mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-02-25 05:08:23 +01:00
11317 lines
360 KiB
Plaintext
11317 lines
360 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Last-Translator: Laurent Jacques <wile64@gmail.com>\n"
|
||
"PO-Revision-Date: 2008-09-04 08:57+0100\n"
|
||
"Language-Team: français\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Generator: KBabel 1.10.2\n"
|
||
"Project-Id-Version: lazaruside\n"
|
||
"MIME-Version: 1.0\n"
|
||
"POT-Creation-Date: \n"
|
||
|
||
#: lazarusidestrconsts:srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " commande 1 \""
|
||
|
||
#: lazarusidestrconsts:srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " commande 2 \""
|
||
|
||
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Le raccourci %s%s%s existe déjà"
|
||
|
||
#: lazarusidestrconsts:srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr "La touche \"%s\" est déjà associée à la commande \"%s\"."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr " Le répertoire de sortie devrait être un répertoire séparé et ne doit contenir aucun des fichiers sources."
|
||
|
||
#: lazarusidestrconsts:srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " en conflit avec "
|
||
|
||
#: lazarusidestrconsts:liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (compilation ...)"
|
||
|
||
#: lazarusidestrconsts:lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (débogage ...)"
|
||
|
||
#: lazarusidestrconsts:liscovarious
|
||
msgid "%s (various)"
|
||
msgstr "%s (divers)"
|
||
|
||
#: lazarusidestrconsts:lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "%s - (nouveau projet)"
|
||
|
||
#: lazarusidestrconsts:lislazarusversionstring
|
||
msgid "%s beta"
|
||
msgstr "%s beta"
|
||
|
||
#: lazarusidestrconsts:lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s octets"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "répertoire %s"
|
||
|
||
#: lazarusidestrconsts:lisdoesnotexists
|
||
msgid "%s does not exists: %s"
|
||
msgstr "%s n'existe pas: %s"
|
||
|
||
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr "%s ne dispose d'aucun chemin d'accès LazDoc valide.%sImpossible de créer le fichier pour fpdoc %s"
|
||
|
||
#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
||
msgstr "%s est %s.%s Ce cercle de dépendance n'est pas autorisée."
|
||
|
||
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s fait déjà partie du projet"
|
||
|
||
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr "%s est une classe abstraite, il a %s méthodes abstraites."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "%s répertoire de projet"
|
||
|
||
#: lazarusidestrconsts:lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr "%s unité %s dans le paquet %s%s"
|
||
|
||
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s n'est pas un nom de projet valide.%sVeuillez en choisir un autre (ex: project1.lpi)"
|
||
|
||
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s n'est pas un identificateur valide."
|
||
|
||
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s n'est pas un nom d'unité valide."
|
||
|
||
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sCliquez sur OK si vous en êtes sûr"
|
||
|
||
#: lazarusidestrconsts:lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sNom de fichier : %s%s%"
|
||
|
||
#: lazarusidestrconsts:lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sImpossible de changer la classe de %s à %s"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sNom d'unité : %s%s%"
|
||
|
||
#: lazarusidestrconsts:lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Page : %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, généré automatiquement"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "%s, spécifique au projet"
|
||
|
||
#: lazarusidestrconsts:lisuereadonly
|
||
msgid "%s/ReadOnly"
|
||
msgstr "%s/Lecture seule"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sAjout d'une nouvelle dépendance pour le paquet %s: paquet %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sAjout d'une nouvelle dépendance pour le projet %s: paquet %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sLes deux paquets sont connectés. Soit l'un des paquets utilise l'autre, ou les deux sont utilisés par un troisième paquet."
|
||
|
||
#: lazarusidestrconsts:lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sDescription : %s"
|
||
|
||
#: lazarusidestrconsts:lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%sFichier existant : %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sVoir Projet -> Inspecteur de Projet"
|
||
|
||
#: lazarusidestrconsts:lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sEtat : "
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sL'unité suivante sera ajoutée à la liste USES de%s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%s Ce paquet est installé, mais le fichier lpk est introuvable"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sCe paquet a été créé automatiquement"
|
||
|
||
#: lazarusidestrconsts:lisnone
|
||
msgid "%snone"
|
||
msgstr "%s aucun "
|
||
|
||
#: lazarusidestrconsts:liswladd
|
||
msgid "&Add"
|
||
msgstr "&Ajouter"
|
||
|
||
#: lazarusidestrconsts:uemaddbreakpoint
|
||
msgid "&Add Breakpoint"
|
||
msgstr "&Ajouter un point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr "&Recherche en arrière"
|
||
|
||
#: lazarusidestrconsts:dlgcasesensitive
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Sensible à la casse"
|
||
|
||
#: lazarusidestrconsts:lisfindfilecasesensitive
|
||
msgid "&Case sensitive"
|
||
msgstr "&Sensible à la casse"
|
||
|
||
#: lazarusidestrconsts:lisclose
|
||
msgid "&Close"
|
||
msgstr "&Fermer"
|
||
|
||
#: lazarusidestrconsts:uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Fermer la page"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Composants"
|
||
|
||
#: lazarusidestrconsts:liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Supprimer"
