
#, object-pascal-format
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr "Zkopírovat \"%s\" do schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Kopírování celého formuláře není implementováno."
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr "Zkopírovat položku do schránky"
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr "Kopírovat/Přesunout soubor do adresáře"
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr "Zkopírovat Vybrané Položky do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Kopírovat Vybrané Zprávy do Schránky"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Snímat pro zprávy FPC"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Snímat pro zprávy Make"
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
msgid "Skip calling compiler"
|
|
msgstr "Přeskočit volání překladače"
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá Free Pascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace."
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
#, object-pascal-format
|
|
msgid "Open Package %s"
|
|
msgstr "Otevřít balíček %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
#, object-pascal-format
|
|
msgid "Open Unit %s"
|
|
msgstr "Otevřít jednotku %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
#, object-pascal-format
|
|
msgid ", CPU: %s"
|
|
msgstr ", CPU: %s"
|
|
|
|
#: lazarusidestrconsts.liscreateandedit
|
|
msgid "Create and edit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Vytvořte nejdříve projekt!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr "Vytvořit režimy Debug a Release"
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr "Vytvořit adresář?"
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr "Vytvořit Filtr"
|
|
|
|
#: lazarusidestrconsts.liscreatefppkgconfig
|
|
msgid "Restore Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr "Vytvořit funkci"
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr "Vytvořit uzel nápovědy"
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr "Vytvořit to"
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
#, object-pascal-format
|
|
msgid "Create local variable \"%s\""
|
|
msgstr "Vytvořit místní proměnnou \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr "Vytvořit nový přídavek"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr "(Vytvořit nový balíček)"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr "(Vytvořit novou komponentu balíčku)"
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr "Vytvořit projekt"
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr "Vytvořit/aktualizovat soubor .po při uložení souboru lfm"
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
#, object-pascal-format
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr "Vytváření indexového souboru zdrojových kódů FPC %s ..."
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Vyberte adresář"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Hodnoty adresářů Nástrojů Kódu"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definovat šablony"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<žádná proměnná nevybrána>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Otevřít náhled"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Nástroje"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
#, object-pascal-format
|
|
msgid "Variable: %s"
|
|
msgstr "Proměnná: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Jméno proměnné"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Šablony"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr "Aktualizovat všechny podpisy metod"
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr "Aktualizovat vícenásobné podpisy procedur"
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "vyberte makro prosím"
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Vybrat makro kódu"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
#, object-pascal-format
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr "Aktuální LCL widgetset: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr "Aktuální stav: "
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Sloupec kurzoru v aktuálním editoru"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Řádek kurzoru v aktuálním editoru"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr "Tyto volby jsou přímo předány překladači jakmile jsou makra nahrazena."
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "vlastní nastavení"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Vlastní nastavení"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr "Vlastní volby"
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Vlastní program"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr "Vlastní Free Pascal program."
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr "Datový modul"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr "Vyhodnocení bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr "Dosažen bod přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr "Zpráva bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr "Výpis zásobníku bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr "Přednastavená barva"
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr "Vyvolána výjimka"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr "Modul nahrán"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr "Modul odebrán"
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr "Výstupní ladící řetězec"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr "Ukončení procesu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr "Start procesu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr "Ukončení vlákna"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr "Start vlákna"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr "Poslána zpráva Windows"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr "Poslána zpráva Windows"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Nebyl určen ladící nástroj"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Přesto nastavit bod přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
#, object-pascal-format
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Není nastaven ladič.%sNastavení bodu přerušení nemá význam, dokud nenastavíte ladič v dialogu Volby ladiče v nabídce."
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Ladění"
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
|
|
msgid "Confirm to delete all Breakpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
|
|
msgid "Confirm to delete Breakpoints in same file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
|
|
msgid "Confirm to clear History"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
|
|
msgid "Confirm to delete all Watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Ladič"
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
|
|
msgstr "Chyba ladiče%sLadič je v chybovém stavu%sUložte svou práci!%sPoužijte Stop, a doufejte v nejlepší."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Neplatný ladič"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
#, object-pascal-format
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (ladění ...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr "Automatické přetypování objektů"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr "Přidat výjimku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Doplňující prohledávací cesty"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
|
|
msgid "BETA: Allow function calls in watches (if supported by backend)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
|
|
msgid "Automatically close the assembler window, after source not found"
|
|
msgstr "Automaticky zavři okno assembleru, až není zdrojový soubor nalezen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
|
|
msgid "Automatically set \"use instance class type\" for new watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
|
|
msgid "Debugger backend"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Bod přerušení"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Smazat záznam při spuštění"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Ladič"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
|
|
msgid "Debugger Backend:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
|
|
msgid "Debugger dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Obecná nastavení ladícího nástroje"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Speciální nastavení pro ladič (záleží na typu ladiče)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
|
|
msgid "Always bring debug-windows (watches, locals) to front when adding items"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr "Zdvojený název výjimky"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
|
|
msgid "Change type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
|
|
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr "Zadejte jméno výjimky"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Záznam událostí"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Obslouženo"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Obslouženo ladícím nástrojem"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Obslouženo programem"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Ignorovat tyto výjimky"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Výjimky jazyku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit line count to"
|
|
msgstr "Omezit počet řádek na"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
|
msgid "Module"
|
|
msgstr "Modul"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmname
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
|
|
msgid "Name:"
|
|
msgstr "Jméno:"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Exceptions"
|
|
msgstr "Upozornit při Výjimkách"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Výjimky OS"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Výstup"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proces"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr "Resetovat ladič po každém běhu"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
|
|
msgid "Show message on stop with Error (Exit-code <> 0)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Zobrazit hlášení při zastavení"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signály"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Vlákno"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
|
|
#, object-pascal-format
|
|
msgid "Unknown Debugger backend \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr "Použít barvy v záznamu událostí"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
|
|
msgid "-- Use IDE default Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
|
|
msgid "-- Use project Debugger --"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr "Okna"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Nelze načíst soubor"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Nelze načíst soubor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Výchozí"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr "Výchozí sekce viditelnosti třídy pro nové metody. Např. dokončení kódu OnShow:="
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr "Výchozí je ComboBox s vybraným \"True\" nebo \"False\""
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr "(výchozí)"
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr "Výchozí sekce metod"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionbox
|
|
msgid "Delay for completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr "Zpoždění pro dlouho řádkové tipy v rámci dokončování"
|
|
|
|
#: lazarusidestrconsts.lisdelayforhints
|
|
msgid "Delay for hints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr "Odstranit?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
#, object-pascal-format
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr "Odstranit přídavek \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "Smazat vše"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Odstranit všechny tyto soubory?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Odstranit víceznačný soubor?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
#, object-pascal-format
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr "Smazat makro \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
#, object-pascal-format
|
|
msgid "Delete mode \"%s\""
|
|
msgstr "Smazat mód \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
#, object-pascal-format
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Odstranit starý soubor \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr "Smazat vybrané makro?"
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr "Odstranit tento přídavek"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
#, object-pascal-format
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr "Odstranit hodnotu \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
#, object-pascal-format
|
|
msgid "Delete value %s"
|
|
msgstr "Smazat hodnotu %s"
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr "Oddělovačem je středník."
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr "Zdroj kompatibilní s Delphi. Doporučeno."
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr "\"Návrhové\" balíky přidávají komponenty a položky do nabídky IDE. Mohou být použity projekty, ale nemohou být přeloženy do projektu. Překladač nenajde jednotky balíku během přeložení projektu."
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr "Plochy ..."
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Cílový adresář"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr "Kód destruktoru"
|
|
|
|
#: lazarusidestrconsts.lisdfileswererenamedtol
|
|
#, object-pascal-format
|
|
msgid "%d files were renamed to lowercase."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Nerozlišovat velikost znaků"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr "Soubor1"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr "Soubor2"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Ignorovat prázdné řádky při přidávání a odstraňování"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Ignorovat rozdílné konce řádků (např. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Ignorovat množství znaků mezer"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Ignorovat mezery (nezahrnovat znaky nových řádků)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Ignorovat mezery na konci řádku"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Ignorovat mezery na začátku řádku"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Pouze výběr"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
msgid "Open difference in editor"
|
|
msgstr "Otevřít rozdíl v editoru"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
#, object-pascal-format
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr "rozdílná jednotka %s nalezena na nové pozici \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Pokyny"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr "Pokyny pro novou jednotku"
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr "Adresáře"
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr "Adresář: "
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
#, object-pascal-format
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr "Adresář \"%s\" nenalezen."
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
#, object-pascal-format
|
|
msgid "directory %s not found"
|
|
msgstr "adresář %s nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr "Adresář, do nějž IDE dává soubory .po"
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr "Zakázat I18N pro LFM"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr "Zakázat Volbu -Xg?"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr "Zakázat volbu -Xg"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Zahodit změny"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr "Zahodit všechny změny"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr "Zahodit změny a otevřít projekt"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr "Zahodit změny a ukončit"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr "Zahodit změny, vytvořit nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Ke zobrazení rozdílu klikněte na jednu z položek nahoře"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
#, object-pascal-format
|
|
msgid "Error reading file: %s"
|
|
msgstr "Chyba načítání souboru: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr "Ignorovat všechny diskové změny"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr "Znovu načíst ozančené soubory z disku"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Některé soubory se na disku změnily:"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
|
|
msgid "Some files have local changes. Either local or external changes will be overwritten."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Rozlišovat velká a malá písmena např. A a a"
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr "Všechny možnosti ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr "Změnit třídu ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr "Definice ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
msgctxt "lazarusidestrconsts.lisdlgedit"
|
|
msgid "Edit ..."
|
|
msgstr "Upravit ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgctxt "lazarusidestrconsts.lisdlgexport"
|
|
msgid "Export ..."
|
|
msgstr "Exportovat ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgctxt "lazarusidestrconsts.lisdlgimport"
|
|
msgid "Import ..."
|
|
msgstr "Importovat ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr "Více ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgctxt "lazarusidestrconsts.lisdlgopen"
|
|
msgid "Open ..."
|
|
msgstr "Otevřít ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
#, object-pascal-format
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s neexistuje: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr "Neměnit"
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
#, fuzzy
|
|
#| msgid "%sDo not check if another IDE instance is already running"
|
|
msgid "Do not check if another IDE instance is already running."
|
|
msgstr "%sNekontrolovat zda již běží jiná instance IDE"
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Nezavírat projekt"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
#, fuzzy
|
|
#| msgid "do not compile dependencies"
|
|
msgid "Do not compile dependencies."
|
|
msgstr "nepřekládat závislosti"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
#, fuzzy
|
|
#| msgid "Do not show splash screen"
|
|
msgid "Do not show splash screen."
|
|
msgstr "Nezobrazovat úvodní obrázek při startu"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr "Nezobrazovat tento dialog pro tento projekt"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr "Neukazovat znova tuto zprávu"
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr "Nezapisovat aktualizované projektové informace po sestavení. Pokud není určeno, číslo sestavení bude zvětšeno pokud je nastaveno."
|
|
|
|
#: lazarusidestrconsts.lisdonwloadonlinepackages
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "The following package(s) are not available locally: %s.\n"
|
|
#| "In order to install it, you must download them first. Download now?\n"
|
|
msgid ""
|
|
"The following package(s) are not available locally: %s.\n"
|
|
"In order to install it, you must download them first. Download now?"
|
|
msgstr ""
|
|
"Následující balíčky nejsou dostupné místně: %s\n"
|
|
"Pro jejich instalaci je musíte nejdříve stáhnout. Stáhnout je nyní?\n"
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgctxt "lazarusidestrconsts.lisdown"
|
|
msgid "Down"
|
|
msgstr "Dolů"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr "Ponížit"
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr "Ponížit konfiguraci"
|
|
|
|
#: lazarusidestrconsts.lisdownload
|
|
msgid "Download"
|
|
msgstr "Stáhnout"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr "Stále si přejete vytvořit nový projekt?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr "Stále si přejete otevřít jiný projekt?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr "Stále si přejete skončit?"
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Kreslit čáry mřížky"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr "Vykreslit výběr zaměřený, i když okno Zprávy není aktivní. Použijte, pokud vaše téma má těžce viditelné neaktivní vykreslení."
|
|
|
|
#: lazarusidestrconsts.lisdropdowncount
|
|
msgid "Drop Down Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdropdowncounthint
|
|
msgid "Used for all ComboBoxes in IDE dialogs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Zkopírovat vybrané komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Vyjmout vybrané komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Přesunout komponentu o jedno dozadu"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Přesunout komponentu o jedno dopředu"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Přesunout komponentu dozadu"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Přesunout komponentu dopředu"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Vložit vybrané komponenty ze schránky"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Vybrat rodičovskou komponentu"
|
|
|
|
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
|
|
msgid "Show nonvisual components"
|
|
msgstr "Ukázat neviditelné komponenty"
|
|
|
|
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
|
|
msgid "Toggle showing nonvisual components"
|
|
msgstr "Přepnout zobrazení negrafických komponent"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr "Duplicitní"
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr "Duplikovat záznam"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr "Duplicitní Soubor"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
#, object-pascal-format
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr "Nalezeno zdvojení hodnoty \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisduplicatemodename
|
|
#, object-pascal-format
|
|
msgid "Mode \"%s\" is already present in the list."
|
|
msgstr "Režim \"%s\" v seznamu již existuje."
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr "Duplicitní jméno"
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
#, object-pascal-format
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr "Zdvojené jméno: Komponenta pojmenovaná \"%s\" již existuje ve zděděné komponentě %s"
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Duplicitní ppu soubor. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr "Zdvojit prohledávací cestu"
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Duplicitní zdroje. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr "Duplicitní Jednotka"
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
#, object-pascal-format
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr "Zdvojit jednotku \"%s\" v \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
|
|
msgid "Amount to scroll in"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
|
|
msgid "Amount to scroll in (%)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
|
|
msgid "Amount to scroll in (Max)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
|
|
msgid "Auto Scroll on delete past left border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
|
|
msgid "Auto Scroll on type past right border"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
|
|
msgid "Trigger on min chars (% of width)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
|
|
msgid "Trigger on min chars visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Upravit"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr "Upravit dodatečnou nápovědu pro zprávy"
|
|
|
|
#: lazarusidestrconsts.liseditbuildmodes
|
|
msgid "Edit build modes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr "Upravit kontextovou nápovědu"
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr "Upravit nápovědu"
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr "Upravit klávesu"
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr "Barvy Editoru"
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgctxt "lazarusidestrconsts.liseditormacros"
|
|
msgid "Editor Macros"
|
|
msgstr "Návrhář maker"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr "Editor ToolBaru"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr "Nastavení Editoru nástrojových panelů"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr "Editor nástrojového panelu je &viditelný"
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr "Nahrát schéma"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Aktuální projekt"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Nástroj pro úpravy"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Klávesa"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametry:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Jméno souboru programu:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Snímat výstup pro zprávy FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Snímat výstup pro zprávy Make"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Požadováno název a jméno souboru"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Pracovní adresář:"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr "Povýšit prioritu zpráv, aby se vždy ukazovalo (jako výchozí má nízkou prioritu \"výřečný\")"
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr "Všechno"
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
|
msgid "Empty Methods"
|
|
msgstr "Prázdné metody"
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr "Nalezeny prázdné metody:"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr "Žádná třída"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
#, object-pascal-format
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr "Žádná třída v %s(%s,%s)"
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr "Pouze zveřejněné"
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr "Veřejný"
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr "Zveřejněné"
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr "Odstranit metody"
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr "Hledat v těchto sekcích tříd:"
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
#, object-pascal-format
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr "Nelze zobrazit prázdné metody aktuální třídy, protože%s%s"
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr "Prázdné"
|
|
|
|
#: lazarusidestrconsts.lisemptydestinationforpublishing
|
|
msgid "Destination directory for publishing is either a relative path or empty."
|
|
msgstr "Cílový adresář pro zveřejnění je buď relativní cesta nebo je prázdný."
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr "Povolit pouze pro balíčky."
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
#, object-pascal-format
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ". Povolit příznak \"Použít jednotku\" jednotky %s v balíčku %s"
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr "Zapnout I18N pro LFM"
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr "Povolit internacionalizaci a podporu překladů"
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Povolit makra"
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2
|
|
msgid "Enable Dwarf 2 (-gw)"
|
|
msgstr "Povolit Dwarf 2 (-gw)"
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf2sets
|
|
msgid "Enable Dwarf 2 with sets"
|
|
msgstr "Povolit Dwarf 2 s množinami"
|
|
|
|
#: lazarusidestrconsts.lisenableoptiondwarf3
|
|
msgid "Enable Dwarf 3 (-gw3)"
|
|
msgstr "Povolit Dwarf 3 (-gw)"
|
|
|
|
#: lazarusidestrconsts.lisenableoptionxg
|
|
msgid "Enable Option -Xg?"
|
|
msgstr "Povolit volbu -Xg?"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr "Povolit = stiskem Return nahrazuje celý identifikátor a Shift+Return nahrazuje prefix, Zakázat = stisk Return nahrazuje prefix a Shift+Return nahrazuje celý identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr "Uzavřít do $IFDEF"
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
#, object-pascal-format
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr "Počet souborů, které se nepodařilo převést: %d"
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr "Kódování souboru \"%s\"%sna disku je %s. Nové kódování je %s."
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
#, object-pascal-format
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr "Zadejte nové jméno makra \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr "Proměnná prostředí, jméno jako parametr"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Neplatný název souboru ladiče"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
#, object-pascal-format
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Soubor ladiče \"%s\" není spustitelný."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
#, object-pascal-format
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Testovací adresář \"%s\" nenalezen."
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
#, object-pascal-format
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Nesprávná volba na pozici %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
#, object-pascal-format
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Volba na pozici %d nepovoluje argument: %s"
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
#, object-pascal-format
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Volba na pozici %d potřebuje argument : %s"
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Chyba: "
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Chyba vytváření souboru"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Chyba mazání souboru"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
#, object-pascal-format
|
|
msgid "Error in %s"
|
|
msgstr "Chyba v %s"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr "Chyba ve jméně souboru překladače:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr "Chyba ve vlastních nastaveních překladače (Ostatní):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr "Chyba ve vlastních nastaveních spojovače (Překládání a Spojování / Předat volby spojovači):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr "Chyba v \"Přidané cesty Ladiče\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr "Chyba v prohledávaných cestách pro \"Zahrnuté souboru\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr "Chyba v prohledávaných cestách pro \"Knihovny\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr "Chyba v prohledávaných cestách pro \"Soubory objektů\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr "Chyba v prohledávaných cestách pro \"Ostatní zdroje\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr "Chyba v prohledávaných cestách pro \"Ostatní soubory jednotek\":"
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr "Chyba v \"výstupní adresář jednotek\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgid "Error: invalid build mode \"%s\""
|
|
msgstr "Chyba: (lazarus) neplatný režim sestavení \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Chyba načítání souboru"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
#, object-pascal-format
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr "Chyba načítání souboru \"%s\":"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Chyba přesunu komponenty"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
#, object-pascal-format
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Chyba přesunu komponenty %s:%s"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr "Chyba pojmenování komponenty"
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr "Chyba otevírání komponenty"
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr "Chyba při otevírání formuláře"
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Chyba analýzy komponentového proudu lfm."
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
#, object-pascal-format
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Chyba načítání seznamu balíčků ze souboru%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr "Chyba načítání XML"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr "Chyba čtení XML souboru \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Chyba přejmenování souboru"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Chyby"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
#, object-pascal-format
|
|
msgid ", Errors: %s"
|
|
msgstr ", Chyb:%s"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr "Chyba během ukládání formuláře"
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
#, object-pascal-format
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr "Chyba nastavení jména komponenty %s na %s"
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
#, object-pascal-format
|
|
msgid "Error writing file \"%s\""
|
|
msgstr "Chyba zápisu do souboru \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
#, object-pascal-format
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Chyba zápisu seznamu balíčků do souboru%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
#, fuzzy
|
|
#| msgid "Every n-th line number"
|
|
msgid "Show every n-th line number"
|
|
msgstr "Každé n-té číslo řádku"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr "Ukázkový soubor:"
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
#, object-pascal-format
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr "Příklady:%sIdentifikátor%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
|
|
#: lazarusidestrconsts.lisexclude
|
|
msgid "Exclude"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
#, object-pascal-format
|
|
msgid "%s excluded at run time"
|
|
msgstr "%s vyjmuto za běhu"
|
|
|
|
#: lazarusidestrconsts.lisexcludesforstars
|
|
msgid "Excludes for * and ** in unit and include search paths"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
#, object-pascal-format
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr "spustitelný soubor \"%s\" je adresář"
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
#, object-pascal-format
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr "spustitelný soubor \"%s\" postrádá oprávnění ke spuštění"
|
|
|
|
#: lazarusidestrconsts.lisexecuteafter
|
|
msgid "Execute After"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutebefore
|
|
msgid "Execute Before"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Vykonání zastaveno"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstoppedexitcode
|
|
#, object-pascal-format
|
|
msgid "Execution stopped with exit-code %1:d ($%2:s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Ukončit"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
#, object-pascal-format
|
|
msgid "Exit code %s"
|
|
msgstr "Exit kód %s"
|
|
|
|
#: lazarusidestrconsts.lisexpand
|
|
msgid "Expand"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
#, fuzzy
|
|
#| msgid "Expand All (*)"
|
|
msgid "Expand All [Ctrl+Plus]"
|
|
msgstr "Rozevřít vše (*)"
|
|
|
|
#: lazarusidestrconsts.lisexpandall2
|
|
msgid "Expand All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Rozevřít všechny třídy"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Rozevřít všechny balíčky"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Rozevřít všechny jednotky"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Úplné souborové jméno aktuálního souboru v editoru"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Exportovat"
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr "Exportovat vše"
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr "Exportovat všechny položky do souboru"
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr "Exportovat volby prostředí"
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr "Exportovat jako HTML"
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr "Exportovat / Importovat"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
#, fuzzy
|
|
#| msgid "Export package list (*.xml)"
|
|
msgid "Export package list"
|
|
msgstr "Exportovat seznam balíčků (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr "Exportovat vybrané"
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr "Exportovat >>"
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Rozbalit"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr "Rozbalit proceduru"
|
|
|
|
#: lazarusidestrconsts.lisextraopts
|
|
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr "Extrémně výřečný"
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External Tools"
|
|
msgstr "Vnější nástroje"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Dosažen max. počet nástrojů"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
#, object-pascal-format
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Toto je maximální počet nástrojů %s."
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
#, object-pascal-format
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr "Selhalo přidání %d není jedinečný zdroj(e)"
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
#, object-pascal-format
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr "Selhalo vytváření Aplikačního balíku pro \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr "Načtení stavu složení selhalo"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr "selhalo řešení maker"
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr "Uložení souboru selhalo."
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr "Fatální"
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgctxt "lazarusidestrconsts.lisfile"
|
|
msgid "File"
|
|
msgstr "Soubor"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr "Soubor: "
|
|
|
|
#: lazarusidestrconsts.lisfilealreadyexists
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" already exists."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr "Přípona souboru programu"
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Filtr souboru"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr "Souborové filtry"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr "Přidat řádek"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr "Smazat řádek"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr "Vložit řádek"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr "Maska souboru"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr "Nastavit předvolené"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr "Toto jsou souborové filtry, které se zobrazí v dialogu Otevřít souobor"
|
|
|
|
#: lazarusidestrconsts.lisfilefound
|
|
msgid "File found"
|
|
msgstr "Soubor nalezen"
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr "Soubor \"%s\" byl pozměněn. Uložit?"
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr "Soubor nemá projekt"
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr "Soubor je adresářem"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr "Soubor není spustitelný"
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Soubor \"%s\" je virtuální."
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr "Styl jména souboru"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Soubor nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
#, object-pascal-format
|
|
msgid "file %s not found"
|
|
msgstr "soubor %s nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr "soubor nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
#, object-pascal-format
|
|
msgid "File not found:%s%s"
|
|
msgstr "Soubor nenalezen:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Soubor \"%s\" nenalezen.%sChcete jej vytvořit?"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Soubor není s malými písmeny"
|
|
|
|
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
|
|
#, object-pascal-format
|
|
msgid "%d files were converted to text format."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings"
|
|
msgstr "Nastavení souboru"
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
#, object-pascal-format
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr "Soubor %s má neplatnou syntax."
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
#, object-pascal-format
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr "Soubor: %s má proceduru 'Register': %s v sekci 'uses' balíčku: %s"
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr "*** Všechny nalezené soubory již mají správné kódování ***"
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "Soubory v ASCII nebo v kódování UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "File %s is converted to text format."
|
|
msgid "File %s was converted to text format."
|
|
msgstr "Soubor %s je převeden do textového formátu."
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Soubor, které nejsou v ASCII ani kódování UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
#, fuzzy
|
|
#| msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgid "File where debug output is written to. Default is write to the console."
|
|
msgstr "soubor, kam je zapisován ladící výstup. Pokud není uveden, ladící výstup je vypisován do konzoly."