|
||
|
||
#: lazarusidestrconsts:lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr "&Supprimer tout"
|
||
|
||
#: lazarusidestrconsts:lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Edition"
|
||
|
||
#: lazarusidestrconsts:lisenableall
|
||
msgid "&Enable All"
|
||
msgstr "&Activer tout"
|
||
|
||
#: lazarusidestrconsts:liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Activer"
|
||
|
||
#: lazarusidestrconsts:dlgentirescope
|
||
msgid "&Entire Scope"
|
||
msgstr "Portée &entière"
|
||
|
||
#: lazarusidestrconsts:lismenufile
|
||
msgid "&File"
|
||
msgstr "&Fichier"
|
||
|
||
#: lazarusidestrconsts:lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "&Chercher"
|
||
|
||
#: lazarusidestrconsts:uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Chercher la déclaration"
|
||
|
||
#: lazarusidestrconsts:dlgfromcursor
|
||
msgid "&From Cursor"
|
||
msgstr "&Depuis le curseur"
|
||
|
||
#: lazarusidestrconsts:dlgglobal
|
||
msgid "&Global"
|
||
msgstr "&Global"
|
||
|
||
#: lazarusidestrconsts:uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Aller au signet"
|
||
|
||
#: lazarusidestrconsts:lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Aide"
|
||
|
||
#: lazarusidestrconsts:lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr "Shéma Multi-ligne"
|
||
|
||
#: lazarusidestrconsts:lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Objets"
|
||
|
||
#: lazarusidestrconsts:lisok
|
||
msgid "&Ok"
|
||
msgstr "&OK"
|
||
|
||
#: lazarusidestrconsts:uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "&Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts:lismenupackage
|
||
msgid "&Package"
|
||
msgstr "Pa&quet"
|
||
|
||
#: lazarusidestrconsts:lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Projet"
|
||
|
||
#: lazarusidestrconsts:dlgpromptonreplace
|
||
msgid "&Prompt On Replace"
|
||
msgstr "&Confirmer les remplacements"
|
||
|
||
#: lazarusidestrconsts:liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Propriétés"
|
||
|
||
#: lazarusidestrconsts:dlgregularexpressions
|
||
msgid "&Regular Expressions"
|
||
msgstr "&Expressions régulières"
|
||
|
||
#: lazarusidestrconsts:lisfindfileregularexpressions
|
||
msgid "&Regular expressions"
|
||
msgstr "&Expressions régulières"
|
||
|
||
#: lazarusidestrconsts:rsremove
|
||
msgid "&Remove"
|
||
msgstr "&Retirer"
|
||
|
||
#: lazarusidestrconsts:lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr "&Remplacer"
|
||
|
||
#: lazarusidestrconsts:dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "&Remplacer par"
|
||
|
||
#: lazarusidestrconsts:lismenurun
|
||
msgid "&Run"
|
||
msgstr "E&xécuter"
|
||
|
||
#: lazarusidestrconsts:uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Exécuter jusqu'au curseur"
|
||
|
||
#: lazarusidestrconsts:lismenusearch
|
||
msgid "&Search"
|
||
msgstr "&Chercher"
|
||
|
||
#: lazarusidestrconsts:dlgselectedtext
|
||
msgid "&Selected Text"
|
||
msgstr "&Texte sélectionné"
|
||
|
||
#: lazarusidestrconsts:uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "&Ajouter un signet"
|
||
|
||
#: lazarusidestrconsts:lissourcebreakpoint
|
||
msgid "&Source breakpoint"
|
||
msgstr "Point d'arrêt &source"
|
||
|
||
#: lazarusidestrconsts:dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "&Texte à trouver"
|
||
|
||
#: lazarusidestrconsts:lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Outils"
|
||
|
||
#: lazarusidestrconsts:lismenuview
|
||
msgid "&View"
|
||
msgstr "&Voir"
|
||
|
||
#: lazarusidestrconsts:lismenuviewsource
|
||
msgid "&View Source"
|
||
msgstr "&Afficher le source"
|
||
|
||
#: lazarusidestrconsts:dlgwholewordsonly
|
||
msgid "&Whole Words Only"
|
||
msgstr "&Mots entiers seulement"
|
||
|
||
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr "&Mots entiers seulement"
|
||
|
||
#: lazarusidestrconsts:lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "Fe&nêtre "
|
||
|
||
#: lazarusidestrconsts:liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Filtre)"
|
||
|
||
#: lazarusidestrconsts:lisfilter2
|
||
msgid "(filter)"
|
||
msgstr "(Filtre)"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr "(pas de description hérité trouvés)"
|
||
|
||
#: lazarusidestrconsts:dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(pas de sous-dossier)"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnodocumentation
|
||
msgid "(none)"
|
||
msgstr "<Aucun>"
|
||
|
||
#: lazarusidestrconsts:listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(macro inconnue: %s)"
|
||
|
||
#: lazarusidestrconsts:lisplistall
|
||
msgid "<All>"
|
||
msgstr "<Tout>"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<NONE>"
|
||
|
||
#: lazarusidestrconsts:lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<Aucun>"
|
||
|
||
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<choisir un fichier existant>"
|
||
|
||
#: lazarusidestrconsts:lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts:lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts:lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
|
||
#: lazarusidestrconsts:lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<aucune variable choisie>"
|
||
|
||
#: lazarusidestrconsts:lisoff
|
||
msgid "? (Off)"
|
||
msgstr "? (Off)"
|
||
|
||
#: lazarusidestrconsts:lison
|
||
msgid "? (On)"
|
||
msgstr "? (On)"
|
||
|
||
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "Un %s ne peut contenir TControls.%sVous pouvez seulement y mettre des composants non visuels."
|
||
|
||
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Le fichier %s%s%s existe déjà. %Le remplacer ?"
|
||
|
||
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Un paquet requis n'a pas été trouvé. Voir le graphique des paquets."
|
||
|
||
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Un simple fichier programme en pascal. %sCela peut être utilisé pour un essai rapide. %sCréez plutôt un nouveau projet."