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Filtr"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
#, object-pascal-format
|
|
msgid "Filter: %s"
|
|
msgstr "Filtr: %s"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr "Filtrovat všechny zprávy určitého typu"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
#, object-pascal-format
|
|
msgid "Filter all messages of type %s"
|
|
msgstr "Filtrovat všechny zprávy typu %s"
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr "Filtr už existuje"
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr "Filtrovat ladící zprávy a níže"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr "Filtrovat tipy a níže"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr "Filtrovat tipy bez polohy v kódu"
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr "Nefiltrovat podle důležitosti"
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr "Filtrovat nedůležité zprávy"
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr "Filtrovat poznámky a níže"
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr "Sady filtrů"
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr "Filtrovat seznam dostupných možností"
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr "Filtrovat výřečné zprávy a níže"
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr "Filtrovat varování a níže"
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr "Hledat ..."
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
#, object-pascal-format
|
|
msgid "Find Declaration of %s"
|
|
msgstr "Hledat deklarace %s"
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr "A&dresáře"
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr "Souborová maska"
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
msgid "Include &sub directories"
|
|
msgstr "Zahrnout podadresáře"
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "&Víceřádkový vzor"
|
|
|
|
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
|
|
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
#, fuzzy
|
|
#| msgid "search all files in &project"
|
|
msgid "all files in &project"
|
|
msgstr "hledat všechny soubory v &projektu"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
#, fuzzy
|
|
#| msgid "search all &open files"
|
|
msgid "all &open files"
|
|
msgstr "hledat všechny &otevřené soubory"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
#, fuzzy
|
|
#| msgid "search in &active file"
|
|
msgid "&active file"
|
|
msgstr "hledat v aktivním souboru"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
#, fuzzy
|
|
#| msgid "search in &directories"
|
|
msgid "&directories"
|
|
msgstr "hledat v &adresářích"
|
|
|
|
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
|
|
msgid "project &group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
#, fuzzy
|
|
#| msgid "Where"
|
|
msgid "Search location"
|
|
msgstr "Kde"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Najít kombinaci kláves"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr "Hledat scházející jednotku"
|
|
|
|
#: lazarusidestrconsts.lisfindoption
|
|
msgid "Find option"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfindoverridestoo
|
|
msgid "Find overrides too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr "První"
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr "&První test"
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "Opravit LFM soubor"
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr "Tip při fokusu"
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Vynutit přejmenování"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
#, fuzzy
|
|
#| msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr "Například ukázat nahoře místní proměnné, když členové aktuální třídy, když předci, když aktuální jednotky, když použité jednotky"
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr "Formulář"
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr "Pro macOS (Darwin)"
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Chyba formátování"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr "Pro Windows"
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
#, object-pascal-format
|
|
msgid "Found version %s, expected %s"
|
|
msgstr "Nalezena verze %s, očekávána %s"
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr "Verze FPC jako jedno číslo (např. 20701)"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr "Soubor zpráv FPC:"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr "Zprávy FPC: Dodatek"
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr "Zdroje (.res) FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr "Zdroje FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr "Příliš staré FPC"
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "Verze FPC: "
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "Verze FPC (např. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "Editor FPDoc"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
#, object-pascal-format
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr "Chyba zápisu \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr "Syntaktická chyba FPDoc"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr "Jméno balíčku FPDoc:"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr "Jméno balíčku FPDoc. Výchozí je jméno souboru projektu."
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
#, object-pascal-format
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr "Syntaktická chyba v fpdoc elementu \"%s\":%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfppkgcompilerproblem
|
|
msgid "there is a problem with the Free Pascal compiler executable, "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfgenproblems
|
|
msgid "Warnings have to be resolved first"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfiguration
|
|
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
|
|
#, object-pascal-format
|
|
msgid "Fppkg configuration file not found:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgcreatefilefailed
|
|
#, object-pascal-format
|
|
msgid "Failed to generate the configuration file \"%s\": %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfilestobewritten
|
|
msgid "Files to be written:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfixconfiguration
|
|
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
|
|
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
|
|
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
|
|
msgid "An up-to-date version is needed to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
|
|
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
|
|
msgid "It is probably too old to create the configuration files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
|
|
#, object-pascal-format
|
|
msgid "The fpcmkcfg configuration tool it too old [%s]."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkginstallationpath
|
|
#, object-pascal-format
|
|
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkglibprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc library prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgprefix
|
|
#, object-pascal-format
|
|
msgid "Fpc prefix: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgproblem
|
|
msgid "Problem with Fppkg configuration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
|
|
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfexception
|
|
#, object-pascal-format
|
|
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconffailed
|
|
#, object-pascal-format
|
|
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfppkgwriteconfigfile
|
|
msgid "Write new configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr "Rámec"
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "&Hledat pozpátku"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
#, object-pascal-format
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr "uvolňování řádků zásobníku: %s"
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr "Zprávy Free Pascal Compileru"
|
|
|
|
#: lazarusidestrconsts.lisfreepascalprefix
|
|
msgid "Free Pascal compiler prefix"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Zdrojový adresář Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "Hleda&t dopředu"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Doplňující soubory k vyhledání (např. /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Najít nebo přejmenovat identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Najít odkazy"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
#, object-pascal-format
|
|
msgid "Identifier: %s"
|
|
msgstr "Identifikátor: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "ve všech otevřených balíčcích a projektech"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "v aktuální jednotce"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "v hlavním projektu"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "v projektu/balíčku vlastnícím aktuální jednotku"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Neplatný identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Přejmenovat všechny výskyty"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr "Přejmenování"
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr "Hledat"
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Hledat také v příkazech"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr "Celá cesta"
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "Funkce"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Obecné"
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
|
|
#, object-pascal-format
|
|
msgid "Fppkg compiler configuration: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
|
|
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
|
|
msgid "Generate new Fppkg configuration files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetbuildmodes
|
|
msgid "Print a list of build modes in the project. Active mode is listed first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetexpandtext
|
|
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr "získat slovo na aktuální pozici"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr "Získat slovo na aktuální pozici kurzoru."
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr "Celkové nastavení"
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr "Přejít na řádek"
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <rok> <jméno autora> <kontakt>\n"
|
|
"\n"
|
|
"Tento zdrojový kód je svobodný program; můžete ho rozšiřovat a/nebo upravovat podle podmínek GNU Všeobecné veřejné licence, tak jak je zveřejněná Nadací Free Software; verze 2 licence nebo (podle svého rozhodnutí) jakékoliv pozdější verze.\n"
|
|
"\n"
|
|
"Tento zdrojový kód je šířen v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez zahrnuté záruky PRODEJNOSTI nebo VHODNOSTI NA PŘÍSLUŠNÝ ÚČEL. Další detaily získáte v GNU Všeobecné veřejné licenci.\n"
|
|
"\n"
|
|
"Kopie GNU Všeobecné Veřejné Licence je dostupná přes World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Můžete ji získat také napsáním do Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Skupina"
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr "Automaticky určené místní proměnné skupiny"
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
#, fuzzy
|
|
#| msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgid "Enable or disable groups of debug output. Valid options are:"
|
|
msgstr "Povolit nebo zakázat skupiny v ladicím výstupu. Platné volby jsou:"
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Narůst na největší"
|
|
|
|
#: lazarusidestrconsts.lisgutterpartmargin
|
|
msgid "Margin"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgutterpartvisible
|
|
msgid "Visible"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgutterpartwidth
|
|
msgid "Width"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr "Má nápovědu"
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr "Barva hlavičky"
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Hlavičkový komentář pro třídu"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr "Položky nápovědy"
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Výběr nápovědy"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Nápověda pro zprávy překladače Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr "Skrýt všechny tipy a varování vložením IDE direktivy {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr "Skrýt zprávu na %s vložením IDE direktivy {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr "Skrýt zprávu vložením IDE direktivy {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
#, object-pascal-format
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr "Skrýt zprávu pomocí vložení {$warn %s off} do jednotky \"%s\""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr "Skrýt hledání"
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr "Skrýt okno"
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
#, object-pascal-format
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr "Skrýt volbou balíčku (-vm%s)"
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
#, object-pascal-format
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr "Skrýt volbou projektu (-vm%s)"
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr "Tip"
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr "Tip: přednastavená hodnota může být definována v podmíněných."
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr "Pokyn u jména vlastnosti ukazuje její popis."
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr "Tip: Zkontrolujte, zda dva balíčky neobsahují jednotku se stejným jménem."
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr "Tip: Klikněte na \"Ukázat volby\" ke zjištění, odkud se berou přicházející zděděné cesty."
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
#, object-pascal-format
|
|
msgid ", Hints: %s"
|
|
msgstr ", Pokynů:%s"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
#, object-pascal-format
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Tip: Funkce \"Vytvořit Řetězec Zdrojů\" očekává řetězcovou konstantu.%sProsím vyberte výraz a zkuste znova."
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Zobrazit formuláře"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Zobrazit jednotky"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Databáze"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Volby nápovědy"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Vlastnosti:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Zobrazovače"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "Cesta FPC Doc HTML"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Horizontální"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr "Vodorovné linky mezi vlastnostmi."
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr "ID"
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr "Přídavek"
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr "Otevírání"
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr "IDE"
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr "Volby sestavení IDE"
|
|
|
|
#: lazarusidestrconsts.lisidecaptioncustomhint
|
|
msgid "Additional info to display in the IDE title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr "IDE bude znovu přeloženo a restartováno během instalace/odinstalace balíčků."
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
#, object-pascal-format, fuzzy, badformat
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr "Vítejte v Lazarusu.%0:sNalezená Konfigurace IDE byla dříve použita jinou instalací Lazarusu.%0:sPokud máte dvě a více oddělených instalací Lazarusu, tyto instalace by neměly sdílet stejnou konfiguraci. To by mohlo vést ke konfliktům a Vaše instalace Lazarusu by se mohly stát nestabilní.%0:s%0:sPokud máte pouze jednu instalaci a zkopírovanoý/přesunutý spustitelný soubor Lazarusu, může aktualizovat tuto konfiguraci.%0:s%1:s%0:s%0:sVyberte:%0:s%:s* Informace o aktualizaci: Použijte tuto konfiguraci a aktualizujte jipro budoucí použití s Lazarusem. Stará instalace ji nebude více používat.%0:s* Ignorovat: Použít tuto konfiguraci, ale ponechat upozornění. Toto může vést ke konfliktům s ostatními instalacemi.%0:s* Zrušit: Ukončit právě teď. Můžete potom vyřešit problém spuštěním Lazarusu se správnou konfigurací.%0:s%0:sDalší informace:%0:sTato konfigurace je pro: %2:s%0:sPatří instalaci Lazarusu v %3:s%0:s.Aktuální IDE bylo spuštěno z: %4:s%0:s"
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr "Informace o IDE"
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr "Makra IDE"
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr "IDE spravuje Application.Scaled (Hi-DPI) v hlavní jednotce."
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr "IDE udržuje titulek v hlavní jednotce."
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr "identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Identifikátor začíná s..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercannotbedotted
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" cannot be dotted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercannotbeempty
|
|
msgid "Identifier cannot be empty"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Identifikátor obsahuje..."
|
|
|
|
#: lazarusidestrconsts.lisidentifierisalreadyused
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is already used"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisalreadyused2
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is already used."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerfunction
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a declared compiler function."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisdeclaredcompilerprocedure
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a declared compiler procedure."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisinvalid
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is invalid"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidentifierisreservedword
|
|
#, object-pascal-format
|
|
msgid "Identifier \"%s\" is a reserved word"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "Volby IDE:"
|
|
|
|
#: lazarusidestrconsts.lisidetitlecustom
|
|
msgid "Custom IDE title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitleoptions
|
|
msgid "IDE main window and taskbar title"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
#, fuzzy
|
|
#| msgid "IDE title starts with project name"
|
|
msgid "Show custom IDE title before built-in IDE title or info"
|
|
msgstr "Titulek IDE začíná názvem projektu"
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr "Všechny režimy sestavení"
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr "Volby překladače pro"
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr "Aktuální režim sestavení"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr "Chyba při otevírání XML"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
#, object-pascal-format
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr "Chyba při otevírání XML souboru \"%s\":%s%s"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr "Exportovat Volby Překladače"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Exportovaný soubor existuje"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
#, object-pascal-format
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "Exportovaný soubor \"%s\" existuje.%sOtevřít soubor a nahradit jen volby překladače?%s(Ostatní nastavení zůstanou zachována.)"
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr "Importovat Volby Překladače"
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Načíst ze souboru"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
#, object-pascal-format
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr "Soubor \"%s\" neobsahuje volby překladače."
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Uložit soubor"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr "Pokud není zaškrtnuto:"
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr "Pokud jsou změněny pouze informace sezení, zeptej se na uložení."
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
#, object-pascal-format
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr "Pokud chcete používat dvě rozdílné verze Lazarusu, musíte spustit druhou verzi s parametrem příkazové řádky primary-config-path nebo pcp.%sNapříklad:"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Ignorovat vše"
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
#, object-pascal-format
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr "Ignorovat, použít %s jako předka"
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr "Přizpůsobit odsazení aktuální jednotce, projektu nebo balíčku"
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr "Komentář provedení pro třídu"
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr "Importovat"
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr "Důležité"
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr "Importovat volby prostředí"
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr "Importovat ze Souboru"
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr "Importování BuildModes není podporováno pro balíčky."
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
#, fuzzy
|
|
#| msgid "Import package list (*.xml)"
|
|
msgid "Import package list"
|
|
msgstr "Importovat seznam balíčků (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr "Nemožné"
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
#, object-pascal-format
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr "Ve zdrojovém adresáři balíčku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr "Ve zdrojovém adresáři projektu. Ověřte duplicity."
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "cesta zahrnutí"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Cesty pro začleněné soubory"
|
|
|
|
#: lazarusidestrconsts.lisincluderecursive
|
|
msgid "Include, recursive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
#, object-pascal-format
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ", nekompatibilní ppu=%s"
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr "Nalezen neplatný konfigurační adresář"
|
|
|
|
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
|
|
#, object-pascal-format
|
|
msgid "there is a problem with the Fppkg configuration. (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr "Odsazení pro zdrojové texty pascalu"
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr "Informace"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
#, object-pascal-format
|
|
msgid "Information about %s"
|
|
msgstr "Informace o %s"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr "Informace o použitém FPC"
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr "V prohledávané cestě jednotek FPC. Zřejmě instalováno balíčkem FPC. Ověřte, zda překladač a soubory ppu jsou ze stejné instalace."
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr "Před související"
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr "Zděděná položka"
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr "Zděděné parametry"
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr "Zděděné komponenty projektu"
|
|
|
|
#: lazarusidestrconsts.lisinitialchecks
|
|
msgid "Initial Checks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr "Inicializovat místní proměnnou"
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
#, object-pascal-format
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr "Před vytvořením čisté kopie projektu/balíčku budou smazané všechny soubory v následujícím adresáři a veškerý jejich obsah bude ztracen.%sSmazat všechny soubory v \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Vložit"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
#, object-pascal-format
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr "Vložit přiřazení %s := ..."
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr "vložit datum"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr "vložit datum a čas"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr "Vložit datum a čas. Volitelně: formátovací řetězec."
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr "Vložit datum. Volitelně: formátovací řetězec."
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr "vložit konec pokud je třeba"
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
|
msgid "Insert Macro"
|
|
msgstr "Vložit makro"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure."
|
|
msgstr "Vložit jméno aktuální procedury."
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr "Vložit značku printshort"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr "vložit hlavičku procedury"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr "vložit jméno procedury"
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
msgid "Insert semicolon if needed"
|
|
msgstr "Vložit středník pokud je třeba"
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr "vložit čas"
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr "Vložit čas, Volitelné: formátovaný řetězec."
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr "Vložit značku url"
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr "V sezení"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr "nainstalováno"
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr "Nainstalovat jej, mám to rád tučné"
|
|
|
|
#: lazarusidestrconsts.lisinstallpackagesmsg
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "The following packages are not installed, but available in the main repository: %s.\n"
|
|
#| "Do you wish to install missing packages?\n"
|
|
msgid ""
|
|
"The following packages are not installed, but available in the main repository: %s.\n"
|
|
"Do you wish to install missing packages?"
|
|
msgstr ""
|
|
"Následující balíčky nejsou nainstalovány, ale dostupné z hlavního repozitáře: %s\n"
|
|
"Chcete instalovat chybějící balíčky?\n"
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Instalovat výběr"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr "Instalovat/Odinstalovat balíčky"
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
#, fuzzy
|
|
#| msgid "Instead of compile package create a simple Makefile."
|
|
msgid "Instead of compiling a package create a simple Makefile."
|
|
msgstr "Místo překladu balíčku vytvořte jednoduchý Makefile."
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr "Nedostatečné kódování"
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr "Interaktivní"
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
#, object-pascal-format
|
|
msgid "internal error: %s"
|
|
msgstr "vnitřní chyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddeclaration
|
|
msgid "Invalid Declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Neplatné odebrání"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr "Neplatný spustitelný soubor"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr "Soubor \"%s\" není spustitelný."
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
#, object-pascal-format
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Neplatný výraz.%sTip: Funkce \"Vytvořit Řetězce Zdrojů\" očekává řetězcovou konstantu v jediném souboru. Prosím vyberte výraz a zkuste znova."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilename
|
|
msgid "Invalid file name"
|
|
msgstr "Neplatný jméno souboru"
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Neplatný filtr"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
#, object-pascal-format
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr "Chybný řádek, sloupec ve zprávě%s%s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
#, object-pascal-format
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr "Neplatná makra v \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
#, object-pascal-format
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr "Neplatná makra \"%s\" v externím nástroji \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
#, object-pascal-format
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr "Neplatné makro \"%s\". Jméno makra musí být identifikátor pascalu."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
#, object-pascal-format
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr "Neplatné jméno makra \"%s\". Jméno je klíčovým slovem."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr "Neplatná maska"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
#, object-pascal-format
|
|
msgid "Invalid mode %s"
|
|
msgstr "Neplatný mód %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Neplatný vícenásobný výběr"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Neplatný Pascalovský identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiername
|
|
#, object-pascal-format
|
|
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
|
|
msgstr "Jméno třídy \"%s\" není platný identifikátor pascalu.%sI tak použít?"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Neplatný název procedury"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Neplatné jméno projektu"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr "Neplatný adresář pro zveřejňování"
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Neplatný výběr"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
#, object-pascal-format
|
|
msgid "invalid version in %s"
|
|
msgstr "neplatná verze v %s"
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
#, object-pascal-format
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s už je částí projektu."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "\"%s\" je chybné jméno projektu.%sProsím vyberte jiné (např. projekt1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
#, object-pascal-format
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr "%s je %s.%sTato kruhová závislost není povolena."
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr "adresář nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr "Záležitosti"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
#, object-pascal-format
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr "Jak se to mohlo stát? Chyba v %s:"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr "Jak se to mohlo stát? Chyba v hlavním adresáři:"
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historie skoků"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr "Skočit na chybu"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr "Skočit na ni, pokud je nalezena chyba ve zdrojích při doplnění identifikátorů."
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
#, object-pascal-format
|
|
msgid "Jump to procedure %s"
|
|
msgstr "Skočit na proceduru %s"
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
#, object-pascal-format
|
|
msgid "%s KB"
|
|
msgstr "%s KB"
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr "Uchovat"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr "Uchovat převedené soubory otevřené v editoru"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr "Všechny soubory projektu budou po převodu otevřeny v editoru"
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Zachovat jméno"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr "Ponechat otevřené"
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
#, fuzzy
|
|
#| msgid "Keep relative indentation of multi line template"
|
|
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
|
|
msgstr "Zachovat relativní odsazení víceřádkové šablony"
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
#, fuzzy
|
|
#| msgid "Keep indentation"
|
|
msgid "Absolute indentation"
|
|
msgstr "Zachovat odsazení"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Ponechat je a pokračovat"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Klávesa"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Vlastní příkazy"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Povely návrháře"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Příkazy inspektoru objektů"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr "Klávesa (nebo pořadí dvou kláves)"
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Přerušit sestavování"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr "Přidat adresu bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr "Přidat zdroj bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr "Přidat data/kukátko"
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgctxt "lazarusidestrconsts.liskmaddwatch"
|
|
msgid "Add watch"
|
|
msgstr "Přidat sledování"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr "Sestavit mnoho režimů"
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Sestavit projekt/program"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr "Vyberte schéma mapování kláves"
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Vzor"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Vyčistit a sestavit"
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Zavřít projekt"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr "Editor definic CodeTools"
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr "Přeložit projekt/program"
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config \"Build File\""
|
|
msgstr "Konfigurace \"Soubor sestavení\""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfigurovat vlastní komponenty"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Kontextová nápověda"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Převést Delphi balíček na Lazarus balíček"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Převést Delphi projekt na Lazarus projekt"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Převést Delphi jednotku na Lazarus jednotku"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Převést DFM soubor na LFM"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected components"
|
|
msgstr "Zkopírovat vybrané komponenty"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected components"
|
|
msgstr "Vyjmout vybrané komponenty"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
msgid "Default adapted to macOS"
|
|
msgstr "Výchozí přizpůsobení pro macOS"
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Odstranit poslední znak"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff Editor Files"
|
|
msgstr "Rozdíl editovaných souborů"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Upravit šablony kódů"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Upravit kontextově citlivou nápovědu"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Zabalit výběr do bloku kódu"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Vyhodnocení/Upravení"
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Nastavení vnějších nástrojů"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
msgid "Find Incremental"
|
|
msgstr "Dopředné hledání"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Zkoumat"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Schéma mapování kláves"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus default"
|
|
msgstr "Výchozí lazarusu"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "macOS, Apple style"
|
|
msgstr "macOS, styl Apple"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "macOS, Lazarus style"
|
|
msgstr "macOS, style Lazarus"
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr "Nový balíček"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Nový projekt"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Nový projekt ze souboru"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nová jednotka"
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr "Poznámka: Všechny klávesy budou nastaveny na hodnoty vybraného schéma."
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Otevřít soubor balíčku"
|
|
|
|
#: lazarusidestrconsts.liskmopenrecent
|
|
msgctxt "lazarusidestrconsts.liskmopenrecent"
|
|
msgid "Open Recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentpackage
|
|
msgid "Open recent package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmopenrecentproject
|
|
msgid "Open recent project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components"
|
|
msgstr "Vložit komponenty"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Pozastavit program"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Zveřejnit projekt"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Rychlý překlad, bez spojování"
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr "Odstranit aktivní soubory z projektu"
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Spustit program"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
#, fuzzy
|
|
#| msgid "SaveAll"
|
|
msgctxt "lazarusidestrconsts.liskmsaveall"
|
|
msgid "Save All"
|
|
msgstr "UložitVše"
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
#, fuzzy
|
|
#| msgid "SaveAs"
|
|
msgid "Save As"
|
|
msgstr "UložitJako"
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Uložit projekt"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Uložit projekt jako"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
msgid "Stop Program"
|
|
msgstr "Zastavit program"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Přepnout mezi Jednotkou a Formulářem"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr "Zobrazit Assembler"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "View Breakpoints"
|
|
msgstr "Zobrazit body přerušení"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Zobrazit Zásobník volání"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr "Přepnout zobrazení Prohlížeče kódu"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Přepnout zobrazení Průzkumníku kódu"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Přepnout zobrazení palety komponent"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr "Zobrazit Záznam událostí ladiče"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "View Debugger Output"
|
|
msgstr "Zobrazit Ladící výstup"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Přepnout zobrazení Editoru dokumentace"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr "Zobrazit historii"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Přepnout zobrazení Rychlých tlačítek IDE"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "View Local Variables"
|
|
msgstr "Zobrazit Místní proměnné"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmemviewer
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
|
|
msgid "View Mem viewer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Přepnout zobrazení Zpráv"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Přepnout zobrazení Inspektoru objektů"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Console In/Output"
|
|
msgstr "Zobrazit Konzoli Vstup/Výstup"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr "Zobrazit Registry"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Přepnout zobrazení Výsledků hledání"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Přepnout zobrazení Zdrojového editoru"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Zobrazit vlákna"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "View Watches"
|
|
msgstr "Zobrazit Sledování"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Zobrazit historii skoků"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Zobrazit nastavení projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View Project Source"
|
|
msgstr "Zobrazit zdroj projektu"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Zobrazit informace o jednotce"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr "Poslední otevřené"
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Neplatné spouštění aplikace"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Spouštění cílové příkazové řádky"
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr "Lazarus Výchoí"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Adresář Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirhint
|
|
#, object-pascal-format
|
|
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
#, fuzzy
|
|
#| msgid "directory to be used as a basedirectory"
|
|
msgid "Directory to be used as a basedirectory."
|
|
msgstr "adresář, který bude použit jako základový"
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
#, object-pascal-format
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr "Lazarus IDE v%s"
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr "Lazarus IDE"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "ID jazyka Lazarusu (např. en, de, br, cz)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Jméno jazyka Lazarusu (např. angličtina, čeština)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [volby] <jméno-projektu>"
|
|
|
|
#: lazarusidestrconsts.lislazbuild
|
|
msgid "lazbuild"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr "Vybrat výstupní adresář spustitelných souborů IDE "
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr "Jste si jisti smazáním tohoto sestavovacího profilu?"
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr "Sestavit více"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr "Společná nastavení"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before build"
|
|
msgstr "Potvrdit před sestavením"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr "Potvrdit smazání"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr "Ladit IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr "Definice"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr "Definice bez -d"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr "Upravit definice"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr "Upravit seznam definic použitelných libovolným profilem"
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Chyba zapisování souboru"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
#, object-pascal-format
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr "%s%s%s%slazbuild není interaktivní, nyní přerušuji."
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr "Úprava sestavovacích profilů"
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr "Upravit profily"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr "Jméno aktivního profilu"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr "Přidat nový profil"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr "Současné sestavovací volby budou spojeny s:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr "Normální IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr "Optimalizované IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Nastavení:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr "Volby předané překladači"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionssyntax
|
|
msgid "lazbuild [options] <project/package filename or package name>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr "Profil k sestavení"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr "Přejmenovat profil"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr "Nové jméno profilu:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after building IDE"
|
|
msgstr "Restartovat po sestavení IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr "Automaticky restartovat Lazarus po sestavení IDE (nemá vliv na sestavení jiných částí)"
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr "Vybrat profily k sestavení"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr "Zobrazit potvrzovací dialog při sestavování přímo z nabídky Nástroje"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr "Zobrazit volby a definice pro příkazový řádek"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Cílové CPU:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Cílový adresář:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Cílový OS:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
#, object-pascal-format
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Nelze zapisovat do souboru \"%s\":%s"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
|
msgid "Update revision.inc"
|
|
msgstr "Aktualizovat revision.inc"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr "Aktualizovat informace o revizi v dialogu \"O Lazarusu\""
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Vyčistit + Sestavit vše"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr "Verze Lazarusu (př. 1.2.4)"
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
msgid "LCL widget type"
|
|
msgstr "Typ LCL Widgetu"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr "Přidat odkaz ke zděděnému"
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Kopírovat ze zděděného"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
#, object-pascal-format
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr "%s nemá platnou cestu FPDoc.%sNelze vytvořit fpdoc soubor pro %s"
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Přesunout položky do zděděného"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr "Neplatná cesta FPDoc"
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
#, object-pascal-format
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr "Jednotka %s není vlastněna žádným balíčkem nebo projektem.%sProsím přidejte jednotku do balíčku nebo projektu.%sNelze vytvořit soubor fpdoc."
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "Vlevo"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Levý okraj. Tato hodnota je přidaná k základnímu okraji a použitá pro mezeru vlevo od prvku."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Levé ukotvení"
|
|
|
|
#: lazarusidestrconsts.lisleftgutter
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisleftgutter"
|
|
msgid "Left"
|
|
msgstr "Vlevo"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto je sourozenec prvku, k jehož levé straně je ukotvený. Ponechte prázdné pro ukotvení k rodiči v Delphi stylu (BorderSpacing a ReferenceSide nehrají roli)"
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Levé strany"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Shodná levá vzdálenost"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr "Méně"
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgctxt "lazarusidestrconsts.lislevels"
|
|
msgid "Levels"
|
|
msgstr "Úrovně"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "Soubor LFM"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr "LFM soubor obsahuje neznámé vlastnosti/třídy které neexistují v LCL. Mohou být nahrazeny nebo smazány."
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "Poškozený soubor LFM"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr "LFM je v pořádku"
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<popis>\n"
|
|
"\n"
|
|
"Copyright (C) <rok> <jméno autora> <kontakt>\n"
|
|
"\n"
|
|
"Tato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat za podmínek GNU Library General Public License, tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze.\n"
|
|
"\n"
|
|
"Tento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOIV ZÁRUKY; dokonce i bez záruky PRODEJNOSTI anebo PRO PŘÍŠLUŠNÝ ÚČEL. Další podrobnosti najdete v GNU Library General Public License.\n"
|
|
"Kopii GNU Library General Public License by jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "cesta knihovny"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
#, fuzzy
|
|
#| msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
|
|
msgstr "Sdílená knihovna Free Pascalu (.dll ve Windows, .so v Linuxu, .dylib v MacOS X)."
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr "Odkaz:"
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "volby spojovače"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr "Cíl odkazu"
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr "seznam všech případných hodnot"
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
#, object-pascal-format
|
|
msgid "Loading %s failed."
|
|
msgstr "Načítání %s selhalo."
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr "Nahrát makro z"
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr "&Místní"
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr "řetězec malými písmeny"
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr "Řetězec s malými písmeny dán jako parametr."
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of project files (LPI and LPS)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
|
|
msgid "Maximize compatibility of package file (LPK)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
|
|
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
#, object-pascal-format
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr "lpk zmizel z disku. Použiji alternativu %s"
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr "lpk chybí"
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr "Zahrnuté soubory zdrojů (.lrs) Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lismacpreferences
|
|
msgid "Preferences..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
#, object-pascal-format
|
|
msgid "Macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Zadejte údaje"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Zadejte spouštěcí parametry"
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Hlavní jednotka má v sekci Uses všechny jednotky projektu"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr "Hlavní jednotka je Zdrojový kód Pascalu"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr "Předpokládat Pascal také pokud nekončí s příponou .pas/.pp."
|
|
|
|
#: lazarusidestrconsts.lismajorchangesdetected
|
|
msgid "Major changes detected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismakecurrent
|
|
msgctxt "lazarusidestrconsts.lismakecurrent"
|
|
msgid "Current"
|
|
msgstr "Aktuální"
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Vytvořit spustitelný"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Nenalezen Make"
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Vytvořit ResourceString"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Doplnit k sekci"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
#, object-pascal-format
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resourcestring \"%s\" již existuje.%sProsím vyberte jiný název.%sPoužijte 'Ignorovat' pokud chcete i tak přidat."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Volby převodu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Vlastní identifikátor"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Identifikátor"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Délka identifikátoru:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Předpona identifikátoru:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Vlož podle abecedy"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Vložit závislé na kontextu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Neplatná sekce Resourcestring"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr "Prosím vyberte sekci resourcestring ze seznamu."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resourcestring již existuje"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Sekce zdrojových řetězců:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Náhled zdroje"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Konstantní řetězec ve zdroji"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Řetězec se stejnou hodnotou:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr "Ujistěte se, že všechny ppu soubor balíčku jsou v jeho výstupním adresáři."
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr "Spravovat editory zdrojových kódů ..."
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
|
|
msgstr "Nejvyšší počet vláken pro souběžný překlad. Výchozí je 0, což zjistí počet jader ze systému."
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
#, object-pascal-format
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr "Nejvýše souběžných procesů, 0 znamená výchozí (%s)"
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
#, object-pascal-format
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr "%s Možná musíte znovu přeložit balíček."
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
#, object-pascal-format
|
|
msgid "%s MB"
|
|
msgstr "%s MB"
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Přerušit sestavení"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr "O FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Přidat bod přerušení"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr "Přidat aktivní soubor do balíčku ..."
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Přidat bod skoku do historie"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Přidat editovaný soubor do projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
msgid "Add &Watch ..."
|
|
msgstr "Přidat sledování ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr "Zalomit řádky ve výběru"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Sestavit soubor"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Sestavit Lazarus s aktuálním profilem"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
#, object-pascal-format
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr "Sestavit Lazarus s profilem: %s"
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Zkontrolovat soubor LFM v editoru"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
msgid "Clean Directory ..."
|
|
msgstr "Vyčistit adresář ..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr "Vyčistit a sestavit ..."
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr "Zavřít soubor editoru"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Zavřít projekt"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "Editor definic pro CodeTools ..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
msgid "Comment Selection"
|
|
msgstr "Zakomentovat výběr"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr "Porovnat soubory ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr "Sestavit mnoho režimů ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Dokončení kódu"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr "Dokončení kódu (s dialogem)"
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Nastavit soubor pro Sestavení+Spuštění ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfigurovat vlastní komponenty ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Nastavit vnější nástroje ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Nastavení \"Sestavení Lazarusu\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Kontextová nápověda"
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Převést Delphi balíček na Lazarus balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Převést Delphi projekt na Lazarus projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Převést Delphi jednotku na Lazarus jednotku ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
#, fuzzy
|
|
#| msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgid "Convert Binary DFM to LFM ..."
|
|
msgstr "Převést binární DFM na textový LFM + zkontrolovat syntaxi ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Převést kódování projektů/balíčků ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
msgid "Debug Windows"
|
|
msgstr "Ladící okna"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr "Delphi převod"
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Úpravy"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Šablony kódu..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Upravit kontextově citlivou nápovědu"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Instalovat/Odinstalovat balíčky ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
#, object-pascal-format
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr "Nutno změnit urychlovací(&&) klávesu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr "Přidat novou položku nad vybratnou položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr "Přidat novou položku za vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr "Přidat novou položku před vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr "Přidat novou položku pod vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr "Přidat podnabídku napravo od vybrané položky"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr "Přidat podnabídku pod vybranou položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr "&Přidat z šablony ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
#, object-pascal-format
|
|
msgid "Add icon from %s"
|
|
msgstr "Přidat ikonu z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr "Přidat &ikonu seznamu obrázků"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr "Přidat položku nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr "&Přidat novou položku nad"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr "Přidat no&vou položku za"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr "&Pžidat novou položku před"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr "Přidat no&vou položku pod"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr "Přidat obsluhu &OnClick"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr "Přidat oddělovač &za"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr "Přidat oddělovač &před"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr "Přidat podnabídku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr "Přidat &podnabídku pod"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr "Přidat &podnabídku napravo"
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
#, object-pascal-format
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr "Nová šablona menu popsaná jako \"%s\" byla uložena na základě %s, s %d podpoložkami"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr "&Upravit,Základní nabídka úprav,&Vrátit zpět,Ctrl+Z,&Znovu použít,,-,,Vybrat &vše,Ctrl+A,V&jmout,Ctrl+X,K&opírovat,Ctrl+C,V&ložit,Ctrl+V,Vložit &speciálně,,-,,H&ledat,,N&ahradit,,&Jít na ...,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr "&Soubor,Základní nabídka soubor,&Nový,,&Otevřít ...,,&Uložit,,Uložit &jako,,-,,&Tisk,,&Nastavení tisku ...,,-,,K&onec,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr "&Nápověda,Základní nabídka nápovědy,Obsah &Nápovědy,F1,Index &Nápovědy,,&Online Nápověda,,-,,&Informace o Licenci,,&Kontrola aktualizací,,-,,&O programu,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr "&Okno,Základní nabídka okna,&Nové okno,,&Dlaždice,,&Kaskáda,,&Seřadit všechny,,-,,&Skrýt,,&Ukázat,,"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr "Popisek"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
#, object-pascal-format
|
|
msgid "Captioned items: %s"
|
|
msgstr "Popsané položky: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr "Popisek by něměl být prázdný"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
#, object-pascal-format
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr "Změnit konfliktní urychlovače \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr "Změnit &ikonu seznamu obrázků"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
#, object-pascal-format
|
|
msgid "Change %s for %s"
|
|
msgstr "Změnit %s pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
#, object-pascal-format
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr "Změnit konflikt zkratky \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
#, object-pascal-format
|
|
msgid "Change the shortCut for %s"
|
|
msgstr "Změnit zkratku pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
#, object-pascal-format
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr "Změnit zkratku 2 pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr "Vyberte šablonu k odstranění"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr "Vyberte šablonu pro vložení"
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr "Klikněte na nešedou položku k úpravě její zkratky nebo klikněte na hlavičku pro seřazení podle sloupce"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
msgid "Component is unexpected kind"
|
|
msgstr "Komponenta má neočekávaný druh"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr "Nepojmenovaná komponenta"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
msgid "<conflict resolution complete>"
|
|
msgstr "<vyřešení konfliktu dokončeno>"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
#, object-pascal-format
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr "Zpočátku nalezených konfliktů: %d"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
#, object-pascal-format
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr "Nejhlubší úroveň zanoření nabídky: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "&Delete item"
|
|
msgstr "&Smazat položku"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr "&Odstranit šablonu nabídky ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr "Odstranit uloženou šablonu nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr "Odstranit vybranou šablonu nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr "Smazat tuto položku a její podpoložky?"
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr "Zobrazit náhled jako &Vyskakovací nabídku"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr "Upravit &Popisek"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
#, object-pascal-format
|
|
msgid "Editing Caption of %s"
|
|
msgstr "Upravování popisku %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
#, object-pascal-format
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr "Pro vyřešení konflktu upravte %s.%s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
#, object-pascal-format
|
|
msgid "Editing %s for %s"
|
|
msgstr "Upravování %s pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
#, object-pascal-format
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr "Upravování %s.%s - nevybrána položky nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr "Vložit &popis nabídky:"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr "Zadejte novou zkratku pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
#, object-pascal-format
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr "Zadejte novou zkratku 2 pro %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr "Existující uložené šablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
msgid "Further shortcut conflict"
|
|
msgstr "Další konflik zkratky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr "Získejte nápovědu pro použití tohoto editoru"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr "&Odchytit klávesu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
#, object-pascal-format
|
|
msgid "GroupIndex: %d"
|
|
msgstr "GroupIndex: %d"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
#, object-pascal-format
|
|
msgid "Values in use: %s"
|
|
msgstr "Použité hodnoty: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr "Nevhodný popis"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
#, object-pascal-format
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr "Vložit šablonu nabídky do kořene %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr "Vložit vybranou šablonu nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr "není přiřazeno"
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
#, object-pascal-format
|
|
msgid "Items with icon: %s"
|
|
msgstr "Položky s ikonou: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
#, object-pascal-format
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr "Seznam zkratek a &urychlovačů pro %s ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
#, object-pascal-format
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr "Seznam zkratek pro %s ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Editor nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr "Akce položky nabídky"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
#, object-pascal-format
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr "Konflikt zkratky položky nabídky v %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr "Přesu&nout položku dolů"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr "&Posunout položku nalevo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr "Pře&sunout položku napravo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr "Přesun&out položku nahoru"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Posunout vybranou položku dolů"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr "Přesunout vybranou položku nalevo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr "Přesunout vybranou položku napravo"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Posunout vybranou položku nahodu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr "n/a"
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr "(nabídka nevybrána)"
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr "<žádný>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr "<žádný>,<žádný>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr "<žádný konflikt zkratky>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr "Žádné uživatelsky uložené šablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
#, object-pascal-format
|
|
msgid "Pick an icon from %s"
|
|
msgstr "Vybrat ikonu z %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
#, object-pascal-format
|
|
msgid "Popup assignments: %s"
|
|
msgstr "Popup přiřazení: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr "RadioItem"
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
#, object-pascal-format
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr "Zbývající konflikty: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr "&Ostranit všechny oddělovače"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
#, object-pascal-format
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr "Vyřešené konflikty: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr "Vyřešit vybrané konflikty"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr "&Vyřešit konflikt zkratky ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr "Uložené šablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr "&Uložit nabídku jako šablonu ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr "Uložit nabídku jako šablonu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr "Uložit nabídku jako šablonu pro budoucí použití"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr "Uložit zobrazenou nabídku jako novou šablonu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
#, object-pascal-format
|
|
msgid "%s conflicts with %s"
|
|
msgstr "%s koliduje s %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr "O&ddělovače"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
#, object-pascal-format
|
|
msgid "Shortcut items: %s"
|
|
msgstr "Položky zkratky: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
msgid "Shortcut not yet changed"
|
|
msgstr "Ještě nezměněná zkratka"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr "Zkratky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr "Zkrat&ky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr "Zkratky a urychlovací klávesy"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d)"
|
|
msgstr "Zkratky (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr "Zkratky (%d) a Urychlovací klávesy (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
msgid "Shortcut,Source Property"
|
|
msgstr "Zkratka,Vlastnosti zdroje"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s"
|
|
msgstr "Použité zkratky v %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
#, object-pascal-format
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr "Použité zkratky v %s (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
#, object-pascal-format
|
|
msgid "\"%s\" in %s"
|
|
msgstr "\"%s\" v %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "\"%s\" is already in use in %s as a shortcut.\n"
|
|
#| "Try a different shortcut.\n"
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut."
|
|
msgstr ""
|
|
"\"%s\" je již použito jako zkratka v %s.\n"
|
|
"Zkuste jinou zkratku.\n"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
#, object-pascal-format
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr "Prosím rozšířit: \"%s\" není dostatečný Popis"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
#, object-pascal-format
|
|
msgid "%s: Shortcuts"
|
|
msgstr "%s: Zkratky"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
#, object-pascal-format
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr "%s: Zkratky a urychlující klávesy"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
#, object-pascal-format
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr "%s.%s.%s - OnClick: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr "Standardní šablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr "Popis šablony:"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr "&Šablony"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr "Šablona uložena"
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "There are no user-saved menu templates.\n"
|
|
#| "\n"
|
|
#| "Only standard default templates are available.\n"
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available."
|
|
msgstr ""
|
|
"Nejsou žádné uložené uživatelské šablony nabídek.\n"
|
|
"\n"
|
|
"Jsou dostupné pouze standardní výchozí šablony.\n"
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
#, object-pascal-format
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr "TSCList.GetScanListCompName: neplatný index %d pro FScanList"
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "You have to change the shortcut from %s\n"
|
|
#| "to avoid a conflict\n"
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict"
|
|
msgstr ""
|
|
"Musíte změnit zkratku z %s\n"
|
|
"pro zamezení konfliktu\n"
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr "Musíte zadat text pro Caption"
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr "Uzavřít v $IFDEF ..."
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Obklopit výběr ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "Vyhodnocení/Upravení ..."
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Vyjmout proceduru ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Soubor"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Najít"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Hledat ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Najít odpovídající konec bloku kódu"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Najít začátek bloku kódu"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Najít deklaraci na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Najít odkazy na identifikátor ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
msgid "Find &in Files ..."
|
|
msgstr "Najít &v souborech ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Najít &Další"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Najít &Předchozí"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr "Najít reference použité jednotky"
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Nastavení ..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
msgid "Goto Include Directive"
|
|
msgstr "Jít na směrnici pro zahrnutí souboru"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
msgid "Goto Line ..."
|
|
msgstr "Přejít na řádek ..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Odhadnout chybně umístěný IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Odhadnout neuzavřený blok"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Nápověda"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE Internals"
|
|
msgstr "Vnitřek IDE"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Přírůstkové hledání"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
msgid "Indent Selection"
|
|
msgstr "Odsadit výběr"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Položka Poznámek k vydání"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Vložit z mapy znaků ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "Vložit klíčové slovo CVS"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
msgid "Current Date and Time"
|
|
msgstr "Datum a čas"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr "Vložit plné jméno souboru ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
|
msgid "Insert General"
|
|
msgstr "Vložit obecné"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
msgid "GPL Notice"
|
|
msgstr "GPL Poznámka"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr "GPL Poznámka (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
msgid "LGPL Notice"
|
|
msgstr "LGPL Poznámka"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr "LGPL Poznámka (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr "MIT Poznámka"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr "MIT Poznámka (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr "Upravená LGPL Poznámka"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr "Upravená LGPL Poznámka (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
msgid "Current Username"
|
|
msgstr "Uživatelské jméno"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "Zkoumat ..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
msgctxt "lazarusidestrconsts.lismenujumpback"
|
|
msgid "Jump Back"
|
|
msgstr "Skočit zpět"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
msgctxt "lazarusidestrconsts.lismenujumpforward"
|
|
msgid "Jump Forward"
|
|
msgstr "Skočit vpřed"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Skočit na"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr "Skočit na implementaci"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr "Skočit na Implementation uses"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr "Skočit na Initialization"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr "Skočit na Interface"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr "Skočit na Interface uses"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Skočit na další značku"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
msgid "Jump to Next Error"
|
|
msgstr "Skočit na následující chybu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Skočit na předchozí značku"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Skočit na předchozí chybu"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr "Skočit na začátek procedury"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr "Skočit na hlavičku procedury"
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
msgid "Lowercase Selection"
|
|
msgstr "Změnit výběr na malá písmena"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
#, fuzzy
|
|
#| msgid "Editor Macros ..."
|
|
msgctxt "lazarusidestrconsts.lismenumacrolistview"
|
|
msgid "Editor Macros"
|
|
msgstr "Návrhář maker ..."
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Vytvořit zdrojový řetězec ..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
|
msgid "MultiPaste ..."
|
|
msgstr "VíceVkládání ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Nová komponenta"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
#, object-pascal-format
|
|
msgid "New %s"
|
|
msgstr "Nový %s"
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nový formulář"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Nový ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgid "New Package ..."
|
|
msgstr "Nový balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Nový projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
msgid "New Project from File ..."
|
|
msgstr "Nový projekt ze souboru ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Nová jednotka"
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Online nápověda"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
msgid "&Open ..."
|
|
msgstr "&Otevřít ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Otevřít jméno souboru na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.lismenuopenfolder
|
|
msgid "Open Folder ..."
|
|
msgstr "Otevřít adresář ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Otevřít načtený balíček ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Otevřít soubor balíčku (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Otevřít balíček aktuální jednotky"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Otevřít projekt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
msgid "Open &Recent"
|
|
msgstr "Otevřít &nedávné"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
msgid "Open Recent Package"
|
|
msgstr "Otevřít nedávný balíček"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Otevřít nedávný projekt"
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr "Otevřít jednotku ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "Pa&ckage"
|
|
msgstr "&Balíček"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
msgid "Package Graph"
|
|
msgstr "Graf balíčku"
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgid "Package Links ..."
|
|
msgstr "Odkazy balíčku ..."
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr "Vložit ze schránky"
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr "Nová komponenta balíčku"
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
|
msgid "Procedure List ..."
|
|
msgstr "Seznam procedur..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Projekt"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Inspektor projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Volby projektu ..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "Spustit"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Vydat projekt..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
msgid "Quick Compile"
|
|
msgstr "Rychlý překlad"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Rychlá kontrola syntaxe"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr "Rychlá kontrola syntaxe OK"
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Odebrat z projektu..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Přejmenovat identifikátor ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenamelowercase
|
|
msgid "Rename Unit Files to LowerCase ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
|
msgid "Reporting a Bug"
|
|
msgstr "Nahlásit chybu"
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr "Znovu uložit formuláře s povoleným i18n"
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Znovu projít zdrojový adresář FPC"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
msgid "Reset Debugger"
|
|
msgstr "Resetovat ladící nástroj"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Navrátit"
|
|
|
|
#: lazarusidestrconsts.lismenurevertconfirm
|
|
#, object-pascal-format
|
|
msgid ""
|
|
"Discard all unsaved changes in\n"
|
|
"\"%s\"?\n"
|
|
"\n"
|
|
"This action cannot be undone and will affect all editor tabs with the file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "&Spustit"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Spustit soubor"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Spustit s parametry ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
#, fuzzy
|
|
#| msgid "Step over to &Cursor"
|
|
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
|
msgid "Run to Cursor"
|
|
msgstr "Spustit po ukazatel"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithdebugging
|
|
msgid "Run with Debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr "Spustit bez Ladění"
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
msgctxt "lazarusidestrconsts.lismenusave"
|
|
msgid "&Save"
|
|
msgstr "&Uložit"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
msgid "Save &As ..."
|
|
msgstr "Uložit &jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Uložit projekt"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Uložit projekt jako..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Hledat"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Vybrat"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrat vše"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
msgid "Select Code Block"
|
|
msgstr "Vybrat blok kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
msgid "Select Line"
|
|
msgstr "Vybrat řádek"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
msgid "Select Paragraph"
|
|
msgstr "Vybrat odstavec"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
msgid "Select to Brace"
|
|
msgstr "Vybrat po závorku"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select Word"
|
|
msgstr "Vybrat slovo"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Nastavit volnou záložku"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr "Ukázat bod vykonávání"
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr "Chytré tipy citlivé na kontext"
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
msgid "Sort Selection ..."
|
|
msgstr "Seřadit výběr ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr "Zdroje"
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr "Zaměnit velikost znaků ve výběru"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Tabulátory na mezery ve výběru"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "O aplikaci"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr "Zakomentovat / odkomentovat výběr"
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Nástroje"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
msgid "Uncomment Selection"
|
|
msgstr "Odkomentovat výběr"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
msgid "Unindent Selection"
|
|
msgstr "Zrušit odsazení výběru"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
msgid "Uppercase Selection"
|
|
msgstr "Změnit výběr na velká písmena"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr "Přidat jednotku do sekce uses ..."