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Un outil a besoin au minimum d'un titre et d'un nom de fichier."
|
||
|
||
#: lazarusidestrconsts:lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr "Annuler les changements ?"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildmakeabort
|
||
msgid "Abort"
|
||
msgstr "Abandon"
|
||
|
||
#: lazarusidestrconsts:lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Arrêter la construction"
|
||
|
||
#: lazarusidestrconsts:lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Arrêter tout"
|
||
|
||
#: lazarusidestrconsts:lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Arrêter tous les chargements"
|
||
|
||
#: lazarusidestrconsts:liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Arrêter le construction"
|
||
|
||
#: lazarusidestrconsts:lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Arrêter le chargement du projet"
|
||
|
||
#: lazarusidestrconsts:lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Arrêter tous les chargements"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildabort
|
||
msgid "Aborted..."
|
||
msgstr "Abandonner..."
|
||
|
||
#: lazarusidestrconsts:lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "A propos"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "A propos de Lazarus"
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract methods - not yet overridden"
|
||
msgstr "Méthodes abstraites- pas encore surchargé"
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr "Méthodes abstraite de %s"
|
||
|
||
#: lazarusidestrconsts:lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Accepter"
|
||
|
||
#: lazarusidestrconsts:lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Remerciements"
|
||
|
||
#: lazarusidestrconsts:lislazbuildaboaction
|
||
msgid "Action"
|
||
msgstr "Action"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Action : %s"
|
||
|
||
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Activer la syntaxe d'expression régulière pour du texte et remplacement (très semblable à perl)"
|
||
|
||
#: lazarusidestrconsts:liscodetempladd
|
||
msgid "Add"
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts:lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Ajouter %s au projet?"
|
||
|
||
#: lazarusidestrconsts:uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Ajouter &suivi sous curseur"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Ajouter un fichier"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Ajouter des fichiers"
|
||
|
||
#: lazarusidestrconsts:rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Ajouter inverse"
|
||
|
||
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "Ajouter les fichiers LFM et LRS, s'ils existent."
|
||
|
||
#: lazarusidestrconsts:lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Ajouter l'unité"
|
||
|
||
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "Ajouter l'unité active au projet"
|
||
|
||
#: lazarusidestrconsts:liskmaddactiveunittoproject
|
||
msgid "Add active unit to project"
|
||
msgstr "Ajouter l'unité active au projet"
|
||
|
||
#: lazarusidestrconsts:lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Ajouter un élément"
|
||
|
||
#: lazarusidestrconsts:dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr "Ajouter opérateur d'assignement :="
|
||
|
||
#: lazarusidestrconsts:liskmaddbreakpoint
|
||
msgid "Add break point"
|
||
msgstr "Ajouter un point d'arrêt "
|
||
|
||
#: lazarusidestrconsts:lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr "Ajouter un point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Ajouter modèle de code"
|
||
|
||
#: lazarusidestrconsts:lisadddirectory
|
||
msgid "Add directory"
|
||
msgstr "Ajouter un répertoire"
|
||
|
||
#: lazarusidestrconsts:lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "Ajouter le fichier de l'éditeur au projet"
|
||
|
||
#: lazarusidestrconsts:lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Ajouter les fichiers de l'éditeur"
|
||
|
||
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "Ajouter un fichier au paquet"
|
||
|
||
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Ajouter un fichier au projet:"
|
||
|
||
#: lazarusidestrconsts:lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Ajouter les fichiers"
|
||
|
||
#: lazarusidestrconsts:lisaddfilesofdirectory
|
||
msgid "Add files of directory"
|
||
msgstr "Ajouter les fichiers au répertoire"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Ajouter les fichiers au paquet"
|
||
|
||
#: lazarusidestrconsts:srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "Ajouter un point de saut"
|
||
|
||
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "Ajouter le point de saut à l'historique"
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Ajouter un lien"
|
||
|
||
#: lazarusidestrconsts:lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr "Ajouter un lien à hérité"
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Ajouter les options aux paquets et projets dépendants"
|
||
|
||
#: lazarusidestrconsts:podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr "Ajouter l'unité paquet à la section Uses"
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Ajouter chemin"
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Ajouter les chemins aux paquets/projets dépendants"
|
||
|
||
#: lazarusidestrconsts:dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Ajouter un point-virgule"
|
||
|
||
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Ajouter aux propriétés favorites"
|
||
|
||
#: lazarusidestrconsts:lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Ajouter au paquet"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtoproject
|
||
msgid "Add to project"
|
||
msgstr "Ajouter au projet"
|
||
|
||
#: lazarusidestrconsts:lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr "Ajouter l'unité au chemin de recherche ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Ajouter une unité à la clause uses du paquet. Désactivez ceci seulement pour les unités qui ne seraient pas compilés dans tous les cas."
|
||
|
||
#: lazarusidestrconsts:liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Ajouter un suivi"
|
||
|
||
#: lazarusidestrconsts:lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr "Ajouter un suivi ..."
|
||
|
||
#: lazarusidestrconsts:dlgedadd
|
||
msgid "Add..."
|
||
msgstr "Ajouter"
|
||
|
||
#: lazarusidestrconsts:dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "Répertoire de recherche complémentaire pour tous les projets (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Options de compilation additionnelles héritées des paquets"
|
||
|
||
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Fichiers additionnels à chercher (i.e. /chemin/*.pas;/chemin2/*.pp)"
|
||
|
||
#: lazarusidestrconsts:rsadditionalinfo
|
||
msgid "Additional info"
|
||
msgstr "Information additionnelle"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Chemin de recherche additionnel"
|
||
|
||
#: lazarusidestrconsts:dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Ajuster la ligne supérieure au commentaire qui précède"
|
||
|
||
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
|
||
msgid "Advanced Build Options"
|
||
msgstr "Options de construction avancées"
|
||
|
||
#: lazarusidestrconsts:rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Afrique"
|
||
|
||
#: lazarusidestrconsts:fdmalignword
|
||
msgid "Align"
|
||
msgstr "Aligner"
|
||
|
||
#: lazarusidestrconsts:lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Alignement"
|
||
|
||
#: lazarusidestrconsts:lisemdall
|
||
msgid "All"
|
||
msgstr "Tout"
|
||
|
||
#: lazarusidestrconsts:lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Tous les fichiers"
|
||
|
||
#: lazarusidestrconsts:lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr "Tous les blocs sont ok."
|
||
|
||
#: lazarusidestrconsts:dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Tous les fichiers"
|
||
|
||
#: lazarusidestrconsts:lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Tous les paquets"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Tous les projets"
|
||
|
||
#: lazarusidestrconsts:lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr "Tous les tests ont réussi."