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Zobrazení"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr "Editor kotev"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Prohlížeč kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Průzkumník kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr "Paleta komponent"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponenty"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Záznam událostí"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
msgid "Debug Output"
|
|
msgstr "Ladící výstup"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
msgid "Forms ..."
|
|
msgstr "Formuláře ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr "Historie"
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Historie skoků"
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
|
|
msgid "Local Variables"
|
|
msgstr "Místní proměnné"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Zprávy"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Inspektor objektů"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr "Zobrazit zdroj projektu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
|
|
msgid "Console In/Output"
|
|
msgstr "Kontola Vstup/Výstup"
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr "Registry"
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Prohlížeč omezení"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Výsledky hledání"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr "Pořadí záložek"
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr "Vlákna"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Přepnout zobrazení formulář/jednotka"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Závislosti jednotky"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
msgid "Unit Information ..."
|
|
msgstr "Informace jednotky ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
msgid "Units ..."
|
|
msgstr "Jednotky ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgctxt "lazarusidestrconsts.lismenuviewwatches"
|
|
msgid "Watches"
|
|
msgstr "Sledování"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr "Co vyžaduje sestavení"
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Okno"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Jiný list"
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Editor zpráv"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr "Okno zpráv"
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Třída metody nenalezena"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
#, object-pascal-format
|
|
msgid "missing directory \"%s\""
|
|
msgstr "chybějící adresář \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Chybějící události"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
#, object-pascal-format
|
|
msgid "missing executable \"%s\""
|
|
msgstr "chybějící spustitelný soubor \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Chybějící identifikátory"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Chybějící balíčky"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr "Vaše volby jsou:"
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr "Zakomentovat"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr "Pouze pro Delphi"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr "1) Zakomentovat vybrané jednotky."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr "1) Použít jednotky pouze pro Delphi."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr "2) Vyhledat jednotky. Nalezené cesty přidat do nastavení projektu."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
#, fuzzy
|
|
#| msgid "3) Abort now, install packages or fix paths and try again."
|
|
msgid "3) Leave these units in uses sections as they are."
|
|
msgstr "3) Nyní přerušit, instalovat balíčky nebo opravit cesty a pokusit se znova."
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr "Cesta jednotek projektu"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
#, fuzzy
|
|
#| msgid "Skip this Unit"
|
|
msgctxt "lazarusidestrconsts.lismissingunitsskip"
|
|
msgid "Skip"
|
|
msgstr "Přeskočit tuto jednotku"
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (c) <year> <copyright holders>\n"
|
|
#| "\n"
|
|
#| "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
#| "\n"
|
|
#| "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
#| "\n"
|
|
#| "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
|
|
msgstr ""
|
|
"<description>\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"Tímto je zde deklarováno povolení, bezplatně a jakékoli osobě zaopatřit si kopii tohoto software a asociované dokumentace (dále \"Software\"), využívat Software bez omezení, včetně neomezenosti práv k užívání, kopírování, úpravám, slučování, publikování, distribuování, sublicencování a/nebo k prodeji kopií Software. Software je předmětem následujících podmínek:\n"
|
|
"Předcházející oznámení o copyrightu a toto oznámení o povolení musí být přítomny ve všech kopiích nebo podstatných částech Software.\n"
|
|
"SOFTWARE JE POSKYTOVÁN \"JAK JE\", BEZ JAKÉKOLI ZÁRUKY, PŘÍMÉ ČI ODVOZENÉ, VČETNĚ, ALE BEZ OMEZENÍ NA ZÁRUKY PRODEJNOSTI, VHODNOSTI PRO PŘÍSLUŠNÝ ÚČEL A NEPORUŠENÍ DUŠEVNÍHO VLASTNICTVÍ. V ŽÁDNÉM PŘÍPADĚ NENESOU AUTOŘI NEBO DRŽITELÉ OPRÁVNĚNÍ ZODPOVĚDNOST ZA JAKÉKOLI NÁROKY. ŠKODY NEBO JINÉ ZÁVAZKY, AŤ JIŽ NA ZÁKLADĚ SMLOUVY, PORUŠENÍ NEBO JINAK, VYPLÍVAJÍCÍ ZE SPOJITOSTI SE SOFTWAREM, JEHO POUŽÍVÁNÍM NEBO JINÝM NAKLÁDÁNÍM S NÍM.\n"
|
|
"(poznámka překladatele: tento překlad je nezávázný, závazný je anglický originál!)\n"
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr "Přídavky a přepisy"
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr "Přidává vlastní možnosti:"
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr "Připojit volitelné volby fpc, například: -O1 -ghtl -dFlag"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr "Aplikovat na všechny balíky."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr "Aplikovat na všechny balíky a projekty."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr "Aplikovat na všechny balíky odpovídající názvu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr "Aplikovat na projekt."
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr "Vytvořit novou skupinu voleb"
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr "Vlastní volba"
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr "Odstranit vybraný cíl nebo možnost"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr "Nepřidávat vlastní možnosti:"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
#, object-pascal-format
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr "Nemá IDE Makro %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr "Nepřepisovat OutDir (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
#, object-pascal-format
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr "Vyloučit všechny balíky odpovídající názvu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
#, object-pascal-format
|
|
msgid "expected \":=\" after macro name but found \"%s\""
|
|
msgstr "očekáváno \":=\" po jménu makra, ale nalezeno \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
#, object-pascal-format
|
|
msgid "expected macro name but found \"%s\""
|
|
msgstr "očekáváno jméno makra, ale nalezeno \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
#, object-pascal-format
|
|
msgid "From %s to %s"
|
|
msgstr "Z %s na %s"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr "IDE Makro"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
#, object-pascal-format
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr "IDE Makro %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
#, object-pascal-format
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr "neplatný znak \"%s\" @ %s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
#, object-pascal-format
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr "neplatný znak v hodnotě makra \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr "chybějící jméno makra"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Posunout vybranou položku dolů"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Posunout vybranou položku nahodu"
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr "Nový cíl"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
#, object-pascal-format
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr "Přepsat OutDir (-FU): %s"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr "Přepsat výstupní adresář (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr "Přepsat výstupní adresář -FU cíle"
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr "Odvolat poslední <Zpět> této tabulky"
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr "Nastavit IDE Makro, např.: LCLWidgetType:=win32"
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
#, object-pascal-format
|
|
msgid "Set \"%s\""
|
|
msgstr "Nastavit \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr "Uloženo v IDE (environmentoptions.xml)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr "Uloženo v projektu (.lpi)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr "Uloženo v sezení projektu (.lps)"
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr "Cíle: "
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr "Vrátit poslední změnu této tabulky"
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
#, object-pascal-format
|
|
msgid "Value \"%s\""
|
|
msgstr "Hodnota \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
#, object-pascal-format
|
|
msgid "(was \"%s\")"
|
|
msgstr "(byl \"%s\")"
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr "Změna WidgetSetu je dostupná pouze pro LCL projekty"
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
#, object-pascal-format
|
|
msgid ", Mode: %s"
|
|
msgstr ", Režim: %s"
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "<description>\n"
|
|
#| "\n"
|
|
#| "Copyright (C) <year> <name of author> <contact>\n"
|
|
#| "\n"
|
|
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
#| "\n"
|
|
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
#| "\n"
|
|
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
#| "\n"
|
|
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
|
|
msgstr ""
|
|
"<popis>\n"
|
|
"\n"
|
|
"Copyright (C) <rok> <jméno autora> <kontakt>\n"
|
|
"\n"
|
|
"Tato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat podle ustanovení GNU Library General Public License tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze s následujícími úpravami:\n"
|
|
"\n"
|
|
"Jako speciální výjimka, vlastníci autorského práva této knihovny Vám dovolují připojit tuto knihovnu s nezávislými moduly, za účelem vytvoření programů, pričemž nezávisí na licenci těchto nezávislých modulů, kopírovat a distribuovat výsledné programy za podmínek poskytnutých podle Vašeho rozhodnutí, které se můžou líšit pro každý nezávislý modul. Nezávislý modul je modul, který není odvozený nebo založený na této knihovně. Pokud upravujete tuto knihovnu, můžete rozšířit tuto výjimku pro svojí verzi knihovny, ale není to Vaše povinnost. Pokud to nechcete udělat, smažte tuto výjimku ze své verze.\n"
|
|
"\n"
|
|
"Tento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez záruky PRODEJNOSTI nebo VHODNOSTI PRO PŘÍSLUŠNÝ ÚČEL. Další podrobnosti najdete v GNU Library General Public License.\n"
|
|
"\n"
|
|
"Kopii GNU Library General Public Licence by jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Více"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr "Více"
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr "Přesunout"
|
|
|
|
#: lazarusidestrconsts.lismovedown
|
|
msgid "Move Down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr "Přesunout Soubory"
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr "Přesunout soubory?"
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
#, object-pascal-format
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "Přesun %s soubor(ů) z %s do adresáře%s%s%sz %s?"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr "Posunout \"%s\" o jednu pozici dolu"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
#, object-pascal-format
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr "Posunout \"%s\" o jednu pozici nahoru"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr "Přesunout nebo Kopírovat soubory?"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
#, object-pascal-format
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "Přesun nebo kopírovat %s soubor(ů) z %s do adresáře%s%s%sz %s?"
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page"
|
|
msgstr "Přesunout stránku"
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr "Přesunout vybranou položku dolu (Ctrl+Dolu)"
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr "Přesunout vybranou položku nahoru (Ctrl+Nahoru)"
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr "Přesunout do: "
|
|
|
|
#: lazarusidestrconsts.lismoveup
|
|
msgid "Move Up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr "Přesun těchto jednotek rozbije jejich sekce uses. Podívej se do okna Zprávy pro více informací."
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr "Ve stylu C: \" => \\\""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr "Escapovat &uvozovky"
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "VíceVkládání"
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr "Styl Pascal: ' => ''"
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr "Vložit &volby"
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr "&Náhled"
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr "Text &po každém řádku"
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr "Text př&ed každým řádkem"
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr "&Ořezat obsah schránky"
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr "Barvy zpráv"
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr "Více adresářů je odděleno středníkem"
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ", více balíčků: "
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Uložit zprávy do souboru (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Jméno"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Konflikt jmen"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr "Jméno aktivního režimu sestavení"
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Jméno nové procedury"
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Nový"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nová třída"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr "Nová konzolová aplikace"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Vytvořit nový editovaný soubor.%sVyberte typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Vytvořit prázdný textový soubor."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
#, object-pascal-format
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Vytvořit nový projekt.%sVyberte typ."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
#, object-pascal-format
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Vytvořit nový vzorový balíček.%sBalíček je sada jednotek a komponent."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Vytvořit novou jednotku s datovým modulem."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Vytvořit novou jednotku s rámcem."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Vytvořit novou jednotku s formulářem LCL."
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr "Zdědit z formuláře projektu nebo komponenty"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Nevybrány žádné položky"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Prosíme nejdříve vyberte položku."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Nové kódování:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
#, object-pascal-format
|
|
msgid "Macro %d"
|
|
msgstr "Makro %d"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr "Nové jméno makra"
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr "Nové implementace metod jsou vloženy mezi existující metody třídy. Buď abecedně, nebo jako poslední, nebo v pořadí deklarace."
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr "Nové metody a členy deklarace v class..end sekci jsou vloženy abecedně nebo přidány nakonec."
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr "Nová stránka"
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
msgid "(new project)"
|
|
msgstr "(nový projekt)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr "Nově nahrané makro. Nebude uloženo"
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr "Nové jednotky jsou přidány do sekcí uses"
|
|
|
|
#: lazarusidestrconsts.lisnoautosaveactivedesktop
|
|
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Nezálohovat soubory"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr "Není zvolen žádný profil k sestavení."
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Žádné změny"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Nevybraný žádný kód"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Nezděděny žádné volby překladače."
|
|
|
|
#: lazarusidestrconsts.lisnofppkgprefix
|
|
msgid "empty Free Pascal compiler prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr "žádný tip"
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr "Nevybráno žádné okno IDE"
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr "Žádný soubor LFM"
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr "Žádné vybrané makro"
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr "(nevybrány žádné zprávy)"
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr "bezejmenný"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr "žádný, klikněte pro výběr jednoho"
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr "(Nic nevybráno)"
|
|
|
|
#: lazarusidestrconsts.lisnonewfilefound
|
|
msgid "No new file found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr "žádný uzel nevybrán"
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr "Žádný pascalovský soubor"
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
#, object-pascal-format
|
|
msgid "No program file \"%s\" found."
|
|
msgstr "Nenalezen žádný programový soubor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Nenalezen žádný výběr ResourceStringu"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Obyčejně je filtr regulární výraz. V jednoduché syntaxi je . obyčejný znak, * znamená cokoliv, ? znamená jakýkoliv znak a čárka a středník oddělují varianty. Např. Jednoduché syntaxi *.pas;*.pp odpovídá ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Nenalezeny žádné konstantní řetězce"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr "Není balíčkem doby návrhu"
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr "Není instalovatelný balíček"
|
|
|
|
#: lazarusidestrconsts.lisnotavalidfppkgprefix
|
|
msgid "Free Pascal compiler not found at the given prefix."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr "Poznámka"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "Dolní"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "Vlevo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "Vpravo"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Nahoře"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Free Pascalu"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr "není vybrána žádné šablona"
|
|
|
|
#: lazarusidestrconsts.lisnothingtodo
|
|
msgid "Nothing to do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr "nenainstalováno"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalledpackages
|
|
msgid "Not installed packages"
|
|
msgstr "Neinstalované položky"
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Nyní ne"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr "Nyní nahráváno: "
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Vytvořit nový projekt"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
#, object-pascal-format
|
|
msgid "Number of files to convert: %s"
|
|
msgstr "Počet souborů k převodu: %s"
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr "Inspektor objektů se stane viditelným, když jsou vybrány komponenty v návrháři."
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr "Object Pascal - výchozí"
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr "cesta objektu"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr "Přepnout na záložku Oblíbené v Inspektoru Objektů"
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
#, object-pascal-format
|
|
msgid " of package %s"
|
|
msgstr " balíčku %s"
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr " Průzkumníka Projektu"
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr "Přidat k oblíbeným vlastnostem"
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
#, object-pascal-format
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr "Zvolte základní třídu oblíbených vlastností \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
#, object-pascal-format
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Třída \"%s\" nenalezena."
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr "Odebrat z oblíbených vlastností"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "automaticky instaluj dynamické"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "automaticky instaluj statické"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Popis: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
#, object-pascal-format
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sPopis: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
#, object-pascal-format
|
|
msgid "Filename: %s"
|
|
msgstr "Jméno souboru: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "instalováno dynamicky"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "instalováno staticky"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
#, object-pascal-format
|
|
msgid "%sLicense: %s"
|
|
msgstr "%sLicence: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "chybějící"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "změněný"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
msgid "Open Loaded Package"
|
|
msgstr "Otevřít načtený balíček"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Jméno balíčku"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Prosím vyberte balíček"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Stav"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
#, object-pascal-format
|
|
msgid "%sThis package is installed but the lpk file was not found"
|
|
msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen"
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Stará třída"
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr "Při zalomení řádku (tj. klávesa Enter)"
|
|
|
|
#: lazarusidestrconsts.lisonlinepackage
|
|
msgid "available in the main repository"
|
|
msgstr "dostupné v hlavním repozitáři"
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr "pouze 32bit"
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr "Dostupné pouze na Windows. Spustit nástroj skrytě."
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr "Dostupné pouze na Windows. Spustit nástroj v nové konzoli."
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr "Pouze zprávy vyhovující tomuto regulárnímu výrazu:"
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr "Pouze zprávy s těmito FPC ID (oddělené čárkou):"
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr "Pouze registrovat soubory balíčeků Lazarusu (.lpk). Nesestavovat."
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Hledat pouze celá slova"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr "Při vložení ze schránky"
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Otevřít"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Otevřít jako XML soubor"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr "Otevřít návrháře při otevření jednotky"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr "Formulář je vždy načten v návrháři, když je otevřena zdrojová jednotka."
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Otevřít existující soubor"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
msgctxt "lazarusidestrconsts.lisopenfile"
|
|
msgid "Open File"
|
|
msgstr "Otevřít soubor"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
msgctxt "lazarusidestrconsts.lisopenfile2"
|
|
msgid "Open file"
|
|
msgstr "Otevřít soubor"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr "Otevřít soubor na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.lisopeninfileman
|
|
msgid "Open in file manager"
|
|
msgstr "Otevřít ve správci souborů"
|
|
|
|
#: lazarusidestrconsts.lisopeninfilemanhint
|
|
msgid "Open destination directory in file manager"
|
|
msgstr "Otevřít cílový adresář ve správci souborů"
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
#, object-pascal-format
|
|
msgid "Open %s"
|
|
msgstr "Otevřít %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Otevřít balíček?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
#, object-pascal-format
|
|
msgid "Open package %s"
|
|
msgstr "Otevřít balíček %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage3
|
|
msgid "Open Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Otevřít soubor projektu"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Otevřít projekt?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Otevřít projekt"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Otevřít projekt znovu"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Otevřít soubor projektu"
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Otevřít soubor jako normální zdrojový soubor"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Open the package %s?"
|
|
msgid ""
|
|
"Open the package \"%s\"?\n"
|
|
"\n"
|
|
"The \"Package\" menu has separate commands for opening packages and a list of recent ones."
|
|
msgstr "Otevřít balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Open the project %s?"
|
|
msgid ""
|
|
"Open the project \"%s\"?\n"
|
|
"\n"
|
|
"The \"Project\" menu has separate commands for opening projects and a list of recent ones."
|
|
msgstr "Otevřít projekt %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr "Otevřít volby nástroje"
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr "Otevřít jednotku"
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr "Otevřít URL"
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr "Otevřít XML"
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Volby"
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr "ignorováno"
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
#, object-pascal-format
|
|
msgid ", OS: %s"
|
|
msgstr ", OS: %s"
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
#, object-pascal-format
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
|
|
msgstr "jiná zdrojová cesta balíčku \"%s\" obsahuje adresář \"%s\", který je už v cestě pro hledání jednotek."
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
#, object-pascal-format
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr "výstupní adresář %s obsahuje Pascalovskou zdrojovou jednotku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisoutputfilenameofproject
|
|
msgid "Output filename of project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
#, fuzzy
|
|
#| msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
|
|
msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varianty se podívejte na soubory ve složce jazyků."
|
|
|
|
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
|
|
msgid "Override function result string types with the first parameter expression type"
|
|
msgstr "Přepsat výsledný řetězcový typ funkce s prvním parametrem výrazového typu"
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
#, fuzzy
|
|
#| msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
|
|
msgstr "%spřepíše výchozí překladač. např. ppc386 ppcx64 ppcppc aj. výchozí je uložen v environmentoptions.xml"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
#, fuzzy
|
|
#| msgid "%soverride the project or IDE build mode."
|
|
msgid "Override the project or IDE build mode."
|
|
msgstr "%spřepíše sestavovací mód projektu nebo IDE."
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
|
|
msgstr "%spřepíše cpu projektu. např. i386 x86_64 powerpc powerpc_64 aj. výchozí: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgid "Override the project operating system. For example: win32 linux. Default: %s."
|
|
msgstr "%spřepíše operační systém projektu. např. win32 linux. výchozí: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
|
|
msgid "Override the project subtarget."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetsetegdefault
|
|
#, object-pascal-format
|
|
msgid "Override the project widgetset. For example: %s. Default: %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr "'Owner' je již použit v TReader/TWriter. Prosím zvolte jiné jméno."
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Balíček"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
#, object-pascal-format
|
|
msgid "package %s"
|
|
msgstr "balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
#, object-pascal-format
|
|
msgid ", package %s"
|
|
msgstr ", balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
msgid "Package info"
|
|
msgstr "Informace balíčku"
|
|
|
|
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Jméno balíčku začíná s..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Jméno balíčku obsahuje..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr "Balíček vyžaduje výstupní adresář."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Balíček vyžaduje instalaci"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" Option"
|
|
msgstr "Balíček \"%s\" Volba"
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr "Výstupní adresář balíčků"
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr "Zdrojový adresář balíčků"
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
#, object-pascal-format
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr "balíčky=%s/%s jednotky=%s/%s identifikátory=%s/%s řádky=%s bajtů=%s"
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr "jednotka balíčku"
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgctxt "lazarusidestrconsts.lispage"
|
|
msgid "Page"
|
|
msgstr "Strana"
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr "Jméno stránky"
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
#, object-pascal-format
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr "Jméno stránky \"%s\" již existuje. Nepřidáno."
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr "Panika"
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ", zanalyzovný "
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
#, object-pascal-format
|
|
msgid "parser \"%s\": %s"
|
|
msgstr "parser \"%s\":%s"
|
|
|
|
#: lazarusidestrconsts.lisparsers
|
|
msgid "Parsers:"
|
|
msgstr "Parsery:"
|
|
|
|
#: lazarusidestrconsts.lispassingquiettwotimeswillp
|
|
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr "vložit schránku"
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr "Vložit ze schránky."
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr "Pastelové barvy"
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr "Cesta"
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Procházet"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr "Smazat neplatné cesty"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Posunout cestu dolů (Ctrl+Dolů)"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Posunout cestu nahoru (Ctrl+Nahoru)"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr "Přidat novou cestu do seznamu"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr "Smazat vybranou cestu"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr "Odstranit neexistující (šedé) cesty ze seznamu"
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr "Nahradit vybranou cestu novou cestou"
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr "Přidat šablonu do seznamu"
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Šablony cest"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Hledat cesty:"
|
|
|
|
#: lazarusidestrconsts.lispathisnodirectory
|
|
msgid "is not a directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr "cesta instantfpc cache"
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr "Cesta nástroje make"
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr "Cesta ke špatné instanci:"
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Pozastavit"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr "Vyčistit pro použití jména balíčku"
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr "Zakázat I18N v lfm"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr "Přidat soubor ze souborového systému"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Přidat do projektu"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Použít změny"
|
|
|
|
#: lazarusidestrconsts.lispckeditavailableonline
|
|
msgid "(available online)"
|
|
msgstr "(dostupné online)"
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
#, object-pascal-format
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Volání %sRegister%s procedura vybrané jednotky"
|
|
|
|
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
|
|
msgid "Check availability online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr "Vyčistit závislosti ..."
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr "Vyčistit přednastavené/preferované jméno souboru závislosti"
|
|
|
|
#: lazarusidestrconsts.lispckeditcommonoptions
|
|
msgid "Common"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Přeložit vše?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Přeložit balíček"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr "Vytvořit fpmake.pp"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Vytvořit Makefile"
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Vlastnosti závislosti"
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
msgid "Edit general options"
|
|
msgstr "Upravit obecná nastavení"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Vlastnosti souboru"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Instalovat"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Neplatná maximální verze"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Neplatná minimální verze"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maximální verze:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimální verze:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
#, object-pascal-format
|
|
msgid "Modified: %s"
|
|
msgstr "Změněný: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Posunout závislost dolů"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Posunout závislost nahoru"
|
|
|
|
#: lazarusidestrconsts.lispckeditoptionsforpackage
|
|
#, object-pascal-format
|
|
msgid "Options for Package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
#, object-pascal-format
|
|
msgid "Package %s"
|
|
msgstr "Balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
#, object-pascal-format
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Balíček \"%s\" byl změněn.%sUložit balíček?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
#, object-pascal-format
|
|
msgid "package %s not saved"
|
|
msgstr "balíček %s nenalezen"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
#, object-pascal-format
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s,Stránka: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Znovu přidat závislost"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Znovu přidat soubor"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
#, object-pascal-format
|
|
msgid "Read Only: %s"
|
|
msgstr "Pouze pro čtení: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
msgid "Recompile All Required"
|
|
msgstr "Znovu přeložit vše potřebné"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
msgid "Recompile Clean"
|
|
msgstr "Znovu přeložit načisto"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Znovu přeložit tento a všechny požadované balíčky?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Registrované zásuvné moduly"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Registrovat jednotku"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Odstranit závislost"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Odstranit závislost \"%s\"%sz balíčku \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr "Odstraněné soubory"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Odstranit požadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Odstranit soubor"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Odstranit soubor?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Odstranit soubor \"%s\"%sz balíčku \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Odstranit vybrané položky"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Požadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
msgid "Save Package"
|
|
msgstr "Uložit balíček"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr "Uchovat jméno souboru jako předvolené pro tuto závislost"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr "Uchovat jméno souboru jako preferované pro tuto závislost"
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maximální verze \"%s\" není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
#, object-pascal-format
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Nejmenší verze \"%s\" není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Odinstalovat"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
|
msgid "View Package Source"
|
|
msgstr "Zobrazit zdroj balíčku"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr "Základní, nelze odinstalovat"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Instalováno"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Instalovat při dalším spuštění"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
#, object-pascal-format
|
|
msgid "%sState: "
|
|
msgstr "%sStav: "
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Odinstalovat při dalším spuštění (pokud není vyžadován instalovaným balíčkem)"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr "Odinstalovat balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Přidat volby do závislých balíčků a projektů"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Přidat cesty do závislých balíčků/projektů"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
msgid "Author"
|
|
msgstr "Autor"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automaticky znovu sestavit podle potřeby"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automaticky znovu sestav pokud znovu sestavení všeho"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Vlastní"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
msgid "Description / Abstract"
|
|
msgstr "Popis / obsah"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr "Čas návrhu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and runtime"
|
|
msgstr "Doba návrhu a doba běhu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "Integrace IDE"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Zahrnout"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Neplatný typ balíčku"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Knihovna"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
msgid "License"
|
|
msgstr "Licence"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Spojovací program"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Hlavní"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Ruční překlad (nikdy automaticky)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Minoritní"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objekt"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
msgid "Package type"
|
|
msgstr "Typ balíčku"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Poskytuje"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Uvolnění"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr "Čas běhu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Balíček \"%s\" má příznak autoinstalace.%sTo znamená, že bude instalován do IDE.%sInstalované balíčky musí být návrhové balíčky."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Tento balíček poskytuje to samé jako následující balíčky:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
msgid "Update / Rebuild"
|
|
msgstr "Aktualizovat / Znovu sestavit"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Použití"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr "Balíček:"
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr "Prohledávané cesty XML souborů pro fpdoc. Více cest musí být odděleno středníkem."
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr "Zobrazit neukončené závislosti"
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr "Když je formulář uložen, IDE může uložit všechny vlastnosti TTranslateString do \"po\" souboru balíčku. K tomu je nutné povolit I18N pro tento balíček, zadat výstupní adresář \"po\" souboru a ponechat tuto volbu nezatrženou."
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Přerušit"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Průběh"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr "Sbalit adresář"
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Nalezen konflikt"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Upravit virtuální jednotku"
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr "Rozbalit adresář"
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Jméno souboru:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Opravit velikost písmen souborů"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Neplatné jméno souboru jednotky"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Neplatné jméno jednotky"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
#, object-pascal-format
|
|
msgid "Missing files of package %s"
|
|
msgstr "Chybějící soubory balíčku %s"
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr "Nový soubor není v zahrnované cestě"
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
|
msgid "No files missing. All files exist."
|
|
msgstr "Žádné chybějící soubory. Všechny soubory existují."
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr "Odstranit soubory"
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr "Vrátit balíček"
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr "Uložit balíček jako ..."
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr "Zobrazit adresářovou strukturu"
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr "Zobrazit chybějící soubory"
|
|
|
|
#: lazarusidestrconsts.lispeshowpropspanel
|
|
msgid "Show properties panel"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Řadit soubory trvale"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr "Řadit soubory abecedně"
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr "Soubor \"%s\" není v současnosti v zahrnované cestě balíčku.%sPřidat \"%s\" do zahrnuté cesty?"
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Jméno jednotky:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr "Použít všechny jednotky v adresáři"
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr "Nepoužít žádné jednotky v adresáři"
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr "Vyčistit závislosti balíku"
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr "Vyčistit výběr"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr "Odstranit závislosti"
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
#, object-pascal-format
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Nová jednotka není v cestě jednotek"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Vydat balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Navrátit balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Soubor \"%s\"%snení aktuálně v cestě jednotek balíčku.%sPřidat \"%s\" do cesty jednotek?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr "Více funkcí pro balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
#, object-pascal-format
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
#, object-pascal-format
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
|
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
|
msgstr "Přidat jednotku do sekce uses v hlavním souboru balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány."
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Víceznačné jednotky nalezeny"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automaticky instalované balíčky"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
#, object-pascal-format
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Porušená závislost"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr "Nalezeny kruhové závislosti"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Smazat starý soubor balíčku?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
#, object-pascal-format
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Odstranit starý soubor balíčku \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
#, object-pascal-format
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Závislost bez vlastníka: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Chyba načítání balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Chyba zapisování balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Soubor je již obsažen v balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Soubor je projekt"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Jméno souboru se liší od jména balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Jméno souboru je použito jiným balíčkem"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Jméno souboru je použito projektem"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Soubor \"%s\" nenalezen."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Soubor není uložený"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Instalace balíčku %s automaticky nainstaluje balíček:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
#, object-pascal-format
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Instalace balíčku %s automaticky nainstaluje balíčky:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Neplatná přípona souboru"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Neplatná přípona balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Neplatné jméno souboru balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Neplatné jméno balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Neplatné jméno balíčku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
#, object-pascal-format
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Načtení balíčku %s nahradí balíček %s%sze souboru %s.%sStarý balíček je upraven.%sUložit starý balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
#, object-pascal-format
|
|
msgid "Package: %s"
|
|
msgstr "Balík: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Konflikt balíčků"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Balíček není návrhový balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Balíček je vyžadován"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Jméno balíčku již existuje"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Balíček musí mít příponu .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr "Nejdříve, prosím, přeložte balíček."
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Prosíme uložte soubor před jeho přidáním do balíčku."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
#, object-pascal-format
|
|
msgid "Project: %s"
|
|
msgstr "Projekt: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Přestavět Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Přejmenovat soubor na malé písmena?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
#, object-pascal-format
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Nahradit existující soubor \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Nahradit soubor"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr "Jeden nebo více vyžadovaných balíčků nebylo nalezeno. Viz graf balíčků pro více detailů."
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid ""
|
|
#| "The package %s is already open in the IDE.\n"
|
|
#| "You cannot save a package with the same name.\n"
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name."
|
|
msgstr ""
|
|
"Balíček %s je již otevřen v IDE.\n"
|
|
"Nemůžete uložit balíček se stejným jménem.\n"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
msgid "Save package?"
|
|
msgstr "Uložit balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
#, object-pascal-format
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Uložit balíček %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
#, object-pascal-format
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Mohu soubor přejmenovat na malé znaky na %s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Přeskočit tento balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Soubor \"%s\"%s je již v balíčku %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Soubor \"%s\" není balíček Lazarusu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
#, object-pascal-format
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Jméno souboru \"%s\" nesouhlasí se jménem balíčku \"%s\" v souboru.%sZměnit jméno balíčku na \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Jméno souboru \"%s\" je částí aktuálního projektu.%sProjekty a balíčky nemůžou sdílet soubory."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
#, object-pascal-format
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Jméno souboru \"%s\" je použité %sbalíčkem \"%s\"%sv souboru \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Následující balíček se nepodařilo načíst:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Následující balíčky se nepodařilo načíst:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
#, object-pascal-format
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr "%sNásledující jednotky budou přidány do sekce 'uses' jednotky%s%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
#, object-pascal-format
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Jméno souboru balíčku \"%s\" v%s\"%s\" není platné jméno balíčku Lazarusu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
#, object-pascal-format
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Balíček %s je balíčkem běhovým. %sBěhové balíčky nelze instalovat do IDE."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr "Balíček \"%s\" je překládán automaticky a jeho výstupní adresář je \"%s\", což je přednastavená cesta hledání jednotek překladače. Balíček používá jiné balíčky, které rovněž používají přednastavenou prohledávanou cestu jednotek překladače. To vytváří nekonečnou smyčku.%sTento problém můžete opravit odstraněním cesty z vaší konfigurace překladače (např.: fpc.cfg)%snebo zakázáním automatické změny tohoto balíčku nebo odstraněním závislostí."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Balíček \"%s\" je označen k instalaci, ale nedá se najít.%sOdstranit závislost ze seznamu instalovaných balíčků?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
#, object-pascal-format
|
|
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
|
|
msgstr "Balíček %s je vyžadován balíčkem %s, který je označen k instalaci.%sViz graf balíčků."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Jméno balíčku \"%s\" není platným jménem balíčku%sProsím zvolte jiné jméno (např. balicek1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
#, object-pascal-format
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Jméno balíčku \"%s\" %ssouboru \"%s\" je neplatné."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Balíček \"%s\" byl označen.%sAktuálně Lazarus podporuje pouze staticky spojené balíčky. Skutečné odinstalování vyžaduje znovu sestavení a restartování Lazarusu.%sChcete teď znovu sestavit Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Balíček \"%s\" byl označen pro instalaci.%sAktuálně Lazarus podporuje pouze staticky spojené balíčky. Skutečná instalace vyžaduje znovu sestavení a restart Lazarusu.%sChcete teď znovu sestavit Lazarus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
#, object-pascal-format
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Projekt vyžaduje balíček \"%s\".%sAle tento nebyl nalezen. Viz Projekt -> Inspektor projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
#, object-pascal-format
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "Dvě jednotky mají stejné jméno:%s1. \"%s\" z %s%s2. \"%s\" z %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr "Kruhová závislost v balíčcích. Viz graf balíčků."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "Existuje jednotka FPC se stejným jménem jako balíček:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
#, object-pascal-format
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "Existuje jednotka FPC se stejným jménem jako %s\"%s\" z %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
#, object-pascal-format
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "Balíček se zvoleným jménem \"%s\" už existuje. %sKonfliktní balíček:\"%s\"%sSoubor: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
#, object-pascal-format
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Již existuje balíček \"%s\" načtený %sze souboru \"%s\".%sViz Balíček -> Graf balíčku.%sNahrazení není možné."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Mezi vyžadovanými balíčky jsou některé neuložené. Viz graf balíčků."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Již existuje jednotka se stejným jménem jako balíček:%s1. \"%s\" z %s%s2. \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Toto je virtuální balíček. Zatím nemá zdrojový kód. Prosím uložte nejdříve balíček."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
#, object-pascal-format
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Nelze vytvořit cílový adresář Lazarusu:%s\"%s\".%sTento adresář je nutný pro nové změněné Lazarus IDE s vašimi vlastními balíčky."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Nelze zapsat balíček \"%s\"%sdo souboru \"%s\".%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Odinstalovat balíček?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
#, object-pascal-format
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Odinstalovat balíček %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Neuložený balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Požít jednotku"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
#, object-pascal-format
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Varování: Soubor \"%s\"%spatří k aktuálnímu projektu."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr "udržovat"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr "nový"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr "odstranit"
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr "Vybrat balíček"
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
|
|
msgstr "Následující závislosti nejsou nutné kvůli automatické přechodnosti závislostí mezi balíčky."
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
#, object-pascal-format
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr "Projekt přepisuje výstupní adresář následujících balíčků.%sViz Projekt / Volby projektu / Přídavky a Přepisy%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Soubor není v žádném načteném balíčku."
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Nelze číst soubor balíčku \"%s\".%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr "Přehrát"
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Celkový"
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
msgid "Online"
|
|
msgstr "Online"
|
|
|
|
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
|
|
msgid "Online packages cannot be deleted"
|
|
msgstr "Online balíčky nelze smazat"
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Odkazy balíčku"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr "Ukázat souhrnné odkaz v "
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr "Ukázat online odkazy"
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr "Ukázat odkaz uživatele v "
|
|
|
|
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
|
|
msgid "Some packages cannot be deleted"
|
|
msgstr "Nelze smazat některé balíčky"
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Uživatel"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window which is normally below the source editor."
|
|
msgstr "Prosím, opravte chybu zobrazenou v okně zpráv, které je zpravidla pod editorem zdrojů."
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Prosím otevřete jednotku před spuštěním."
|
|
|
|
#: lazarusidestrconsts.lispleaseplacetheeditorcaretonanidentifierifthisisane
|
|
msgid "Please place the editor caret on an identifier. If this is a new unit, please save the file first."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Prosíme vyberte nějaký kód k vytažení nové procedury/metody."
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<Všechno>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Změnit písmo"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Zkopírovat jméno metody do schránky"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Filtrovat podle jakékoliv odpovídající části metody"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Filtrovat podle začátku metody"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Skoč na výběr"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<žádný>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objekty"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr "Seznam procedur"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr "Vyberte adresář .po souborů"
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Neukládat žádné informace sezení"
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Uložit v souboru .lps v konfiguračním adresáři IDE"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Ulořit v souboru .lpi"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Ulořit v souboru .lps v adresáři projektu"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Uložit informace o sezení"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ".lpi je hlavní informační soubor projektu, .lps je samostatný soubor jen pro data sezení."
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr "Pozice"
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
#, object-pascal-format
|
|
msgid "%s (position outside of source)"
|
|
msgstr "%s (pozice vně zdroje)"
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
#, object-pascal-format
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr "ppu ve špatném adresáři=%s."
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
#, object-pascal-format
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr "%s.ppu nenalezeno. Zkontrolujte vás fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr "Předcházející slovo"
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "primary config directory where Lazarus stores its config files. Default is "
|
|
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
|
|
msgstr "hlavní konfigurační adresář, kde Lazarus uchovává své konfigurační soubory. Výchozí je "
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr "Primární konfigurační cesta"
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
#, object-pascal-format
|
|
msgid "prior %s"
|
|
msgstr "před %s"
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Priorita"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr "Soukromý"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Soukromá metoda"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
#, object-pascal-format
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr "Před pokračováním asi bude nutné nainstalovat některé balíčky.%sVarování:%sProjekt používá následující návrhové balíčky, které mohou být nezbytné k otevření formuláře v návrháři. Pokud budete pokračovat, můžete obdržet chyby o chybějících komponentách a načítání formuláře pravděpodobně způsobí velmi nepříjemné výsledky.%sJe doporučeno zrušit akci a nejdříve nainstalovat tyto balíčky."
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Procedura"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Procedura s rozhraním"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Program"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Zjištěn program"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr "Free Pascal program příkazové řádky s několika přidanými užitečnými nastaveními."
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Zdrojový soubor programu musí mít pascalovkou příponu jako .pas, .pp nebo .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Závislost již existuje"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add Editor Files"
|
|
msgstr "Přidat editované soubory"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Neplatná verze Min-Max"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Neplatná verze"
|
|
|
|
#: lazarusidestrconsts.lisprojaddlocalpkg
|
|
#, object-pascal-format
|
|
msgid "Local (%s)"
|
|
msgstr "Místní (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maximální verze (nepovinné):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimální verze (nepovinné):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
|
|
msgid "New FPMake Requirement"
|
|
msgstr "Nový požadavek FPMake"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nové požadavky"
|
|
|
|
#: lazarusidestrconsts.lisprojaddonlinepkg
|
|
#, object-pascal-format
|
|
msgid "Online (%s)"
|
|
msgstr "Online (%s)"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Jméno balíčku:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Balíček nenalezen"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagetype
|
|
msgid "Package Type:"
|
|
msgstr "Typ balíčku:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
#, object-pascal-format
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Závislost \"%s\" nebyla nalezena.%sProsím zvolte existující balíček."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maximální verze \"%s\" je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximální verze je menší než Minimální verze."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Nejmenší verze \"%s\" je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
#, object-pascal-format
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Projekt již je závislý na balíčku \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Jméno jednotky \"%s\" už v projektu%sexistuje se souborem: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
#, object-pascal-format
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Jméno jednotky \"%s\" už existuje ve výběru%sse souborem: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Jméno jednotky již existuje"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
#, object-pascal-format
|
|
msgid "Project %s"
|
|
msgstr "Projekt %s"
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr "Projekt: "
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr "projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekt změněn"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr "Projekt změněn na disku"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Adresář projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Jméno souboru projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Cesta začleněných souborů projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Zjištěn informační soubor projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectinspectorshowprops
|
|
msgid "Show properties pane in Project Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekt je spustitelný"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr "Generuje binární spustitelné, které lze spustit."
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr "Projekt"
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Vlastnosti makra projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectnamespaces
|
|
msgid "Project Namespaces"
|
|
msgstr "Jméno prostory projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr "Volva Projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr "Výstupní adresář projektu (např. ppu adresář)"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr "Výstupní adresář projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr "Adresář, v němž musí být hlavní soubor projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr "Sezení Projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr "Sezení projektu se změnilo"
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr "Zdrojový adresář projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr "%0:s%0:s na adrese %1:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr "Projekt %s vyvolal výjimku třídy '%s'."
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
#, object-pascal-format
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr "Projekt %s vyvolal výjimku třídy '%s' se zprávou:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr "%0:s%0:s v souboru '%1:s' na adrese %2:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr "%0:s%0:s v souboru '%1:s' na řádce %2:d"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
#, object-pascal-format
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr "%0:s%0:s v souboru '%1:s' na řádce %2:d:%0:s%3:s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Zdrojová cesta projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr "jednotka projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Cesta jednotek projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojectver
|
|
msgid "Project version"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr "Průvodce projektu"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Potvrdit odstranění závislostí"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Potvrdit odstranění souboru"
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
#, object-pascal-format
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Odstranit závislost pro %s?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
#, object-pascal-format
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Inspektor projektu - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Odstranit požadované balíčky"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
#, object-pascal-format
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Odstranit soubor %s z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
#, object-pascal-format
|
|
msgid "Remove %s items from project?"
|
|
msgstr "Odebrat %s položek z projektu?"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Vždy sestavit (i pokud se nic nezmění)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr "Může být potřeba pokud je chyba v kontrole závislostí, obyčejně není potřeba."
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Chyba"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
#, object-pascal-format
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Nelze změnit seznam automaticky vytvářených formulářů ve zdrojovém kódu programu.%sNejdříve opravte chyby."
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Dotázat se na hodnotu"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr "Vlastnosti (nahradit nebo odstranit)"
|
|
|
|
#: lazarusidestrconsts.lisproperty
|
|
#, object-pascal-format
|
|
msgid "%s property"
|
|
msgstr "vlastnost %s"
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr "Chráněné"
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Chráněné metody"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Veřejná metoda"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Zveřejněné metody"
|
|
|
|
#: lazarusidestrconsts.lispublishedto
|
|
#, object-pascal-format
|
|
msgid "Published to %s"
|
|
msgstr "Zveřejněné do %s"
|
|
|
|
#: lazarusidestrconsts.lispublishmodulenote
|
|
msgid "Files belonging to project / package will be included automatically."
|
|
msgstr "Soubory patřící projektu / balíčku budou zahrnuty automaticky."
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Zveřejni adresář projektu"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr "Zveřejnit projekt"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr "Uložit .lrs soubory ve výstupním adresáři"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr "Zdroj bude dostupný pro FPC."
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Upravit virtuální jednotku"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Již existuje jednotka s tímto jménem.%sSoubor: %s"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Jméno jednotky není platný pascalovský identifikátor."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
#, object-pascal-format
|
|
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "Převést Delphi projekt"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "&New Project"
|
|
msgstr "Nový projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "&Open Project"
|
|
msgstr "Otevřít projekt"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
|
msgid "Open &Recent Project"
|
|
msgstr "Otevřít nedávný projekt"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr "Prohlížet ukázkové projekty"
|
|
|
|
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
|
|
msgid "Quick check Fppkg configuration at start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr "Rychle Opravit chybu"
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr "Rychlé opravy"
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr "Hledat identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr "Ukončit"
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "&Quit Lazarus"
|
|
msgstr "Ukončit Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr "Opravdu odstranit?"
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr "Poslední listy"
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr "Record"
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr "Zaznamenáno"
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgctxt "lazarusidestrconsts.lisredo"
|
|
msgid "Redo"
|
|
msgstr "Opakovat změnu"
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr "Regulární výrazy"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr "Relativní"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "Odstranit"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr "Odstranit?"
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Odstranit všechny neplatné vlastnosti"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr "Odstranit všechny filtry zpráv podle typu"
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr "Odebrat všechny jednotky"
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr "Odstranit Volbu Překladače Skrýt Zprávu"
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr "Odstranit %s závislostí z balíčku \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
#, object-pascal-format
|
|
msgid "Removed property \"%s\"."
|
|
msgstr "Odstraněna vlastnost \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
#, object-pascal-format
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr "Odstranit %s souborů z balíčku \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
msgid "Remove from Project"
|
|
msgstr "Odstranit z projektu"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr "Odstranit z vyhledávací cesty"
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr "Odstranit zahrnutou cestu?"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
#, object-pascal-format
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr "Odstranit místní proměnnou \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr "Odstranit Filtr Typu Zprávy"
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr "Odstranit neexistující soubory"
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr "Odstranit vybrané jednotky"
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Odstranit je"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr "Odstranit cesty z \"Ostatní zdroje\""
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr "Odstranit cestu jednotek?"
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
#, object-pascal-format
|
|
msgid "Remove uses \"%s\""
|
|
msgstr "Odstranit uses \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgctxt "lazarusidestrconsts.lisrename"
|
|
msgid "Rename"
|
|
msgstr "Přejmenování"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr "Přejmenovat ..."
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Přejmenovat soubor?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Přejmenování souboru selhalo"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr "Ukázat seznam přejmenovaných identifikátorů"
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
#, object-pascal-format
|
|
msgid "Rename to %s"
|
|
msgstr "Přejmenovat na %s"
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Přejmenovat na malá písmena"
|
|
|
|
#: lazarusidestrconsts.lisrenamingaborted
|
|
msgid "Renaming aborted"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrenamingconflict
|
|
msgid "Renaming conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr "Znovuotevřít projekt"
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr "Znovuotevřít s jiným kódováním"
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Repeat"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgctxt "lazarusidestrconsts.lisreplace"
|
|
msgid "Replace"
|
|
msgstr "Nahradit"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr "Nahrazena vlastnost \"%s\" s \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
#, object-pascal-format
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr "Nahrazen typ \"%s\" s \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr "Nahrazení"
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr "Nahrazující funkce"
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr "Náhrady"
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr "Opravit neznámé vlastnosti a typy"
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr "Nahradit celý identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Nahrazení výběru selhalo."
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr "Přeskenovat"
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgctxt "lazarusidestrconsts.lisreset"
|
|
msgid "Reset"
|
|
msgstr "Nulovat"
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr "Nastavit všechny souborové filtry na předvolené?"
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr "Resetovat vlastnosti Left, Top, Width, Height vybraných komponent na vlastnosti předků?"
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr "Jméno zdroje musí být jedinečné."
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Chyba uložení zdroje"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr "Typ zdroje projektu"
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Restartovat"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr "Výsledek:"
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
#, fuzzy
|
|
#| msgid ""
|
|
#| "Return the list of all values of case variable in front of variable.\n"
|
|
#| "\n"
|
|
#| "Optional Parameters (comma separated):\n"
|
|
#| "WithoutExtraIndent // the case list will be generated without extra indentation\n"
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation"
|
|
msgstr ""
|
|
"Vrací seznam všech hodnot podmínkové proměnné před proměnnou.\n"
|
|
"\n"
|
|
"Volitelné Parametry (čárkou oddělené):\n"
|
|
"WithoutExtraIndent // seznam případů bude generován bez odsazení navíc\n"
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Vrácení selhalo"
|
|
|
|
#: lazarusidestrconsts.lisrevision
|
|
msgid "Revision: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "Vpravo"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Pravé ukotvení"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Pravý okraj. Tato hodnota je přidána k základnímu okraji a použitá pro odsazení vpravo od prvku."
|
|
|
|
#: lazarusidestrconsts.lisrightgutter
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lisrightgutter"
|
|
msgid "Right"
|
|
msgstr "Pravé"
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto je sourozenec prvku, k jehož pravé straně je ukotvený. Ponechte prázdné pro ukotvení k rodiči v Delphi stylu (BorderSpacing a ReferenceSide nehrají roli)"
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Pravé strany"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Stejná pravá vzdálenost"
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Spustit"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr "\"Běhové a Designové\" balíčky nemají omezení."
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
#, object-pascal-format
|
|
msgid "%s (running ...)"
|
|
msgstr "%s (běžící ...)"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Soubor není spustitelný"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
#, object-pascal-format
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Hostitelská aplikace \"%s\" není spustitelná."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Spustit"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr "Pouze běhové, nelze instalovat v IDE"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr "\"Pouze běhové\" balíčky pouze pro projekty. Nemohou být instalovány v IDE, ani nepřímo."
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
|
|
msgstr "\"Běhové\" balíčky mohou být užity v projektech. Nemohou být instalovány v IDE, dokud je nevyžaduje nějaký Návrhový balíček."
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Spustit-po selhalo"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr "Abstraktní metody - doposud nepředefinováno"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Abstract methods of %s"
|
|
msgstr "Abstraktní metody %s"
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Ukazatel není v deklaraci třídy"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IDE je zaneprázdněno"
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
#, object-pascal-format
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr "%s je abstraktní třída, protože má abstraktní metody %s."
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Nenalezeny abstraktní metody"
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr "Přepsat celý výběr"
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr "Přepsat první vybraný"
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Vybrat žádný"
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
#, object-pascal-format
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr "Existuje %s abstraktních metod, které lze implementovat.%sZvolte metody, pro které chcete vytvořit kostry:"
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Neexistují žádné abstraktní metody k přetížení."