|
||
|
||
#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr "Toutes vos modifications %s%s%s%s seront perdus et le dossier réouvert."
|
||
|
||
#: lazarusidestrconsts:lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr "Autoriser les appels de fonctions"
|
||
|
||
#: lazarusidestrconsts:dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Autoriser LABEL et GOTO"
|
||
|
||
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Autoriser la recherche de lignes multiples"
|
||
|
||
#: lazarusidestrconsts:dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "Par ordre alphabétique"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolalt
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts:dlgaltsetclmode
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr "La touche Alt met en mode colonne"
|
||
|
||
#: lazarusidestrconsts:lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr "Touche alternative"
|
||
|
||
#: lazarusidestrconsts:lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr "Touche alternative (ou une séquence de 2 touches)"
|
||
|
||
#: lazarusidestrconsts:srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr "Touche alternative (ou combinaison de 2 touches)"
|
||
|
||
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
|
||
msgid "Always Build before Run"
|
||
msgstr "Toujours construire avant l'exécution"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Toujours construit (seulement si rien n'est changé)"
|
||
|
||
#: lazarusidestrconsts:dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr "Curseur toujours visible"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Type d'ancêtre ambigu"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Nom de classe ambigu"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Nom d'unité ambigu"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Unité ambigüe trouvée"
|
||
|
||
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Fichier litigieux de configuration additionnel du compilateur trouvé"
|
||
|
||
#: lazarusidestrconsts:lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr "Compilateur Ambigus"
|
||
|
||
#: lazarusidestrconsts:dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Action sur fichier litigieux :"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Fichier litigieux trouvé"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Fichier litigieux trouvé: %s%s%s%sCe fichier peut être confondu avec %s%s%s%s%sSupprimer le fichier litigieux ?"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Fichiers ambigus trouvés"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr "Unité ambigüe trouvée"
|
||
|
||
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Unités ambigüe trouvées"
|
||
|
||
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "Un erreur a lieu au précédent démarrage pendant le chargement %s!%s%sCharger ce projet à nouveau ?"
|
||
|
||
#: lazarusidestrconsts:lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Type d'ancêtre"
|
||
|
||
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Editeur d'ancre - aucune commande choisie"
|
||
|
||
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr "Ancre du côté inférieur du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr "Ancre du côté gauche de l'enfant du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr "Ancre du côté droit du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr "Ancre du côté supérieur du contrôle, préserver l'espace de bordure"
|
||
|
||
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr "Ancres des commandes sélectionner "
|
||
|
||
#: lazarusidestrconsts:lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Ajouter à la section"
|
||
|
||
#: lazarusidestrconsts:dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Application"
|
||
|
||
#: lazarusidestrconsts:dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "Paramètres de l'application"
|
||
|
||
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Application%sUn programme graphique LCL/FreePascal. Le fichier programme est automatiquement géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts:dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Appliquer"
|
||
|
||
#: lazarusidestrconsts:lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Appliquer les changements"
|
||
|
||
#: lazarusidestrconsts:rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Arabe"
|
||
|
||
#: lazarusidestrconsts:dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Réel"
|
||
|
||
#: lazarusidestrconsts:lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "Croissant"
|
||
|
||
#: lazarusidestrconsts:dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Demander"
|
||
|
||
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Demander avant de remplacer chaque texte trouvé"
|
||
|
||
#: lazarusidestrconsts:dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr "Style d'assembleur :"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "De"
|
||
|
||
#: lazarusidestrconsts:lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr "Auteur:"
|
||
|
||
#: lazarusidestrconsts:liscodetemplautocompleteon
|
||
msgid "Auto complete on ..."
|
||
msgstr "Auto complété sur ..."
|
||
|
||
#: lazarusidestrconsts:dlgautoform
|
||
msgid "Auto create form when opening unit"
|
||
msgstr "Créer la fiche automatiquement en ouvrant l'unité"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Les noeuds créés automatiquement ne peuvent pas être modifiés,%set ne peuvent pas avoir de sous-noeud non automatique"
|
||
|
||
#: lazarusidestrconsts:dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Supprimer le fichier auto."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "Les noeuds générés automatiquement ne peuvent pas être édités."
|
||
|
||
#: lazarusidestrconsts:dlgautoident
|
||
msgid "Auto indent"
|
||
msgstr "Indentation automatique"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "Reconstruction automatique quand on reconstruit tout"
|
||
|
||
#: lazarusidestrconsts:dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Renommer automatiquement les fichiers en minuscule"
|
||
|
||
#: lazarusidestrconsts:dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "Enregistrement automatique"
|
||
|
||
#: lazarusidestrconsts:lisautoshowobjectinspector
|
||
msgid "Auto show Object Inspector"
|
||
msgstr "Afficher automatiquement l'Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts:dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Fiches créées automatiquement:"
|
||
|
||
#: lazarusidestrconsts:lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "généré automatiquement"
|
||
|
||
#: lazarusidestrconsts:rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Automatique (ou anglais)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr "Dispositifs automatiques "
|
||
|
||
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr "Augmenter Automatiquement le numéro de construction"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Incrémenter la version automatiquement à la construction"
|
||
|
||
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Paquets installés automatiquement"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Reconstruire automatiquement au besoin"
|
||
|
||
#: lazarusidestrconsts:dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Fiches disponibles:"
|
||
|
||
#: lazarusidestrconsts:lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Paquets disponibles"
|
||
|
||
#: lazarusidestrconsts:dlgedback
|
||
msgid "Back"
|
||
msgstr "Retour"
|
||
|
||
#: lazarusidestrconsts:fdmorderbackone
|
||
msgid "Back one"
|
||
msgstr "Retour d'un"
|
||
|
||
#: lazarusidestrconsts:dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Arrière-plan"
|
||
|
||
#: lazarusidestrconsts:dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Sauvegarde"
|
||
|
||
#: lazarusidestrconsts:lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "L'archivage du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts:dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Derrière les méthodes"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "Binaire"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Bloc"
|
||
|
||
#: lazarusidestrconsts:dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr "Indentation de bloc"
|
||
|
||
#: lazarusidestrconsts:dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Gras"
|
||
|
||
#: lazarusidestrconsts:uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Signet"
|
||
|
||
#: lazarusidestrconsts:lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr "Espace de bordure"
|
||
|
||
#: lazarusidestrconsts:lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "L'espace de bordure autour de la commande. Les quatre autres espaces de bordures sont ajoutés à cette valeur."