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr "Tuto metodu nelze přetížit, protože je definována v aktuální třídě"
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr "Nelze zobrazit abstraktní metody této třídy, protože"
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Uložit"
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Uložit vše"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr "Uložit všechny zvolené"
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
msgid "Save all modified files"
|
|
msgstr "Uložit všechny upravené soubory"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr "Uložit Všechny/Původní Zprávy do Souboru..."
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
#, fuzzy
|
|
#| msgid "Save and exit dialog"
|
|
msgid "Only Save"
|
|
msgstr "Uložit a ukončovací dialog"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
#, fuzzy
|
|
#| msgid "Save and rebuild IDE"
|
|
msgid "Rebuild IDE"
|
|
msgstr "Uložit a znovu sestavit IDE"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr "Uložit změněné soubory?"
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Uložit změny?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
#, object-pascal-format
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Uložit změny projektu %s?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "Save current editor file"
|
|
msgstr "Uložit aktuální editovaný soubor"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr "Uloženo s nastavením IDE"
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr "Uloženo se sezením projektu"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
#, object-pascal-format
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Uložit soubor \"%s\"%spřed zavřením formuláře \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr "Uložit makro jako"
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr "Uložit zprávy"
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
#, object-pascal-format
|
|
msgid "Save project %s (*%s)"
|
|
msgstr "Uložit projekt %s (*%s)"
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
#, object-pascal-format
|
|
msgid "Save session changes to project %s?"
|
|
msgstr "Uložit změny sezení do projektu %s?"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
|
msgid "Save fold info"
|
|
msgstr "Uložit informaci o skládání"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr "Editor kódu podporuje skládání (dočasné skrývání) úseků kódu."
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
|
msgid "Save jump history"
|
|
msgstr "Uložit historii skoků"
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr "Ctrl+Klik na identifikátor v editoru kódu je uložen v historii skoků."
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Uložit nastavení"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr "Uložit Zobrazené Zprávy do Souboru..."
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Uložit "
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
#, object-pascal-format
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr "Ukládání souboru \"%s\" jako \"%s\" ztratí znaky na řádce %s, sloupci %s."
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Činitel zvětšení:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr "Skenovat soubory v nadřazeném adresáři"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr "Hledat zdrojové soubory v adresářích sourozenců (rodičovský adresář a jeho potomci)"
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr "Prohledávání"
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
#, object-pascal-format
|
|
msgid "%s. Scanning ..."
|
|
msgstr "%s. Skenování ..."
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr "Prohledávání nadřazeného adresáře"
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr "Prohledávané cesty"
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
#, object-pascal-format
|
|
msgid "Search Unit \"%s\""
|
|
msgstr "Hledat jednotku \"%s\""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
#, object-pascal-format, fuzzy, badformat
|
|
#| msgid "secondary config directory where Lazarus searches for config template files. Default is "
|
|
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
|
|
msgstr "druhotný konfigurační adresář, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je "
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr "Druhotná konfigurační cesta"
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr "&Druhý test"
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Podívat se na hlášení."
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
#, object-pascal-format
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sPodívejte se na Projekt -> Inspektor projektu"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Vybrat položku nápovědy:"
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Vybrat uzel"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr "Vybrat jiný LCL widgetset (makro LCLWidgetType)"
|
|
|
|
#: lazarusidestrconsts.lisselectbuildmode
|
|
msgid "Select build mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
#, fuzzy
|
|
#| msgid "Select Delphi form files (*.dfm)"
|
|
msgid "Select Delphi form files (*.dfm|*.fmx)"
|
|
msgstr "Vybrat soubor formuláře Delphi (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgctxt "lazarusidestrconsts.lisselected"
|
|
msgid "Selected"
|
|
msgstr "Vybrané"
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr "Vybrané přídavky:"
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr "Vybrané a potomci"
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr "(vybraný dolní soused)"
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr "Vybrané mapování příkazů"
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr "vybrané pro instalaci"
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr "vybrané pro odinstalaci"
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr "(vybraný levý soused)"
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr "Vybrané zprávy v okně zprávy:"
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerecompiled
|
|
#, object-pascal-format
|
|
msgid "Selected %d modes were successfully compiled."
|
|
msgstr "Vybraných %d režimů bylo úspěšně sestaveno."
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr "(vybraný pravý soused)"
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr "(vybraný horní soused)"
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Vybrat soubor"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcpath
|
|
msgid "Select the path where FPC is installed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr "Vybrat zdrojový adresář FPC"
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
msgid "Select Frame"
|
|
msgstr "Vyberte Rámec"
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Výběr přesahuje řetězcovou konstantu"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Nástroj výběru"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr "Vybrat zdrojový adresář Lazarusu"
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
#, object-pascal-format
|
|
msgid "Select path to %s"
|
|
msgstr "Vybrat cestu k %s"
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr "Vybrat cílový adresář"
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr "Nastavit všechny barvy:"
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr "Nastavit výchozí"
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr "Toto nastavte k překládání zpráv překladače do jiného jazyka (mimo Angličtinu). Například: Němčina: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr "(Nastavení výchozího odsazování)"
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr "Krátky:"
|
|
|
|
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
|
|
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr "Krátké, bez cesty"
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
#, object-pascal-format
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr "Měla by být komponenta \"%s\" automaticky vytvořena, když aplikace nastartuje?"
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr "Ukázat"
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
#, object-pascal-format
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr "Ukázat abstraktní metody \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr "Zobrazit strom komponent"
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr "Ukázat konzoli"
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr "Ukázat pokyny deklarace"
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr "Ukázat rozdíly mezi módy ..."
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr "Ukázat prázdné jednotky/balíčky"
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr "Ukázat zprávu FPC \"přeloženo řádků\""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr "Zobrazit ikony pro"
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Ukázat žlábek"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr "Ukázat nápovědu"
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Ukázat pokyny"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Ukázat identifikátory"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr "Ukázat informační rámeček"
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr "Ukázat Typové ID Zprávy"
|
|
|
|
#: lazarusidestrconsts.lisshowmultiplelines
|
|
msgid "Show multiple lines"
|
|
msgstr "Ukázat více řádků"
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr "Zobrazit pouze změněné"
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr "Zobrazit pouze jedno tlačítko v liště pro celé IDE, namísto jednoho tlačítka pro každé okno. Někteří Linuxoví Správci Oken jako Cinnamon toto nepodporují a vždy ukazují jedno tlačítko pro každé okno."
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr "Ukázat výstup"
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview gutter"
|
|
msgstr "Zobrazit přehledový žlábek"
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Ukázat balíčky"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr "Ukázat pozici v zdrojovém editoru"
|
|
|
|
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
|
|
msgid "Show property filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr "Ukázat nedávno použité identifikátory na vrchu"
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr "Zobrazit relativní cesty"
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr "Ukáže všechny prvky v hierarchii stromu."
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr "Rámeček vespodu ukazuje popis vybrané vlastnosti."
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
#, fuzzy
|
|
#| msgid "Show setup dialog for most important settings"
|
|
msgid "Show setup dialog for most important settings."
|
|
msgstr "Ukázat dialog nastavení nejdůležitějších nastavení"
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Ukázat speciální znaky"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr "Ukázat stavový pruh"
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Ukázat jednotky"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr "Ukázat jednotky se sekcemi initialization/finalization"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr "Tyto jednotky mohou inicializovat globální data použitá programem/aplikací. Odstraňte je opatrností."
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr "Zobrazit nepoužité jednotky ..."
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr "Ukázat pokyny hodnot během ladění"
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
#, fuzzy
|
|
#| msgid "show version and exit"
|
|
msgid "Show version and exit."
|
|
msgstr "ukázat verzi a odejít"
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Zúžit na nejmenší"
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Sourozenec"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr "Jednoduchý program"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr "Nejjednodušší Free Pascal program příkazové řádky."
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple syntax"
|
|
msgstr "Jednoduchá syntaxe"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr "Přeskočit chyby"
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr "Přeskočit soubor"
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Přeskočit soubor a pokračovat v načítání"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
#, fuzzy
|
|
#| msgid "Skip loading last project"
|
|
msgid "Skip loading last project."
|
|
msgstr "Přeskočit načtení posledního projektu"
|
|
|
|
#: lazarusidestrconsts.lisskipstartupchecks
|
|
msgid "Skip selected checks at startup. Valid options are:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr "Pomalejší, ale přesnější."
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr "Menší, ale pomalejší"
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Odpovídá"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Omlouváme se, tento typ ještě nebyl implementován"
|
|
|
|
#: lazarusidestrconsts.lissorthistorylimit
|
|
msgid "History items limit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr "Řazení"
|
|
|
|
#: lazarusidestrconsts.lissortorderalphabetic
|
|
msgid "Alphabetic"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderdefinition
|
|
msgid "Definition (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortorderscopedalphabetic
|
|
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
|
|
msgid "Alphabetic (Scoped)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortordertitle
|
|
msgid "Order by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Vzestupný"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Rozlišovat velikost znaků"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Vzestupný"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Doména"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Ignorovat mezery"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Řádky"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Volby"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Odstavce"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Náhled"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Přijmout"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Seřadit výběr"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Slova"
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationaresame
|
|
#, object-pascal-format
|
|
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
|
|
msgstr "Zdrojový \"%s\"%sa cílový \"%s\"%sadresář je stejný. Prosím vyberte jiný adresář."
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Zdrojový adresář \"%s\" neexistuje."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr "Správce Oken Editoru Zdrojáku"
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Zdroj upraven"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Zdroj stránky \"%s\" změněn. Uložit?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
#, object-pascal-format
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr "Zdroje stránek se změnily. Uložit stránku \"%s\"? (%d další)"
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Zdrojové cesty"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Mezery stejně"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr "Zdroj. OS"
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Hledání"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Hledat text"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr "Začátek převodu"
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr "Spustit IDE"
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Začít s novým projektem"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr "Stavová lišta ukazuje jména vlastností a třídu, kde jsou zveřejněny."
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgctxt "lazarusidestrconsts.lisstop"
|
|
msgid "Stop"
|
|
msgstr "Zastavit"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Zastavit aktuální ladění a znovu sestavit projekt?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Zastavit ladění?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Zastavit ladění?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Zastavit při výjimce"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Zastavit ladění?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr "Uložit oddělovače cesty \\ a / jako"
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Chyba proudového zpracování"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Podprocedure"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Vnořená procedura na stejné úrovni"
|
|
|
|
#: lazarusidestrconsts.lissubtarget
|
|
msgid "Subtarget"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Úspěch"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
#, object-pascal-format
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr "Úspěšně exportováno do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr "Úspěšně exportováno %d režimu sestavení do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr "Úspěšně exportovány volby překladače do \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
#, object-pascal-format
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr "Úspěšně importováno z \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
#, object-pascal-format
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr "Úspěšně importováno %d režimů sestavení z \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
#, object-pascal-format
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr "Úspěšně importovány volby překladače z \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr "Navrhnout přednastavené jméno nového souboru malými písmeny"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr "Podezřelá cesta zahrnovaných"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr "Podezřelá cesta jednotek"
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Neplatné jméno proměnné"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
#, object-pascal-format
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "\"%s\" není platný identifikátor."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Přepsat systémovou proměnou"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr "Přepnout Nastavení Filtru"
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr "Přepnout záložku Oblíbené po dotazu na jméno komponenty."
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Režim syntaxe"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr "system.ppu nenalezen. Zkontrolujte Váš fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
#, object-pascal-format
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr "Setřídit pořadí záložek všech dceřiných prvků \"%s\" podle jejich pozice?"
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr "Přesunout vybraný prvek dolů v pořadí záložek"
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
#, object-pascal-format
|
|
msgid "Tab Order of %s"
|
|
msgstr "Pořadí záložek %s"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr "Vypočítat pořadí záložek rekurzivně pro prvky potomků"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr "rekurzivně"
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr "Vypočítat pořadí záložek prvků podle jejich X a Y souřadnic"
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr "Přesunout vybraný prvek nahoru v pořadí záložek"
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
#, object-pascal-format
|
|
msgid "Tabs for %s"
|
|
msgstr "Listy pro %s"
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr "Cíl:"
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
#, object-pascal-format
|
|
msgid ", Target: %s"
|
|
msgstr ", Cíl: %s"
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Cílový CPU"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr "Jméno cílového souboru (prázdné = použít výstupní adresář jednotek):"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr "Jméno cílového souboru (-o):"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Cílové jméno souboru projektu"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Cílové jméno souboru + parametry"
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr "Cíl je pouze ke čtení"
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Cílový OS"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr "Upravitelná buňka"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
#, object-pascal-format
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr "Vloží upravitelné buňky. Mezi buňkami můžete přecházet klávesou Tab.%0:sMakro \"param\" přijímá seznam argumentů oddělených čárkou.%0:sPrvním argumentem je výchozí hodnota.%0:sDruhý argument (nepovinný) může být použit k propojení buňky s jinou buňkou (synchronní úprava).%0:s%0:s while param(\"foo\") do param(foo);%0:sVloží dvě nezávislé buňky, obě s výchozím textem \"foo\".%0:sUvozovky nejsou povinné%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sVloží dvě propojené buňky. Úprava jedné z nich se promítne i do druhé%0:sHodnota \"1\" odkazuje na pozici dalšího \"param()\", takže pokud je více parametrů:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sDruhá a třetí jsou propojené (třetí odkazuje na \"2\").%0:s%0:s\"Sync\" může být zkráceno na \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sDruhá a třetí jsou propojené.%0:sPoznámka: Pokud \"Sync\" nemá uvedeno \"=\" a pozici, propojí se k předchozí buňce se stejnou výchozí hodnotou (v tomto případě \"foo\")."
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr "Soubor šablony"
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testovací adresář"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr "Zkušební URL"
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
#, object-pascal-format
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr "Aplikační balík byl vytvořen pro \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
#, object-pascal-format
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Třída \"%s\" je TControl a nemůže být vložena na neovládací prvek.%sNelze vložit."
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr "Soubor překladače \"%s\" nevypadá v pořádku:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
#, object-pascal-format
|
|
msgid "The component %s can not be deleted because it is not owned by %s."
|
|
msgstr "Komponenta %s nemůže být smazána, protože není vlastněna %s."
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr "Editor komponenty třídy \"%s\" vytvořil chybu:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
#, object-pascal-format
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr "Třída editoru komponent \"%s\"%svyvolaná slovesem #%s \"%s\"%svytvořila chybu:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr "Komponenta %s je zděděná z %s.%sK smazání zděděné komponenty otevřete předka a smažte ji tam."
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
#, object-pascal-format
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr "Komponenta %s je zděděná z %s.%sK přejmenování zděděné komponenty otevřete předka a přejmenujte ji tam."
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr "Jméno komponenty musí být jedinečné ve všech komponentách na formuláři/datovém modulu. Jméno je porovnáváno bez citlivosti na velikost písmen jako normální identifikátor pascalu."
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr "Nastavení bude poníženo/převedeno."
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
#, object-pascal-format
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr "%s obsahuje neexistující adresář:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
#, object-pascal-format
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr "%s obsahuje znak hvězdičky *.%sLazarus to považuje za běžný znak a neprovádí rozšíření jako souborová maska."
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr "Aktuální FPC nemá žádný konfigurační soubor. Pravděpodobně budou chybět některé jednotky. Zkontrolujte svou instalaci FPC."
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
#, object-pascal-format
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr "Ladič \"%s\"%sneexistuje, nebo není spustitelný.%sZkontrolujte Nástroje -> Nastavení -> Volby ladiče"
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr "Výchozí režim musí být uložen v projektu, ne v sezení."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
#, object-pascal-format
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Cílový adresář%s\"%s\" neexistuje."
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr "Adresář \"%s\" již neobsahuje žádné zahrnované soubory projektu. Odstranit tento adresář z projektové cesty zahrnovaných cest?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr "Adresář \"%s\" již neobsahuje žádné projektové jednotky. Odstranit tento adresář z projektové cesty jednotek?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
#, object-pascal-format
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Adresář \"%s\" nadále není potřeba v cestě jednotek.%sOdstranit jej?"
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\""
|
|
msgstr "Soubor \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr "Indexový soubor je nutný pro funkce jako hledání deklarací. Během vytváření můžete upravovat zdrojové kódy a překládat, ale funkce jako hledání deklarací zobrazí chyby o nenalezených jednotkách. Může to trvat několik minut."
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr "Soubor \"%s\" není projekt Lazarusu.%sVytvořit nový projekt pro \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
#, object-pascal-format
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr "Maska souboru \"%s\" je neplatná."
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
#, object-pascal-format
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr "Maska souboru \"%s\" není platný regulární výraz."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "Soubor \"%s\" vypadá jako program. %sZavřít aktuální projekt a vytvořit nový projekt Lazarusu pro tento program?%s\"Ne\" načte soubor jako normální zdroj."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
#, object-pascal-format
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr "Soubor %s vypadá, že je programový soubor existujícího projektu Lazarusu."
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Soubor \"%s\" nebyl nalezen.%sChcete ho najít sami?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
#, object-pascal-format
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Soubor \"%s\" nebyl nalezen.%sZvolte Ignorovat pro pokračování v načítání projektu,%szvolte Zrušit pro zastavení načítání."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
#, object-pascal-format
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Následující metody použité v %s nejsou v zdrojovém kódu%s%s%s%s%sOdstranit tyto odkazy?"
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr "Zdrojový adresář FPC \"%s\" nevypadá v pořádku:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr "Spustitelný soubor Free Pascal překladače má obvykle jméno \"%s\". Můžete rovněž použít překladač specifický pro cílovou platformu jako \"%s\". Zadejte, prosím, kompletní souborovou cestu."
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr "IDE stále sestavuje."
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr "Identifikátor je jednotkou. Použijte funkci Soubor - Uložit jako k přejmenování jednotky."
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitproceedanyway
|
|
#, object-pascal-format
|
|
msgid "The identifier is a %s.%sNew file(s) will be created, old can be deleted.%sProceed anyway?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
#, object-pascal-format
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr "Klávesa %s%sje již přiřazena k %s%s.%sOdstranit staré přiřazení a přiřadit klávese novou funkci %s?"
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
#, object-pascal-format
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr "Programový balíček %s%snutný ke spuštění neexistuje, nebo není spustitelný.%sChcete jej vytvořit?%sViz nastavení v Projekt -> Volby projektu -> Aplikace."
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
#, object-pascal-format
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Spouštěcí aplikace \"%s\"%sneexistuje, nebo není spustitelná.%sViz Spustit -> Parametry spouštění -> Místní"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr "Adresář Lazarusu obsahuje zdrojové kódy IDE a soubory balíčků LCL a mnoha standardních balíčků. Obsahuje například soubor \"ide%slazarus.lpi\". Soubory překladů jsou umístěny také tam."
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
#, object-pascal-format
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr "Adresář Lazarusu \"%s\" nevypadá v pořádku:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhelazarussourcesuse
|
|
#, object-pascal-format
|
|
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "Soubor LFM (formulář Lazarusu) obsahuje neplatné vlastnosti. To například znamená, že obsahuje nějaké vlastnosti/třídy, které neexistují v aktuálním LCL. Obvyklá oprava je odstranit tyto vlastnosti z lfm a ručně opravit kód Pascalu."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
#, object-pascal-format
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr "Makro \"%s\" nezačíná na \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
#, object-pascal-format
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr "Spouštěcí soubor \"make\" má obvykle jméno \"%s\". Je potřeba pro sestavení IDE. Prosím, zadejte celou cestu souboru."
|
|
|
|
#: lazarusidestrconsts.listhenamecontainsapascalkeyword
|
|
#, object-pascal-format
|
|
msgid "The name \"%s\" contains a Pascal keyword."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
#, object-pascal-format
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr "Nový 'include' soubor ještě není v cestě hledání.%sPřidat adresář %s?"
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
#, object-pascal-format
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr "Nová jednotka zatím není v cestě hledání.%sPřidat adresář %s?"
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr "Stará konfigurace bude povýšena."
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
#, object-pascal-format
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr "\"Ostatní zdroje\" obsahuje adresář, který je již v \"Ostatní soubory jednotek\".%s%s"
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
#, object-pascal-format
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr "Výstupní adresář \"%s\" chybí."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr "Výstupní adresář %s je v seznamu cest hledání include %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr "Výstupní adresář %s je v zděděném seznamu cest hledání include %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr "Výstupní adresář %s je v seznamu zděděných cest hledání jednotek %s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
#, object-pascal-format
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr "Výstupní adresář %s je v seznamu cest hledání jednotek%s."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr " Výstupní adresář by měl být samostatný adresář a neměl by obsahovat žádné zdrojové soubory."
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr "Vlastnící třída má toto jméno"
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr "Vlastník má toto jméno"
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Balíček %s přidává cestu \"%s\" do zahrnované cesty IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
#, object-pascal-format
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Balíček %s přidává cestu \"%s\" do cesty jednotek IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Balíček již obsahuje jednotku s tímto jménem."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
#, object-pascal-format
|
|
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
|
|
msgstr "Balíček %s nelze nainstalovat, protože vyžaduje balíček \"%s\", který je pouze balíčkem běhovým."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
#, object-pascal-format
|
|
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
|
|
msgstr "Balíček %s nemůže být odinstalován, protože jej potřebuje samo IDE."
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
#, object-pascal-format
|
|
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr "Balíček %s nemá proceduru \"Register\", což typicky znamená, že neposkytuje žádný přídavek pro IDE. Jeho instalací se pravděpodobně pouze zvětší velikost IDE a může dokonce způsobit jeho nestabilitu.%sTip: Pokud chcete použít balíček v projektu, použijte položku nabídky \"Přidat do projektu\"."
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
#, object-pascal-format
|
|
msgid "The package %s is already in the list"
|
|
msgstr "Balíček %s je již v seznamu"
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
#, object-pascal-format
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr "Balíček %s není balíčkem návrhovým. Nelze jej nainstalovat do IDE."
|
|
|
|
#: lazarusidestrconsts.listhepackageisusedby
|
|
#, object-pascal-format
|
|
msgid "The package \"%s\" is used by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
#, object-pascal-format
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr "Cesta \"make\" není správná: \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
#, object-pascal-format
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr "Program \"make\" nenalezen.%sTento nástroj je nutný k sestavení Lazarusu."
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr "Volby překladače projektu a příkazy v hlavním zdroji se liší. Nové jednotky použijí mód a řetězcový typ z voleb projektu:"
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
|
|
msgid "Running your application with debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
|
|
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
|
|
msgid "Run with no debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
|
|
#, object-pascal-format
|
|
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
|
|
msgid "Choose Debug Information format"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
#, object-pascal-format
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr "Projekt nepoužívá rozhraní jednotek LCL, které jsou vyžadovány LCLBase.%sDostanete různé chyby při linkování, pokud použijete LCL bez rozhraní."
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
|
|
#, object-pascal-format
|
|
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr "Projekt nemá hlavní soubor zdrojového kódu."
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
#, object-pascal-format
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Informační soubor projektu \"%s\"%sje shodný s hlavním souborem zdrojového kódu!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
#, object-pascal-format
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr "Informační soubor projektu \"%s\"%sse změnil na disku."
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
#, object-pascal-format
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Před sestavením musíte projekt uložit%sPokud jste nastavili testovací adresář v nastavení IDE,%smůžete nový projekt zároveň vytvořit i sestavit.%sUložit projekt?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources which require at least FPC 2.4"
|
|
msgstr "Projekt používá FPC zdroje, které vyžadují nejméně FPC 2.4"
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
#, object-pascal-format
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr "Projekt používá cílový OS=%s a CPU=%s.%ssystem.ppu pro tento cíl nebyl nalezen v binárním adresáři FPC.%sUjistěte se, že fpc je pro tento cíl správně nainstalováno a že fpc.cfg obsahuje správné adresáře."
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr "Projekt zapisuje ladící symboly do vnějšího souboru. \"%s\" podporuje pouze symboly ve spustitelných."
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
|
|
#, object-pascal-format
|
|
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
|
|
msgstr "Projekt zapisuje ladící symboly do spustitelného souboru raději než do vnějšího souboru. \"%s\" podporuje pouze symboly ve vnějším souboru."
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
#, object-pascal-format
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr "%sExistují dodatečné poznámky pro tuto zprávu na%s"
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
#, object-pascal-format
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "V adresáři jsou další soubory se stejným jménem, %skteré se liší pouze ve velikosti písmen:%s%s%sSmazat je?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
#, object-pascal-format
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Na disku už je soubor se stejným jménem a podobnou koncovkou%sSoubor: %s%sNejednoznačný soubor: %s%sSmazat nejednoznačný soubor?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr "Už existuje režim sestavení s tímto názvem."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr "Už existuje třída komponenty s názvem %s."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr "Již existuje komponenta se tímto jménem"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
#, object-pascal-format
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr "Už existuje soubor%s%s%s v %s"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
#, object-pascal-format
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr "Už existuje soubor \"%s\" v %s%sStarý: %s%sNový: %s%s%sPokračovat?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "Již existuje formulář se jménem \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr "Makro se jménem \"%s\" již existuje."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
#, object-pascal-format
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr "IDE makro se jménem \"%s\" již existuje"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
#, object-pascal-format
|
|
msgid "There is already a package %s in the list"
|
|
msgstr "Balíček %s je již v seznamu"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
#, object-pascal-format
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr "Už existuje jednotka \"%s\" v %s%sStará: %s%sNová: %s%sMěli by jste se přesvědčit že v cestě pro hledání jednotek je pouze jedna z nich.%s%sPokračovat?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Jednotka se jménem \"%s\" již existuje. Identifikátory Pascalu musí být unikátní."
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
#, object-pascal-format
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Jednotka se jménem \"%s\" již v projektu existuje.%sZvolte, prosím, jiné jméno"
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
#, object-pascal-format
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr "V adresáři %s není fpc.exe. Obvykle je spouštěcí make soubor instalován společně s překladačem FPC."
|
|
|
|
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
|
|
#, object-pascal-format
|
|
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr "Musí existovat alespoň jeden sestavovací mód."
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
#, object-pascal-format
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr "Zdrojová třída \"%s\" dědí z \"%s\". Pravděpodobně je to překlep pro TForm."
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
#, object-pascal-format
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Při zápisu zvolené komponenty nastala chyba %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
#, object-pascal-format
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Při převodu binárního proudu zvolené komponenty nastala chyba %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
#, object-pascal-format
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Při kopírování proudu komponenty do schránky nastala chyba:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Kořenovou komponentu nelze smazat."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr "Tyto soubory budou smazány"
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr "Tyto nastavení jsou uloženy v projektu."
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr "Tyto jednotky nebyly nalezeny:"
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
#, object-pascal-format
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr "Zdrojové kódy balíčků Free Pascalu jsou nutné pro prohlížení a doplňování kódu. Například obsahuje soubor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhetargetdirectoryisafile
|
|
#, object-pascal-format
|
|
msgid "The target directory is a file:%s"
|
|
msgstr "Cílový adresář je soubor:%s"
|
|
|
|
#: lazarusidestrconsts.listhetargetfilenameisadirectory
|
|
msgid "The target file name is a directory."
|
|
msgstr "Jméno cílového souboru je adresář."
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
#, object-pascal-format
|
|
msgid "The target %s is not writable."
|
|
msgstr "Cíl %s není zapisovatelný."
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
#, object-pascal-format
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr "Adresář testů nelze nalézt:%s\"%s\"%s(viz volby IDE)"
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
#, object-pascal-format
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr "Jednotka \"%s\" již existuje."
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
#, object-pascal-format
|
|
msgid "The unit belongs to package %s."
|
|
msgstr "Jednotka patří balíčku %s."
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
#, object-pascal-format
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Jednotka %s existuje dvakrát v cestě jednotek %s:"
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr "Jednotka má toto jméno"
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
#, object-pascal-format
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr "Jméno souboru jednotky \"%s\" není malými písmeny.%sPřekladač Free Pascal nehledá všechny velikosti. Je doporučeno použít jména souborů s malými písmeny.%sPřejmenovat soubor malými písmeny?"
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
#, object-pascal-format
|
|
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr "Jednotka %s je součastí zdrojů FPC, ale odpovídající soubor fpdoc nebyl nalezen.%sBuď jste dosud nepřidali adresář fpcdocs do prohledávané cesty, nebo jednotka ještě není dokumentovaná.%sSoubory fpdoc pro FPC můžete stáhnout z: %s%sPřidejte, prosím, adresář do voleb editoru fpdoc.%sPro vytvoření nového souboru musí být adresář zapisovatelný."
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
#, object-pascal-format
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr "Jednotka %s je používaná jinými soubory.%sAktualizovat automaticky odkazy?"
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
#, object-pascal-format
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Jednotka samotná už má jméno \"%s\". Identifikátory Pascalu musí být unikátní."
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
#, object-pascal-format
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr "Cesta hledání jednotek \"%s\" obsahuje zdrojový adresář \"%s\" balíčku %s"
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
#, object-pascal-format
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr "Pracovní adresář \"%s\" neexistuje.%sProsím, zkontrolujte pracovní adresář vNabídka > Spustit > Parametry spuštění."
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
#, object-pascal-format
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr "Tato komponenta už obsahuje třídu s názvem %s."
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr "Tato funkce vyžaduje otevřený .lfm soubor v editoru zdrojového kódu."
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
#, fuzzy
|
|
#| msgid "this help message"
|
|
msgid "This help message."
|
|
msgstr "tato zpráva nápovědy"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr "Toto je zkušební projekt pro balíčky v době návrhu, zkouším mimo IDE."
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
#, object-pascal-format
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Vypadá to jako pascalovský soubor.%sDoporučujeme ve jméně použít malá písmena, aby jste předešli problémům na některých souborových systémech a různých překladačích.%sPřejmenovat na malá písmena?"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr "Tento projekt nemá hlavní zdrojový soubor"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr "Tento projekt má pouze výchozí sestavovací mód."
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
#, object-pascal-format
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr "Tato kombinace voleb sestavení Lazarusu není podporována touto instalací.%sAdresář \"%s\" není zapisovatelný.%sViz webové stránky Lazarusu pro jiné způsoby instalace Lazarusu."
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
#, object-pascal-format
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Tento příkaz nelze vyjmout.%sProsím, vyberte nějaký kód pro vyjmutí procedury/metody."
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr "Toto umožní změnu všech režimů sestavení najednou. Ještě není hotovo."
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr "Toto vytvoří kruhovou závislost."
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
#, object-pascal-format
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr "Toto vloží hodně textu (%s) do schránky.%sPokračovat?"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr "&Titulek"
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
#, fuzzy
|
|
#| msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
|
|
msgstr "Titulek v panelu úloh zobrazí například: projekt1.lpi - Lazarus"
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr "Název (nechejte prázdné pro výchozí)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Cesta:"
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr "Nastavení nástrojového panelu"
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
#, object-pascal-format
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr "nástroj \"%s\" nemá spustitelný soubor"
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr "Hlavička Nástroje: Selhalo"
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr "Hlavička Nástroje: Běží"
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr "Hlavička Nástroje: Odscrollováno"
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr "Hlavička Nástroje: Úspěch"
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr "nástroj skončil s kódem %s. Použijte kontextovou nabídku pro více informací."
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
|
|
#, object-pascal-format
|
|
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Nahoře"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Přichycení nahoru"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Horní okrajový prostor. Tato hodnota je přidána jako základ okrajového prostoru a použita pro prostor nad prvkem."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Procedure hint"
|
|
msgstr "Zobrazit tipy tříd/procedur"
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Vrcholky"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Toto je sourozenec prvku, k jehož horní straně je ukotvený. Ponechte prázdné pro ukotvení k rodiči v Delphi stylu (BorderSpacing a ReferenceSide nehrají roli)"
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Horní mezery stejně"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
#, object-pascal-format
|
|
msgid "Total Pages: %s"
|
|
msgstr "Celkem stránek: %s"
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr "Přeložit Anglické Zprávy"
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr "Strom potřebuje obnovení"
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
#, object-pascal-format
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr "Dva přesunované soubory budou mát stejný název:%s%s%s%s%sv %s"
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr "Typy (neodstraňovat pokud není náhrada)"
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr "Přídavné adresáře:"
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr "Všechny jednotky balíčku"
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr "Všechny jednotky v zdrojovém editoru"
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr "Všechny jednotky"
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr "Jako výchozí jsou prohledány pouze otevřené jednotky a jednotky projektu. Přidejte sem seznam adresářů k prohledání oddělený středníkem."
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr "Složit všechny uzly"
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr "Rozbalit všechny uzly"
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
#, object-pascal-format
|
|
msgid "File: %s"
|
|
msgstr "Soubor: %s"
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr "(Filtrovat)"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
#, object-pascal-format
|
|
msgid "Implementation Uses: %s"
|
|
msgstr "Implementation Uses: %s"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
#, object-pascal-format
|
|
msgid "implementation uses: %s"
|
|
msgstr "implementation uses: %s"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
#, object-pascal-format
|
|
msgid "Interface Uses: %s"
|
|
msgstr "Interface Uses: %s"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
#, object-pascal-format
|
|
msgid "interface uses: %s"
|
|
msgstr "interface uses: %s"
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr "Projekt a balíčky"
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr "Skenování ..."
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
#, object-pascal-format
|
|
msgid "Scanning: %s units ..."
|
|
msgstr "Skenování: %s jednotek ..."
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr "(Hledat)"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr "Najít další výskyt této fráze"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr "Najít další jednotku s touto frází"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr "Najít předchozí výskyt této fráze"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr "Najít předchozí jednotku s touto frází"
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr "Vybrané jednotky"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr "Zobrazit uzly pro adresáře"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr "Zobrazit uzly pro projekt a balíčky"
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr "Jednotky"
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
#, object-pascal-format
|
|
msgid "Units: %s"
|
|
msgstr "Jednotky: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
#, object-pascal-format
|
|
msgid "Used by Implementations: %s"
|
|
msgstr "Použito v Implementacích: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
#, object-pascal-format
|
|
msgid "used by implementations: %s"
|
|
msgstr "použito v implementacích: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
#, object-pascal-format
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr "Použito v Rozhraních: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
#, object-pascal-format
|
|
msgid "used by interfaces: %s"
|
|
msgstr "použito v rozhraních: %s"
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Neukazovat znova tuto zprávu."
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Chyba v regulárním výrazu"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Písmo bez UTF-8"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
msgid "Goto line:"
|
|
msgstr "Přejít na řádek:"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Nenalezeno"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
#, object-pascal-format
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Nahradit výskyty \"%s\"%s s \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
#, object-pascal-format
|
|
msgid "Searching: %s"
|
|
msgstr "Hledání: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr "Pokračovat v hledání od začátku?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr "Pokračovat v hledání od konce?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
#, object-pascal-format
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Hledaný řetězec '%s' nenalezen!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
#, object-pascal-format
|
|
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr "Aktuální písmo editoru nepodporuje UTF-8, ale váš systém vypadá, že ho používá.%sTo znamená, že ne-ASCII budou pravděpodobně zobrazeny nekorektně.%sMůžete vybrat jiné písmo v nastavení editoru."
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Smazat vyrovnávací paměť pro include"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
#, object-pascal-format
|
|
msgid "%s bytes"
|
|
msgstr "%s bajtů"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Zahrnut tímto:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
msgid "In project:"
|
|
msgstr "V projektu:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Řádky:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Jméno:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "ne"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Velikost:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Typ:"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "ano"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Ukázat hodnoty CodeTools"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Nelze převést binární proud na text"
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Nelze zkopírovat komponenty do schránky"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nelze přidat komentář zdrojové hlavičky do souboru zdrojů %s\"%s\".%sNejspíše chyba syntaxe."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
#, object-pascal-format
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Nelze přidat zdroj T%s:FORMDATA do souboru zdrojů %s\"%s\".%sPravděpodobně syntaktická chyba."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
|
|
msgstr "Nelze přidat závislost %s, neboť balíček %s má již závislost %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
#, object-pascal-format
|
|
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
|
|
msgstr "Nelze přidat závislost %s, protože by vznikla kruhová závislost. Závislost %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
#, object-pascal-format
|
|
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
|
|
msgstr "Do projektu nelze přidat %s, přestože projekt už obsahuje jednotku se stejným jménem."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Nelze zálohovat soubor \"%s\" do \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
#, object-pascal-format
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sNelze změnit jméno třídy %s na %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr "Nelze změnit Scaled projektu ve zdrojovém souboru.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
#, object-pascal-format
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr "Nelze změnit titulek projektu ve zdrojích.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Nelze vyčistit cílový adresář"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
#, object-pascal-format
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Nelze vyčistit \"%s\".%sProsím, zkontrolujte přístupová práva."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
#, object-pascal-format
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Nelze převést text komponenty do binárního formátu:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
#, object-pascal-format
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Nelze převést soubor \"%s\"%sChyba: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
#, object-pascal-format
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Nelze převést textová data formuláře souboru %s\"%s\"%sdo binárního proudu. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
#, object-pascal-format
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr "Nelze převést na kódování \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file because there is already a directory with this name."
|
|
msgstr "Nelze vytvořit nový soubor, jelikož již existuje adresář stejného jména."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Nelze vytvořit dočasnou paměť pro lfm."
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Nelze odstranit mnohoznačný soubor \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
#, object-pascal-format
|
|
msgid "unable to execute: %s"
|
|
msgstr "nemožno spustit: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr "Nelze najít sekci ResourceString v této nebo některé z použitých jednotek."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
#, object-pascal-format
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "Nelze najít platné jméno třídy v \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Nelze nalézt soubor \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
#, object-pascal-format
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr "Nelze najít soubor \"%s\".%sPokud patří do vašeho projektu, zkontrolujte cestu hledání v %sProjekt -> Volby překladače -> Prohledávané cesty -> Ostatní soubory jednotek. Pokud tento soubor patří do balíčku, zkontrolujte příslušné volby překladače balíčku. Pokud tento soubor patří do Lazarusu, ujistěte se čistým přeložením. Pokud soubor patří do FPC, zkontrolujte fpc.cfg. Pokud si nejste jistí, použijte Projekt -> Volby překladače -> Test"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
#, object-pascal-format
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Nelze najít %s v proudu LFM."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr "Nelze najít metodu."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
#, object-pascal-format
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr "Nelze najít pascalovskou jednotku (.pas,.pp) pro soubor .lfm %s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
#, object-pascal-format
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr "Nelze najít komponentu třídy \"%s\".%sNení registrována pomocí RegisterClass a nebyl nalezen žádný lfm soubor.%sJe vyžadována jednotkou:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Nelze získat změny v editoru."
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Nelze získat zdroj pro návrhář."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
#, object-pascal-format
|
|
msgid "unable to load file %s: %s"
|
|
msgstr "nelze nahrát soubor %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
#, object-pascal-format
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr "Nelze přečíst balíček \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
#, object-pascal-format
|
|
msgid "Unable to load the component class \"%s\" because it depends on itself."
|
|
msgstr "Nelze načíst třídu komponenty \"%s\", protože závisí na sobě samé."
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
#, object-pascal-format
|
|
msgid "Unable to open \"%s\""
|
|
msgstr "Nemožno otevřít \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr "Nelze otevřít komponentu předka"
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
#, object-pascal-format
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule."
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
#, object-pascal-format
|
|
msgid "Unable to read %s"
|
|
msgstr "Nelze přečíst %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr "nelze číst proces ExitStatus"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
#, object-pascal-format
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Nelze odstranit starý záložní soubor \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr "Nelze odstranit Scaled projektu ze zdrojového souboru.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
#, object-pascal-format
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr "Nelze odstranit titulek projektu ze zdrojů.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
#, object-pascal-format
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Nelze přejmenovat víceznačný soubor \"%s\"%sna \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Nelze přejmenovat formulář ve zdrojovém souboru."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Nelze přejmenovat metodu. Prosím vyřešte chybu ukázanou v okně zpráv."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Nelze přejmenovat proměnnou ve zdrojovém souboru."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr "Nelze spustit"
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
#, object-pascal-format
|
|
msgid "Unable to run \"%s\""
|
|
msgstr "Nelze spustit \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Nelze nastavit AnchorSide Control"
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr "Nelze zobrazit metodu."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Nelze zřetězit vybranou komponenty"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Nelze zřetězit vybrané komponenty."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
#, object-pascal-format
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Nelze zřetězit %s:T%s."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
#, object-pascal-format
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Nelze převést komponentu v binárním proudu %s:T%s na text."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Nelze zaktualizovat příkaz CreateForm v zdrojovém souboru projektu"
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr "Zruš výběr všech"
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Vrátit zpět"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
#, object-pascal-format
|
|
msgid "Uninstall %s"
|
|
msgstr "Odinstalovat %s"
|
|
|
|
#: lazarusidestrconsts.lisuninstallfail
|
|
msgid "Uninstall failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr "Odinstalování není možné"
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Odinstalovat vybrané"
|
|
|
|
#: lazarusidestrconsts.lisuninstallthemtoo
|
|
msgid "Uninstall them too"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr "Jednotka \"%s\" byla změněna. Uložit?"
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Identifikátor jednotky již existuje"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
#, object-pascal-format
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s jednotka %s v balíčku %s"
|
|
|
|
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
|
|
#, object-pascal-format
|
|
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Jméno jednotky je už v projektu"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Jméno jednotky začíná s..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Jméno jednotky obsahuje..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
#, object-pascal-format
|
|
msgid "unit %s not found"
|
|
msgstr "jednotka %s nenalezena"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
#, object-pascal-format
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr "jednotka %s nenalezena na místě \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "A unit not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Výstupní adresář jednotky"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "cesta jednotky"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Cesty jednotky"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
#, object-pascal-format
|
|
msgid "unit %s requires package %s"
|
|
msgstr "jednotka %s vyžaduje balíček %s"
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinfile
|
|
#, object-pascal-format
|
|
msgid "Units not found in file %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
#, object-pascal-format
|
|
msgid "Unused units of %s"
|
|
msgstr "Nepoužité jednotky z %s"
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr "Neobvyklé jméno překladače. Obvykle začíná fpc, ppc nebo ppcross."
|
|
|
|
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
|
|
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
|
|
msgstr "Neobvyklé jméno pas2js překladače. Obvykle začíná s pas2js."
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "Nahoru"
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationcreateform
|
|
msgid "Update Application.CreateForm statements in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
|
|
msgid "Update Application.Scaled statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
|
|
msgid "Update Application.Title statement in main unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr "Aktualizovat informace"
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr "Aktualizovat ostatní podpisy procedur když se změnila pouze velikost písmen"
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr "Aktualizovat odkazy?"
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr "Povýšit"
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr "Povýšit konfiguraci"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr "řetězec velkými písmeny"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr "Řetězec s velkými písmeny dán jako parametr."
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
#, object-pascal-format
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr "URL na wiki (základní url je %s)"
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr "Zpráva o použití (volba -h)"
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr "Použít"
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Použít Ansi řetězce"
|
|
|
|
#: lazarusidestrconsts.lisuseanyway
|
|
#, object-pascal-format
|
|
msgid "Use \"%s\" anyway"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr "Použijte zaškrtávátko pro boolovské hodnoty"
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr "Použít komentáře ve vlastních volbách"
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
#, object-pascal-format
|
|
msgid " used by %s"
|
|
msgstr " užito %s"
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr "Použít balíčky návrhu"
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr "Použito pro automaticky vytvořené formuláře."
|
|
|
|
#: lazarusidestrconsts.lisusefilterforextrafiles
|
|
msgid "Use filter to include extra files"
|
|
msgstr "Použít filtr k zahrnutí extra souborů"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr "Použít identifikátor"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
#, object-pascal-format
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr "Použít identifikátor %s v %s na %s"
|
|
|
|
#: lazarusidestrconsts.lisuseinstead
|
|
#, object-pascal-format
|
|
msgid "Use \"%s\" instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Spouštím aplikaci"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
#, object-pascal-format
|
|
msgid "Use package %s in package %s"
|
|
msgstr "Použít balíček %s v balíčku %s"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr "Použít balíček v balíčku"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
#, object-pascal-format
|
|
msgid "Use package %s in project"
|
|
msgstr "Použít balíček %s v projektu"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr "Použít balíček v projektu"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
#, object-pascal-format
|
|
msgid "Add to list \"%s\""
|
|
msgstr "Přidat na seznam \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr "Uživatelem definované značkování v textu"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
#, object-pascal-format
|
|
msgid "Remove from list \"%s\""
|
|
msgstr "Odebrat ze seznamu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
#, object-pascal-format
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr "Přepnout na seznamu \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Uživatelský domovský adresář"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr "Přidat jednotku do sekce použitých jednotek"
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
#, object-pascal-format
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr "Použít jednotku %s v jednotce %s"
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr "UTF-8 s BOM"
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Hodnota"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
#, object-pascal-format
|
|
msgid "Value%s"
|
|
msgstr "Hodnota%s"
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr "Hodnota: "
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr "Hodnoty"
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr "Hodnoty, které jsou změněny z výchozího jsou uložen v .lfm souboru a jsou zobrazeny jinak v Inspektoru objektů."
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Proměnná"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr "Výřečný"
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Ověřit volání metod"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Verze"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr "Konflikt verzí"
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Svislý"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Zkopírovat informace o verzi do schránky"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr "Velmi Výřečný"
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Zobrazit zdroj (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr "Varování: "
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
#, object-pascal-format
|
|
msgid ", Warnings: %s"
|
|
msgstr ", Varování:%s"
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
#, object-pascal-format
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr "%sVarování: Toto je hlavní jednotka. Nová hlavní jednotka bude %s.pas."
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr "Vítejte v Lazarus IDE %s"
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
#, object-pascal-format
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr "Vítejte v Lazarusu %s%sJiž existuje konfigurace z verze %s v%s%s"
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr "Co potřebuje sestavit"
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr "Aktualizuj odkazy, pokud je jednotka přejmenována"
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template which is used when creating new projects"
|
|
msgstr "Pokud je povoleno, aktuální nastavení jsou uloženy do šablony, která je použita při vytváření projektů"
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr "Pak je pouze jedna možná položka doplnění k okamžitému použití, bez zobrazení doplňovacího boxu"
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr "Ukázat aktuální uzel v průzkumníku kódu při pohybu kurzoru v editoru zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr "Nabídka okna zobrazuje jméno navrhovaného formuláře namísto jeho popisku"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr "Užitečné zejména když je titulek okna prázdný."
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr "Okno Zůstává Vždy Nahoře"
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ", se zahrnutými "
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr "Bez správného překladače nebude procházení kódu a překlad dokonalé."
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr "Bez správného ladiče bude ladění neuspokojivé."
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr "Bez správného adresáře Lazarusu dostanete mnoho varování."
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr "Bez správného spustitelného \"make\" není možný překlad IDE."
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr "Bez příslušných zdrojů FPC bude procházení a doplňování kódu velmi omezené."
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "S požadovanými balíčky"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Slovo na pozici kurzoru v aktuálním editoru"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Pracovní adresář pro sestavení"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Pracovní adresář pro spuštění"
|
|
|
|
#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
|
|
msgid "Write config instead of command line parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswritepackageinfofailed
|
|
msgid "Writing the package info file failed."
|
|
msgstr "Zapisování informací balíčku do souboru selhalo."
|
|
|
|
#: lazarusidestrconsts.liswriteprojectinfofailed
|
|
msgid "Writing the project info file failed."
|
|
msgstr "Zápis projektových informací selhal."
|
|
|
|
#: lazarusidestrconsts.liswritewhatpackagefilesares
|
|
msgid "Write what package files are searched and found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
#, object-pascal-format
|
|
msgid "wrong version in %s: %s"
|
|
msgstr "špatná verze v %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr "Toto můžete zakázat pro jednotlivé formuláře v editoru balíčku"
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr "Můžete to vypnout pro jednotlivé formuláře pomocí kontextového nabídky v Inspektoru projektu"
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr "Můžete stáhnout FPC a zdroje FPC z http://sourceforge.net/projects/lazarus/?source=directory"
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Nemůžete sestavit Lazarus v průběhu ladění nebo překládání."
|
|
|
|
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
|
|
msgid "You cannot change the build mode while compiling."
|
|
msgstr "Nemůžete změnit režim sestavení během překládání."
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr "Můžete vybrat položky jednoduše pomocí stisku podtržených písmen"
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<Všechno>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Editor zdrojového kódu"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr "Odstranit vybrané"
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr "neplatný"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
#, object-pascal-format
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr "neplatný lpk soubor (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
#, object-pascal-format
|
|
msgid "lpk file valid (%s)"
|
|
msgstr "platný lpk soubor (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
#, object-pascal-format
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr "Nebylo možné odstranit soubor \"%s\""
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr "platný"
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr "Přeskenovat lpl soubory"
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
|
|
msgid "Add horizontal spacing between columns"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
|
|
msgid "Add vertical spacing around nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphextraspacing
|
|
msgid "Extra spacing (x/y)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphnamesabovenode
|
|
msgid "Names above node"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
|
|
msgid "Absolute limit for height of levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptcrossings
|
|
msgid "Crossings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedgelen
|
|
msgid "Edge len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptedges
|
|
msgid "Edges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptinfo
|
|
msgid "Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlevels
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
|
|
msgid "Levels"
|
|
msgstr "Úrovně"
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
|
|
msgid "Limit height of Levels"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
|
|
#, object-pascal-format
|
|
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphoptsplitpoints
|
|
msgid "Splitpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphreducebackedges
|
|
msgid "Reduce backedges"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecalculatelay
|
|
msgid "Calculate layout from high-edge"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapecurved
|
|
msgid "Curved"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgesshape
|
|
msgid "Edges shape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
|
|
msgid "Edges split mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
|
|
msgid "Minimize edges len"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapenodes
|
|
msgid "Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphshapestraight
|
|
msgid "Straight"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
|
|
msgid "Merge at highest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
|
|
msgid "Merge at source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
|
|
msgid "Merge at target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitnone
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
|
|
msgid "None"
|
|
msgstr "Žádné"
|
|
|
|
#: lazarusidestrconsts.lvlgraphsplitseparate
|
|
msgid "Separate"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lvlgraphstraightengraph
|
|
msgid "Straighten graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterchanges
|
|
msgid "Changes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterfolding
|
|
msgid "Folding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispguttermarks
|
|
msgid "Marks"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutternocurrentlinecolor
|
|
msgid "No current line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterseparator
|
|
msgid "Separator"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
|
|
msgid "Use current line color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
|
|
msgid "Use current line number color"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr "Přidat jednotku balíčku do sekce uses"
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Přidat inverzi"
|
|
|
|
#: lazarusidestrconsts.rsaddnewterm
|
|
msgid "Add new term"
|
|
msgstr "Přidat novou položku"
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr "Atributy"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Automaticky zvyšovat číslo sestavení"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr "Zvýšeno pokaždé, když je projekt přeložen."