|
||
|
||
#: lazarusidestrconsts:lisbottom
|
||
msgid "Bottom"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Sélection du bas de page"
|
||
|
||
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "L'espace inférieur de bordure. Cette valeur est ajoutée à l'espace bas de bordure et employée pour l'espace au-dessous de la commande."
|
||
|
||
#: lazarusidestrconsts:lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Espacement égal au bas"
|
||
|
||
#: lazarusidestrconsts:lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts:dlgbrachighlight
|
||
msgid "Bracket highlighting"
|
||
msgstr "Mise en évidence des parenthèses"
|
||
|
||
#: lazarusidestrconsts:lisbreak
|
||
msgid "Break"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts:lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr "Couper les lignes dans la sélection"
|
||
|
||
#: lazarusidestrconsts:srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Couper la ligne et déplacer le curseur"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Couper la ligne sans bouger le curseur"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
||
msgid "Break on Lazarus Exceptions"
|
||
msgstr "Arrêt sur des exceptions de Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Points d'arrêt"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Dépendances brisées"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Dépendance brisée"
|
||
|
||
#: lazarusidestrconsts:lispatheditbrowse
|
||
msgid "Browse"
|
||
msgstr "Parcourir"
|
||
|
||
#: lazarusidestrconsts:lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Rechercher le compilateur (%s)"
|
||
|
||
#: lazarusidestrconsts:lismenubuild
|
||
msgid "Build"
|
||
msgstr "Construire"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildall
|
||
msgid "Build All"
|
||
msgstr "Construire tout"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Construire les outils de code"
|
||
|
||
#: lazarusidestrconsts:lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Commande de construction"
|
||
|
||
#: lazarusidestrconsts:lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Construire le fichier"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Construire l'IDE"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
|
||
msgid "Build IDE with Packages"
|
||
msgstr "Construire l'IDE avec les paquets"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
|
||
msgid "Build IDE without Packages"
|
||
msgstr "Construire l'IDE sans les paquets"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Construire la JITForm"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildlcl
|
||
msgid "Build LCL"
|
||
msgstr "Construire la LCL"
|
||
|
||
#: lazarusidestrconsts:lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Construire Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr "Numéro de construction"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildoptions
|
||
msgid "Build Options"
|
||
msgstr "Options de construction"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Construire SynEdit"
|
||
|
||
#: lazarusidestrconsts:lismenubuildall
|
||
msgid "Build all"
|
||
msgstr "Construire tout"
|
||
|
||
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
|
||
msgid "Build all files of project/program"
|
||
msgstr "Construire tous les fichiers du projet/programme"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr "Construire les composants (SynEdit, CodeTools)"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildexamples
|
||
msgid "Build examples"
|
||
msgstr "Construire les exemples"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Construire Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Construire un nouveau projet"
|
||
|
||
#: lazarusidestrconsts:liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Construire le programme/projet"
|
||
|
||
#: lazarusidestrconsts:rsbuild
|
||
msgid "Build:"
|
||
msgstr "Construiction :"
|
||
|
||
#: lazarusidestrconsts:dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr "Macros de style C (globales)"
|
||
|
||
#: lazarusidestrconsts:dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr "Opérateurs de style C (*=, +=, /= et -=)"
|
||
|
||
#: lazarusidestrconsts:dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr "INLINE style C++"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr "Mot-clé CVS"
|
||
|
||
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Appel de la procédure %sRegister%s de l'unité sélectionnée"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Pile d'appels"
|
||
|
||
#: lazarusidestrconsts:liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Appel sur :"
|
||
|
||
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr "L'appel de %s pour créer le Makefile depuis %s a échoué."
|
||
|
||
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Ne peut copier le composant de niveau supérieur"
|
||
|
||
#: lazarusidestrconsts:liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Ne peut enregistrer des composants sans unité"
|
||
|
||
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "peut seulement changer la classe de TComponents."
|
||
|
||
#: lazarusidestrconsts:dlgcancel
|
||
msgid "Cancel"
|
||
msgstr "Annuler"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Annuler le chargement de ce composant"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "abandonner le chargement d'unité"
|
||
|
||
#: lazarusidestrconsts:liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "abandonner le renommage"
|
||
|
||
#: lazarusidestrconsts:lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "ne peut trouver la liste des contributeurs"
|
||
|
||
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Lanceur Lazarus introuvable:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Insensible à la casse"
|
||
|
||
#: lazarusidestrconsts:rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Catalan"
|
||
|
||
#: lazarusidestrconsts:liscecategories
|
||
msgid "Categories"
|
||
msgstr "Catégories"
|
||
|
||
#: lazarusidestrconsts:listtodolcategory
|
||
msgid "Category"
|
||
msgstr "Catégorie"
|
||
|
||
#: lazarusidestrconsts:dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr "Centrer sur la ligne du curseur"
|
||
|
||
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr "Commande centrale horizontale relative au contrôle donné"
|
||
|
||
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr "Commande centrale verticale relative au contrôle donné"
|
||
|
||
#: lazarusidestrconsts:liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Centrer dans la fenêtre"
|
||
|
||
#: lazarusidestrconsts:liscenters
|
||
msgid "Centers"
|
||
msgstr "Centres"
|
||
|
||
#: lazarusidestrconsts:liscodetemplchange
|
||
msgid "Change"
|
||
msgstr "Changer"
|
||
|
||
#: lazarusidestrconsts:lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Modifier la classe"
|
||
|
||
#: lazarusidestrconsts:lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr "Changer la classes de %s"
|
||
|
||
#: lazarusidestrconsts:lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr "Changer l'encodage"
|
||
|
||
#: lazarusidestrconsts:lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Changer la police"
|
||
|
||
#: lazarusidestrconsts:lischangefile
|
||
msgid "Change file"
|
||
msgstr "Changer de fichier"
|
||
|
||
#: lazarusidestrconsts:lischangeparent
|
||
msgid "Change parent ..."
|
||
msgstr "Changer le parent …"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr "Entrée ChangeLog"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "Fichiers modifiés:"
|
||
|
||
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Le changement du nom ou de la version d'un paquet brise les dépendances. Est-ce que ces dépendances doivent être changées aussi?%s Oui pour modifier toutes les dépendances listées. %Ignorer pour briser les dépendances et continuer."
|
||
|
||
#: lazarusidestrconsts:srkmecchar
|
||
msgid "Char"
|
||
msgstr "Caractère"
|
||
|
||
#: lazarusidestrconsts:lischaracter
|
||
msgid "Character"
|
||
msgstr "Caractère"
|
||
|
||
#: lazarusidestrconsts:lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Table des caractères"
|
||
|
||
#: lazarusidestrconsts:rscharacterset
|
||
msgid "Character set:"
|
||
msgstr "Jeu de caractères :"
|
||
|
||
#: lazarusidestrconsts:lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr "Vérifier le fichier LFM dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr "Vérifier les changements sur le disque avec le chargement "
|
||
|
||
#: lazarusidestrconsts:dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Vérifier la cohérence"
|
||
|
||
#: lazarusidestrconsts:dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "Vérification des du compilateur"
|
||
|
||
#: lazarusidestrconsts:dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr "Contrôles :"
|
||
|
||
#: lazarusidestrconsts:rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Chinois "
|
||
|
||
#: lazarusidestrconsts:lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Choisissez le répertoire des fichiers .po"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Choisissez le paquet Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Choisissez le projet Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Choisissez l'unité Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts:lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Choisissez le répertoire"
|
||
|
||
#: lazarusidestrconsts:lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Choisissez le répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Choisir l'arrangement du clavier"
|
||
|
||
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Choisissez le répertoire de Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr "Choix global"
|
||
|
||
#: lazarusidestrconsts:lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr "Choisissez un lien FPDoc"
|
||
|
||
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Choisir une classe de basse pour la propriété de favori %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Choisissez un nom différent"
|
||
|
||
#: lazarusidestrconsts:lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr "Choisir une touche ..."
|
||
|
||
#: lazarusidestrconsts:dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Choisissez le fichier de modèle de code (*.dci)"
|
||
|
||
#: lazarusidestrconsts:lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Choisissez le nom de fichier du compilateur"
|
||
|
||
#: lazarusidestrconsts:lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Choisissez le nom de fichier du débogueur"
|
||
|
||
#: lazarusidestrconsts:lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Choisissez le répertoire"
|
||
|
||
#: lazarusidestrconsts:lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Choisissez le chemin \"make\""
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Choisissez un de ces items pour créer un nouveau fichier"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Choisissez un de ces items pour créer un nouveau paquet"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Choisissez un de ces items pour créer un nouveau projet"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr "Choisissez un de ces éléments qui hériter d'un existant"
|
||
|
||
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr "Choisissez le répertoire de sortie pour l'exécutable de l'IDE"
|
||
|
||
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Choisissez le source du programme (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Choisissez la structure pour entourer la sélection"
|
||
|
||
#: lazarusidestrconsts:lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Choisissez le répertoire de tests"
|
||
|
||
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr "Dépendances circulaire dans un paquet"
|
||
|
||
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "La classe %s%s%s n'est pas une classe de composants référencée.%sIncapable de coller."
|
||
|
||
#: lazarusidestrconsts:lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Classe %s%s%s non trouvée."
|
||
|
||
#: lazarusidestrconsts:lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr "Classes %s%s%s de la méthode %s%s%s introuvable."
|
||
|
||
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Nom de classe déjà existant"
|
||
|
||
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr "Conflits de classe avec le fichier .lfm : %s L'unité %s%s utilise l'unité %s%squi contient la classe %s,%smais le fichier .lfm contient déjà une autre classe.%s Il ne peut y avoir qu'une conception de classe par unité.%sS’il vous plaît passer %s dans une autre unité."
|
||
|
||
#: lazarusidestrconsts:lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Classe introuvable"
|
||
|
||
#: lazarusidestrconsts:dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Odre des classes"
|
||
|
||
#: lazarusidestrconsts:dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Politique d'insertion de portion de classe"
|
||
|
||
#: lazarusidestrconsts:liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Classique"
|
||
|
||
#: lazarusidestrconsts:liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Nettoyage de répertoire"
|
||
|
||
#: lazarusidestrconsts:liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Nettoyer les sources Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
|
||
msgid "Clean Up + Build all"
|
||
msgstr "Nettoyer + construire tout"
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr "Nettoyer tout"
|
||
|
||
#: lazarusidestrconsts:lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr "Nettoyer un répertoire ..."