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "&Build:"
|
|
msgstr "&Sestavení:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Mapa znaků:"
|
|
|
|
#: lazarusidestrconsts.rscloseall
|
|
msgid "Close all pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
#, fuzzy
|
|
#| msgid "Close current page"
|
|
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
|
|
msgstr "Zavřít aktuální stránku"
|
|
|
|
#: lazarusidestrconsts.rscloseleft
|
|
msgid "Close page(s) on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseothers
|
|
msgid "Close other page(s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rscloseright
|
|
msgid "Close page(s) on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Podmíněné definice"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Vytvořit novou definici"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Povolit i18n"
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
#, fuzzy
|
|
#| msgid "Filter the lines in list with a string"
|
|
msgid "Filter the lines in list with a string (Ctrl+F)"
|
|
msgstr "Filtrovat řádky v seznamu s řetězcem"
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found but not listed here: "
|
|
msgstr "Nalezeno, ale zde nevypsáno: "
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr "Vyloučeno"
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
|
|
msgid "Force update PO files on next build"
|
|
msgstr "Vynutit aktualizaci PO souborů při dalším sestavení"
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr "Identifikátory:"
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Nastavení i18n"
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr "Původní:"
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr "Informace o verzi je uloženo pokud to formát spustitelného podporuje."
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include version info in executable"
|
|
msgstr "Zahrnout informaci o verzi ve spustitelném souboru"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Nastavení jazyka"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Výběr jazyka:"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr "&Hlavní verze:"
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr "Ve&dlejší verze:"
|
|
|
|
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
|
|
msgid "New search with same criteria (Ctrl+N)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Jiné informace"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "Výstupní adresář pro PO:"
|
|
|
|
#: lazarusidestrconsts.rsrefreshthesearch
|
|
msgid "Refresh the search (F5)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr "Zdroj"
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr "Vymazat všechny zdroje?"
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgctxt "lazarusidestrconsts.rsresourcefilename"
|
|
msgid "File name"
|
|
msgstr "Jméno souboru"
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Typ"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr "&Revize:"
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr "Vybrat zděděnou položku"
|
|
|
|
#: lazarusidestrconsts.rsshowabspath
|
|
msgid "Absolute path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowfilename
|
|
#, fuzzy
|
|
msgctxt "lazarusidestrconsts.rsshowfilename"
|
|
msgid "File name"
|
|
msgstr "Jméno souboru"
|
|
|
|
#: lazarusidestrconsts.rsshowpathmode
|
|
msgid "Path display mode (Ctrl+P)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsshowrelpath
|
|
msgid "Relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Číslování verze"
|
|
|
|
#: lazarusidestrconsts.showoptions
|
|
msgid "Show options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Příkazy nabídky Nápověda"
|
|
|
|
#: lazarusidestrconsts.srkmcatclipboard
|
|
msgid "Clipboard commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Příkazové příkazy"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "Příkazy CodeTools"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr "Příkazy výběru textových sloupců"
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Příkazy přesunu ukazatele"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Příkazy úpravy textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Příkazy nabídky Soubor"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr "Příkazy skládání textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatlinewrap
|
|
msgid "Line wrapping"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makra"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
msgid "Text bookmark commands"
|
|
msgstr "Příkazy záložek textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr "Více-vsuvkové příkazy"
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Příkazy nabídky Balíček"
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Příkazy nabídky Projekt"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Příkazy nabídky Spustit"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Příkazy hledání a nahrazení textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Příkazy výběru textu"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Příkazy zdrojového zápisníku"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr "Editování Syncron"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr "Úpravy Syncron (ne v buňce)"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr "Úpravy Syncron (při výběru)"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr "Editování šablony"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr "Úprava šablony (ne v buňce)"
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Příkazy nabídky Nástroje"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Zobrazit příkazy nabídky"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Příkaz:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Konflikt "
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "přerušit sestavení"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr "Abstraktní metody ..."
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr "přidat adresu bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr "přidat zdroj bodu přerušení"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr "přidat data/kukátko"
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
msgid "Add Jump Point"
|
|
msgstr "Přidat bod skoku"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "přidat sledování"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr "Připojit k programu"
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Dokončování šablon kódu"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr "Kopírovat blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr "Vymazat blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr "Jdi na začátek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr "Jít na konec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr "Skrýt blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
#, fuzzy
|
|
#| msgid "Indent block"
|
|
msgid "Indent line/block"
|
|
msgstr "Odsadit blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindentmove
|
|
msgid "Indent line/block (move columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr "Přesunout blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr "Nastavit začátek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr "Nastavit konec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr "Ukázat blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr "Přepnout blok"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
#, fuzzy
|
|
#| msgid "Unindent block"
|
|
msgid "Unindent line/block"
|
|
msgstr "Vrátit odsazení bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindentmove
|
|
msgid "Unindent line/block (move columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbreakpointproperties
|
|
msgid "show breakpoint properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "sestavit program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "sestavit soubor"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Sestavit lazarus"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr "sestavit mnoho režimů"
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Znak"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr "vyčistit a sestavit"
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Odstranit celý text"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr "Vyčistit všechny záložky"
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr "Vyčistit záložky pro aktuální soubor"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr "Sloupec Vybrat dolů"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr "Sloupcový výběr do úplného konce"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr "Sloupcový výběr do úplného začátku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr "Sloupec Vybrat vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr "Sloupec Vybrat ke konci řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr "Sloupce Vybrat k začátku řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr "Sloupce Vybrat k začátku v řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr "Sloupec Vybrat k spodku stránky"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr "Sloupec Vybrat spodek stránky"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr "Sloupec Vybrat vrch stránky"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr "Sloupec Vybrat stránku nahoru"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr "Sloupec Vybrat vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr "Sloupec Vybrat nahoru"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr "Sloupec Vybrat slovo vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr "Sloupec Vybrat slovo vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockmoveleft
|
|
msgid "Move column-block left (delete before columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockmoveright
|
|
msgid "Move column-block right (delete after columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockshiftleft
|
|
msgid "Shift column-block left (delete in columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnblockshiftright
|
|
msgid "Shift column-block right (delete in columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Režim výběru sloupce"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr "přeložit program/projekt"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "konfigurační soubor sestavení"
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Kopírovat"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyadd
|
|
msgid "Copy to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyaddcurrentline
|
|
msgid "Copy current line to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopycurrentline
|
|
msgid "Copy current line to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr "Kopírovat editor do nového okna"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr "Kopírovat editor do dalšího volného okna"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr "Kopírovat editor do předešlého volného okna"
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Vyjmout"
|
|
|
|
#: lazarusidestrconsts.srkmeccutadd
|
|
msgid "Cut to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutaddcurrentline
|
|
msgid "Cut current line to clipboard (append)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeccutcurrentline
|
|
msgid "Cut current line to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Odstranit k začátek řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Odstranit znak na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Smazat ke konci řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Odstranit poslední znak"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Odstranit k začátku slova"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Odstranit aktuální řádek"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelinekeepx
|
|
msgid "Delete current line (keep X pos)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Odstranit ke konci slova"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr "Odpojit od programu"
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Rozdíl"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr "Přesunout kurzor dolů"
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateline
|
|
msgid "Duplicate line (or lines in selection)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecduplicateselection
|
|
msgid "Duplicate selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Přesunout ukazatel na úplný konec"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Přesunout ukazatel na úplný začátek"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr "Prázdné metody ..."
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr "Volby IDE"
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "vyhodnocení/upravení"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Rozbalit proceduru"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
#, object-pascal-format
|
|
msgid "External tool %d"
|
|
msgstr "Vnější nástroj %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Nastavení vnějších nástrojů"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
msgid "Find Text"
|
|
msgstr "Najít text"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Najít další konec bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Najít začátek bloku"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
msgid "Find Declaration"
|
|
msgstr "Najít deklaraci"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find Identifier References"
|
|
msgstr "Najít použití identifikátoru"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
msgid "Find in Files"
|
|
msgstr "Najít v souborech"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Najít další"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Najít další výskyt slova"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr "Najít přetížené"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr "Najít přetížené ..."
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
msgid "Find Previous"
|
|
msgstr "Najít předchozí"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Najít předchozí výskyt slova"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Najít definic procedury"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
msgid "Find Procedure Method"
|
|
msgstr "Najít metodu procedury"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr "Svinout na pozici ukazatele"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
#, object-pascal-format
|
|
msgid "Fold to Level %d"
|
|
msgstr "Svinout do úrovně %d"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldtoggle
|
|
msgid "Toggle Fold at Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
#, object-pascal-format, fuzzy
|
|
#| msgid "Go to editor %d"
|
|
msgid "Go to source editor %d"
|
|
msgstr "Jít na editor %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Jít na direktivu include aktuálního vloženého souboru"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
msgid "Go to Line Number"
|
|
msgstr "Jít na číslo řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
#, object-pascal-format
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Přejít na záložku %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Jít na XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Hádat chybně umístěné $IFDEF"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr "Posunout kurzor část slova vlevo (např. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr "Posunout kurzor část slova vpravo (např. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Vložit položku ZáznamZměn"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Vložit z mapy znaků"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Vložit klíčové slovo CVS Autor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Vložit klíčové slovo CVS Date"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Vložit klíčové slovo CVS Header"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Vložit klíčové slovo CVS ID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Vložit klíčové slovo CVS Log"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Vložit klíčové slovo CVS Name"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Vložit klíčové slovo CVS Revision"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Vložit klíčové slovo CVS Source"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Vložit aktuální datum a čas"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr "Vložit plné jméno souboru"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Vložit GPL poznámku"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr "Vložit GPL poznámku (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Vložit GUID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Vložit LGPL poznámku"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr "Vložit LGPL poznámku (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Ukončit řádek a nechat kurzor"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr "Vložit MIT poznámku"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr "Vložit MIT poznámku (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Režim vkládání"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Vložit upravenou LGPL poznámku"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr "Vložit upravenou LGPL poznámku (přeloženo)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Vložit aktuální jméno uživatele"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "zkoumat"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Převrátit přiřazení"
|
|
|
|
#: lazarusidestrconsts.srkmecjumptonextsearchresult
|
|
msgid "Jump to next search result"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecjumptoprevsearchresult
|
|
msgid "Jump to previous search result"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "Vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "Vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr "Přesunout kurzor vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Ukončit řádek a přesunout kurzor"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Přesunout ukazatel na konec řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Režim výběru řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Přesunout ukazatel na začátek řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr "Přesunout ukazatel na začátek textu v řádku"
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr "Uzamknout editor"
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
msgid "Make Resource String"
|
|
msgstr "Vytvořit zdrojový řetězec"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Přejít na odpovídající závorku"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Přesunout editor doleva"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Přesunout editor zcela vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr "Přesunout editor do nového okna"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr "Přesunout editor do dalšího prázdného okna"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr "Přesunout editor do předešlého volného okna"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Přesunout editor doprava"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Přesunout editor zcela vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecmovelinedown
|
|
msgid "Move line down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmovelineup
|
|
msgid "Move line up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectdown
|
|
msgid "Move selection down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectleft
|
|
msgid "Move selection left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectright
|
|
msgid "Move selection right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmoveselectup
|
|
msgid "Move selection up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "VíceVkládání"
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Další značka"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Přejít na další editor"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr "Jít na další editor v historii"
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr "Jít na další editor se stejným Zdrojem"
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr "Jít na další okno"
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Režim normálního výběru"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
msgid "Open File at Cursor"
|
|
msgstr "Otevřít soubor na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Režim přepisu"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Přesunout ukazatel na spodek stránky"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Přesunout ukazatel o stránku níže"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Přesunout kurzor o stranu vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Přesunout kurzor o stranu vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Přesunout ukazatel o začátek stránky"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Přesunout ukazatel o jednu stránku výše"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Vložit"
|
|
|
|
#: lazarusidestrconsts.srkmecpasteascolumns
|
|
msgid "Paste (as Columns)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "pozastavit program"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr "Vyčistit všechny stříšky navíc"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr "Kurzorové klávesy mažou všechny dodatečné vsuvky"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr "Kurzorové klávesy přesouvají všechny dodatečné vsuvky"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr "Přidat další vsuvku"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr "Přepnout dodatečnou vsuvku"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr "Odstranit dodatečnou vsuvku"
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Předchozí značka"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Přejít na předchozí editor"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr "Jít na předchozí editor v historii"
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr "Jít na předchozí editor se stejným Zdrojem"
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr "Jít na předchozí okno"
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "rychlý překlad, bez spojení"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
msgid "remove breakpoint"
|
|
msgstr "odebrat bod přerušení"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Odebrat prázdné metody"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr "Odebrat nepoužívané jednotky"
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Přejmenovat identifikátor"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
msgid "Replace Text"
|
|
msgstr "Nahradit text"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
|
msgid "Reporting a bug"
|
|
msgstr "Hlášení závady"
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "resetovat ladič"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr "Přesunout kurzor vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "spustit program"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "spustit soubor"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "spustit s parametry"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithdebugging
|
|
msgid "run with debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr "spustit bez ladění"
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Rolovat dolů o jeden řádek"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Rolovat vlevo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Rolovat vpravo o jeden znak"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Rolovat nahoru o jeden řádek"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Vybrat dolní"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Vybrat vše"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Převést ve výběru tabulátory na mezery"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Vybrat po úplný konec"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Vybrat po úplný začátek"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Vybrat Goto XY"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr "Vybrat část slova vlevo (např. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr "Vybrat část slova vpravo (např. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "Select Left"
|
|
msgstr "Vybrat vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Vybrat konec řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Vybrat začátek řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr "Vybrat k začátku text v řádku"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Vybrat spodek stránky"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Vybrat stránku dole"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Vybrat stránku vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Vybrat stránku vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Vybrat vrch stránky"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Vybrat stránku nahoře"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "Select Right"
|
|
msgstr "Vybrat vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordleft
|
|
msgid "Smart select word left (start/end of word)"
|
|
msgstr "Chytře vybrat slovo nalevo (začátek/konec slova)"
|
|
|
|
#: lazarusidestrconsts.srkmecselsmartwordright
|
|
msgid "Smart select word right (start/end of word)"
|
|
msgstr "Chytře vybrat slovo napravo (začátek/konec slova)"
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr "Začít lepicí výběr"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr "Začít lepicí výběr (sloupcový)"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr "Začít lepicí výběr (řádkový)"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr "Ukončit lepicí výběr"
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Vybrat nahoru"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr "Vybrat do konce slova vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr "Vybrat do konce slova vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Vybrat slovo nalevo"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Vybrat slovo napravo"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Nastavit volnou Záložku"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, object-pascal-format
|
|
msgid "Set bookmark %d"
|
|
msgstr "Nastavit záložku %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift Tab"
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Ukázat abstraktní metody"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show Code Context"
|
|
msgstr "Ukázat obsah kódu"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr "ukázat bod vykonávání"
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordleft
|
|
msgid "Smart move cursor left (start/end of word)"
|
|
msgstr "Chytře posunout kurzor doleva (začátek/kone slova)"
|
|
|
|
#: lazarusidestrconsts.srkmecsmartwordright
|
|
msgid "Smart move cursor right (start/end of word)"
|
|
msgstr "Chytře posunout kurzor doprava (začátek/konec slova)"
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "zastavit program"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr "Přehrát makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr "Nahrát makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapcolsellineend
|
|
msgid "Column Select to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapcolsellinestart
|
|
msgid "Column Select to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewraplineend
|
|
msgid "Move cursor to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewraplinestart
|
|
msgid "Move cursor to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapsellineend
|
|
msgid "Select to wrapped line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynplinewrapsellinestart
|
|
msgid "Select to wrapped line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
|
|
msgid "Add Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
|
|
msgid "Add Cell (case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
|
|
msgid "Add Cell (context-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
|
|
msgid "Add Cell (context & case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Jít na poslední pozici v buňce"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Jít na první pozici v buňce"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr "Vybrat buňku"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
|
|
msgid "Remove current Cell"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr "Odejít"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
|
|
msgid "Grow cell on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
|
|
msgid "Grow cell on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Další buňka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Další buňka (všechny vybrané)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Další buňka (pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Další buňka (všechny vybrané / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Předchozí buňka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Předchozí buňka (všechny vybrané)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Předchozí buňka (pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Předchozí buňka (všechny vybrané / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
|
|
msgid "Shrink cell on the left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
|
|
msgid "Shrink cell on the right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr "Spustit editor Syncro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
|
|
msgid "Start Syncro edit (case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
|
|
msgid "Start Syncro edit (context-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
|
|
msgid "Start Syncro edit (context & case-sensitive)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Přejít na poslední pozici v buňce"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Přejít na první pozici v buňce"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr "Vybrat buňku"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr "Odejít"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr "Dokončit"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Další buňka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr "Další buňka (rotace)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Další buňka (všechny vybrané)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr "Další buňka (rotace / všechny vybrané)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Další buňka (pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr "Další buňka (kruhově / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Další buňka (všechny vybrané / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr "Další buňka (kruhově / všechny vybrané / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Předchozí buňka"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Předchozí buňka (všechny vybrané)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Předchozí buňka (pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Předchozí buňka (všechny vybrané / pouze první)"
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
msgid "Syntax Check"
|
|
msgstr "Kontrola syntaxe"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr "Zobrazit assembler"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr "prohodit bod přerušení"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpointenabled
|
|
msgid "enable/disable breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Zobrazit body zastavení"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Zobrazit volací zásobník"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Zobrazit prohlížeč kódu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Zobrazit průzkumník kódu"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Zobrazit sadu komponent"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Zobrazit výstup ladícího nástroje"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Přepnout mezi formulářem a jednotkou"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Zobrazit editor dokumentace"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Zobrazit rychlá tlačítka IDE"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Zobrazit místní proměnné"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
#, object-pascal-format
|
|
msgid "Toggle bookmark %d"
|
|
msgstr "Přepnout záložku %d"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr "Prohodit zvýraznění aktuálního slova"
|
|
|
|
#: lazarusidestrconsts.srkmectogglememviewer
|
|
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
|
|
msgid "View Mem viewer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Zobrazit hlášení"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Přepnout režim"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Zobrazit inspektor objektů"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr "Zobrazit registry"
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Zobrazit prohlížeč omezení"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Zobrazit výsledky hledání"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Zobrazit editor zdrojů"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Zobrazit sledovače"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Rozevřít vše"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr "Rozevřít na pozici ukazatele"
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "neznámý příkaz editoru"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr "Nepoužité jednotky ..."
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr "Přesunout kurzor nahoru"
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Zobrazit editor kotev"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Zobrazit komponenty"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr "Zobrazit makra editoru"
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Zobrazit formuláře"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr "Ukázat historii"
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View console in/output"
|
|
msgstr "Zobrazit konzoli vstup/výstup"
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr "Ukázat pořadí záložek"
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Ukázat vlákna"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Zobrazit závislosti jednotky"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Zobrazit informace o jednotkách"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Zobrazit jednotky"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word Completion"
|
|
msgstr "Doplnění slova"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr "Posunout kurzor na konec slova vlevo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr "Posunout kurzor na konec slova vpravo"
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Přesunout ukazatel o slovo doleva"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Přesunout ukazatel o slovo doprava"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr "Přiblížit"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr "Oddálit"
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr "Upravit klávesy povelů"
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr "Pokračovat s další akcí uvolnění tlačítka myši"
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr "Složit komentáře"
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr "Zabalit komentáře ve výběru"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr "Složit neaktivní Ifdef"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr "Složit neaktivní Ifdef (vyloučit smíšený stav)"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr "Složit neaktivní Ifdef ve výběru"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr "Složit neaktivní IfDef ve výběru (vyloučit smíšený stav)"
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr "Skrýt komentáře"
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr "Skrýt komentáře ve výběru"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr "Srovnat akci tlačítka s tlačítkem myši dolů"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr "Srovnat akci řádku s tlačítkem myši dolů"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr "Srovnat akci úprav s tlačítkem myši dolů"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr "Srovnat akci pozice s tlačítkem myši dolů"
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr "Hledat všechny akce kliknutí myši"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr "Rozložit aktivní IfDef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr "Rozložit aktivní Ifdef ve výběru"
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Rozevřít vše"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr "Rozložit všechny Ifdef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr "Rozložit všechny Ifdef ve výběru"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr "Rozbalit všechny komentáře ve výběru"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr "Rozložit komentáře"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr "Rozbalit komentáře ve výběru"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr "Rozložit neaktivní Ifdef"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr "Rozložit neaktivní Ifdef ve výběru"
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Soubor je pouze ke čtení"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Soubor \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" není zapisovatelný."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr "Zamknutý"
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr "Nahrávání"
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr "Pozastavit"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Přidat &Sledování v místě kurzoru"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr "Přidat kukátko na kurzor"
|
|
|
|
#: lazarusidestrconsts.uembookmarknset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s: %s"
|
|
msgstr "Záložka &%s: %s"
|
|
|
|
#: lazarusidestrconsts.uembookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Bookmark &%s"
|
|
msgstr "Záložka &%s"
|
|
|
|
#: lazarusidestrconsts.uembookmarknunsetdisabled
|
|
#, object-pascal-format
|
|
msgid "Bookmark %s"
|
|
msgstr "Záložka %s"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr "Zavřít všechny &ostatní stránky"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesplain
|
|
msgid "Close All Other Pages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesright
|
|
msgid "Close Pages on the &Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpagesrightplain
|
|
msgid "Close Pages on the Right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Zavřít stránku"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
msgid "Copy Filename"
|
|
msgstr "Zkopírovat název souboru"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr "Klonovat do nového okna"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr "Klonovat do jiného Okna"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Nové okno"
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Ladění"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Kódování"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr "&Vyhodnocení/Upravení ..."
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Najít deklaraci"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr "Najít v ostatních oknech"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Skok na značku"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmarks
|
|
msgid "Goto Bookmark ..."
|
|
msgstr "Skok na značku ..."
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Zvýrazňovač"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "&Zkoumat ..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Převrátit přiřazení"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr "Konec řádku"
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr "&Uzamknout stránku"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr "Přesunout stránku doleva"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr "Přesunout stránku nejvíce doleva"
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr "Přesunout stránku doprava"
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr "Přesunout stránku nejvíce doprava"
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr "Přesunout do nového Okna"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr "Přesunout do jiného Okna"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Nové okno"
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Přejít na další záložku"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Změněný"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Otevřít soubor na pozici kurzoru"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Přejít na předchozí záložku"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Skok procedury"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Přepracování"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Zobrazovat čísla řádků"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Zdroj"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr "&Přepnout záložku"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s: %s"
|
|
msgstr "Přepnout záložku &%s: %s"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarknunset
|
|
#, object-pascal-format
|
|
msgid "Toggle Bookmark &%s"
|
|
msgstr "Přepnout záložku &%s"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmarks
|
|
msgid "Toggle Bookmark ..."
|
|
msgstr "Přepnout záložku ..."
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr "Přepnout záložku"
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Zobrazit volací zásobník"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Doposud neimplementováno"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "VLO"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "PŘE"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Pouze pro čtení"
|
|
|
|
#: lazarusidestrconsts.uepselchars
|
|
#, object-pascal-format
|
|
msgid "%d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselcol
|
|
msgid "COL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselcxchars
|
|
#, object-pascal-format
|
|
msgid "%d * %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.uepselline
|
|
#, fuzzy
|
|
#| msgid "Line"
|
|
msgctxt "lazarusidestrconsts.uepselline"
|
|
msgid "LINE"
|
|
msgstr "Řádek"
|
|
|
|
#: lazarusidestrconsts.uepselnorm
|
|
msgid "DEF"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforpackage
|
|
msgid "Options for Package graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.unitdepoptionsforunit
|
|
msgid "Options for Unit graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Informace o verzi"
|
|
|