|
||
|
||
#: lazarusidestrconsts:liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Nettoyer les sous-répertoires"
|
||
|
||
#: lazarusidestrconsts:liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "nettoyer le chemin des unités"
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr "Nettoyer+Construire"
|
||
|
||
#: lazarusidestrconsts:lisuidclear
|
||
msgid "Clear"
|
||
msgstr "Suppr"
|
||
|
||
#: lazarusidestrconsts:liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr "Nettoyer le répertoire ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr "Libérer la dépendance du Nom de fichier"
|
||
|
||
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Effacer le cache inclure"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Effacer les log à l'exécution"
|
||
|
||
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr "Cliquez ici pour parcourir le fichier"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Cliquez sur un des éléments ci-dessous pour voir les différences"
|
||
|
||
#: lazarusidestrconsts:lismenuclose
|
||
msgid "Close"
|
||
msgstr "Fermer"
|
||
|
||
#: lazarusidestrconsts:liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Fermer tout"
|
||
|
||
#: lazarusidestrconsts:lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Fermer le projet"
|
||
|
||
#: lazarusidestrconsts:lismenucloseall
|
||
msgid "Close all editor files"
|
||
msgstr "Fermer tous les fichiers"
|
||
|
||
#: lazarusidestrconsts:lissrclosepage
|
||
msgid "Close page"
|
||
msgstr "Fermer la page"
|
||
|
||
#: lazarusidestrconsts:liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Fermer le projet"
|
||
|
||
#: lazarusidestrconsts:dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr "Code"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodebrowser
|
||
msgid "Code Browser"
|
||
msgstr "Navigateur de code"
|
||
|
||
#: lazarusidestrconsts:dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Création de code"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
||
msgid "Code Explorer"
|
||
msgstr "Explorateur de code"
|
||
|
||
#: lazarusidestrconsts:lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Modèles de code ..."
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolstab
|
||
msgid "Code Tools"
|
||
msgstr "Audit de code"
|
||
|
||
#: lazarusidestrconsts:liscodebrowser
|
||
msgid "Code browser"
|
||
msgstr "Navigateur de code"
|
||
|
||
#: lazarusidestrconsts:dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr "Repliage de code"
|
||
|
||
#: lazarusidestrconsts:dlgedcodeparams
|
||
msgid "Code parameters"
|
||
msgstr "Paramètres du code"
|
||
|
||
#: lazarusidestrconsts:srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Modèle d'achèvement de code"
|
||
|
||
#: lazarusidestrconsts:dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr "Modêles de code"
|
||
|
||
#: lazarusidestrconsts:lisceocodeexplorer
|
||
msgid "CodeExplorer Options"
|
||
msgstr "Options de l'explorateur de code"
|
||
|
||
#: lazarusidestrconsts:liscodetools
|
||
msgid "CodeTools"
|
||
msgstr "Outils de code"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr "Outils de code - des outils et des fonctions pour analyser, passé en revue et éditer des sources Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Définitions des Outils de code"
|
||
|
||
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Outils de code Répertoire de valeurs"
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Options des Outils de code"
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsoptions
|
||
msgid "CodeTools Options ..."
|
||
msgstr "Options des Outils de code ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Commandes des outils de code"
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsoptions
|
||
msgid "CodeTools options"
|
||
msgstr "Options des outils de code"
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Editeur des directives des outils de code ..."
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr "Options des outils de code"
|
||
|
||
#: lazarusidestrconsts:liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Etendre toutes les classes"
|
||
|
||
#: lazarusidestrconsts:liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Etendre tous les paquets"
|
||
|
||
#: lazarusidestrconsts:liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Etendre toutes les unités"
|
||
|
||
#: lazarusidestrconsts:lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Collecter les fichiers .po"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Deux-points"
|
||
|
||
#: lazarusidestrconsts:dlgedcolor
|
||
msgid "Color"
|
||
msgstr "Couleur"
|
||
|
||
#: lazarusidestrconsts:dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Profils des couleurs"
|
||
|
||
#: lazarusidestrconsts:dlgenvcolors
|
||
msgid "Colors"
|
||
msgstr "Couleurs"
|
||
|
||
#: lazarusidestrconsts:srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Mode de sélection en colonne"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Virgule"
|
||
|
||
#: lazarusidestrconsts:liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Commande suivante"
|
||
|
||
#: lazarusidestrconsts:liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Commande suivante invalide"
|
||
|
||
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Commande après l'édition du module"
|
||
|
||
#: lazarusidestrconsts:srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Commande commandes"
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr "Paramètres de ligne de commande"
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Paramètres de la ligne de commande (sans le nom de l'application)"
|
||
|
||
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Paramètres d'exécution du programme"
|
||
|
||
#: lazarusidestrconsts:liscocommand
|
||
msgid "Command:"
|
||
msgstr "Commande :"
|
||
|
||
#: lazarusidestrconsts:lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr "Sélection en commentaire"
|
||
|
||
#: lazarusidestrconsts:liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Commentaire :"
|
||
|
||
#: lazarusidestrconsts:dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Compilation"
|
||
|
||
#: lazarusidestrconsts:liscocalloncompile
|
||
msgid "Compile"
|
||
msgstr "Compiler"
|
||
|
||
#: lazarusidestrconsts:liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr "Compiler l'IDE (sans assemblage)"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr "Compiler le projet"
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Compiler tout?"
|
||
|
||
#: lazarusidestrconsts:lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Compiler le paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Chemin de source compilé additionnel"
|
||
|
||
#: lazarusidestrconsts:liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Compilateur"
|
||
|
||
#: lazarusidestrconsts:dlgcompileroptions
|
||
msgid "Compiler Options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts:lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Options du compilateur ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Options du compilateur pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts:liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Options du compilateur pour le projet %s"
|
||
|
||
#: lazarusidestrconsts:liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Erreur du compilateur"
|
||
|
||
#: lazarusidestrconsts:liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Nom de fichier du compilateur"
|
||
|
||
#: lazarusidestrconsts:liskmcompileroptions
|
||
msgid "Compiler options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts:dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Chemin du compilateur (%s)"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildcomplile
|
||
msgid "Compiling..."
|
||
msgstr "Compilation ..."
|
||
|
||
#: lazarusidestrconsts:lismenucompletecode
|
||
msgid "Complete Code"
|
||
msgstr "Compléter le code"
|
||
|
||
#: lazarusidestrconsts:srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr "Compléter le code"
|
||
|
||
#: lazarusidestrconsts:dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Propriétés d'achèvement"
|
||
|
||
#: lazarusidestrconsts:liscomponent
|
||
msgid "Component"
|
||
msgstr "Composant"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Classe de composant %s%s%s déjà définie"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Le nom du composant %s%s%s est un mot réservé"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Le nom du composant %s%s%s n'est pas valide"
|
||
|
||
#: lazarusidestrconsts:lisfpcomponents
|
||
msgid "Components"
|
||
msgstr "Composants"
|
||
|
||
#: lazarusidestrconsts:liscondition
|
||
msgid "Condition"
|
||
msgstr "Condition"
|
||
|
||
#: lazarusidestrconsts:rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr "Définitions conditionnelle"
|
||
|
||
#: lazarusidestrconsts:liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Configurer %sConstruire le fichier%s"
|
||
|
||
#: lazarusidestrconsts:dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr "Fichiers de configuration:"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Configurer %sConstruire Lazarus%s"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Configurer Construire %s"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Configurer Construire+Exécuter le fichier ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Configurer l'aide "
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Configurer l'aide ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Configurer \"Build Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigurecustomcomponents
|
||
msgid "Configure custom components"
|
||
msgstr "Configurer les composants utilisateur ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr "Configurer les composants utilisateur ..."
|
||
|
||
#: lazarusidestrconsts:lismenusettings
|
||
msgid "Configure custom tools ..."
|
||
msgstr "Configurer les outils personnalisés..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigureinstalledpackages
|
||
msgid "Configure installed packages"
|
||
msgstr "Configurer les paquets installer"
|
||
|
||
#: lazarusidestrconsts:lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr "Configurer les paquets installés ..."
|
||
|
||
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
||
msgid "Confirm before rebuilding Lazarus"
|
||
msgstr "Confirmer avant de reconstruire Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Confirmer les changements"
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Confirmer la suppression de la dépendance"
|
||
|
||
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr "Confirmez le nouveau ensemble de paquets pour l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Confirmer le retrait du fichier"
|
||
|
||
#: lazarusidestrconsts:liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr "Confirmez remplacer"
|
||
|
||
#: lazarusidestrconsts:srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflit"
|
||
|
||
#: lazarusidestrconsts:lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Conflit trouvé "
|
||
|
||
#: lazarusidestrconsts:lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr "Application console"
|
||
|
||
#: lazarusidestrconsts:lisceconstants
|
||
msgid "Constants"
|
||
msgstr "Constantes"
|
||
|
||
#: lazarusidestrconsts:dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Le nom du constructeur doit être 'init' (le destructeur doit être 'done')"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Contenu"
|
||
|
||
#: lazarusidestrconsts:lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Aide contextuelle"
|
||
|
||
#: lazarusidestrconsts:liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Aide contextuelle"
|
||
|
||
#: lazarusidestrconsts:liscontinue
|
||
msgid "Continue"
|
||
msgstr "Continuer"
|
||
|
||
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Continuer sans charger la fiche"
|
||
|
||
#: lazarusidestrconsts:liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Contributeurs"
|
||
|
||
#: lazarusidestrconsts:liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Le contrôle nécessite un parent"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Options de conversion"
|
||
|
||
#: lazarusidestrconsts:lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Erreur de conversion"
|
||
|
||
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM file to LFM"
|
||
msgstr "Convertir un fichier DFM vers LFM"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
||
msgid "Convert DFM file to LFM ..."
|
||
msgstr "Convertir un fichier DFM en LFM ..."
|
||
|
||
#: lazarusidestrconsts:lispwconvertproject
|
||
msgid "Convert Delphi Project"
|
||
msgstr "Convertir un projet Delphi"
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Convertir un paquet Delphi en paque Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr "Convertir un paquet Delphi en paquet Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi project to Lazarus project"
|
||
msgstr "Convertir un projet Delphi en projet Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr "Convertir un projet Delphi en projet Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi unit to Lazarus unit"
|
||
msgstr "Convertir une unité Delphi en unité Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr "Convertir une unité Delphi en unité Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Convertir un noeud"
|
||
|
||
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Convertir les tabulations de la sélection en espaces"
|
||
|
||
#: lazarusidestrconsts:lismenucopy
|
||
msgid "Copy"
|
||
msgstr "Copier"
|
||
|
||
#: lazarusidestrconsts:liscopyall
|
||
msgid "Copy All"
|
||
msgstr "Copier tout"
|
||
|
||
#: lazarusidestrconsts:liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Erreur de copie"
|
||
|
||
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr "Copier tous les messages cachés dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr "Copier tous les messages vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Copier l'erreur"
|
||
|
||
#: lazarusidestrconsts:uemcopyfilename
|
||
msgid "Copy filename"
|
||
msgstr "Copier nom de fichier"
|
||
|
||
#: lazarusidestrconsts:lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Copie depuis hérité "
|
||
|
||
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Copier le Nom de méthode dans le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr "Copier la sortie vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Copier les composants choisis vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Copier les composants sélectionnés vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr "Copier les messages sélectionnés dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts:srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Copier la sélection vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr "Copier les informations de version dans le presse-papier"
|
||
|
||
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Copier le mot si rien à copier"
|
||
|
||
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "La copie d'une fiche complète n'est pas encore implémentée."
|
||
|
||
#: lazarusidestrconsts:rscopyright
|
||
msgid "Copyright:"
|
||
msgstr "Copyright :"
|
||
|
||
#: lazarusidestrconsts:dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Compteur (.pp;1)"
|
||
|
||
#: lazarusidestrconsts:lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Créer"
|
||
|
||
#: lazarusidestrconsts:lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Créer les fichiers .po"
|
||
|
||
#: lazarusidestrconsts:dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr "Créer un Bundle Application"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Créer les définitions pour le répertoire %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Créer les définitions pour le projet %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Créer les définitions pour le compilateur Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Créer Définit pour des sources Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Créer les définitions pour le répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Créer les macros et chemins pour un répertoire projet FPC"
|
||
|
||
#: lazarusidestrconsts:lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr "Créer un fichier FPDoc"
|
||
|
||
#: lazarusidestrconsts:dlgcocreatemakefile
|
||
msgid "Create Makefile"
|
||
msgstr "Créer le Makefile"
|
||
|
||
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Créer un sous-menu"
|
||
|
||
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Créer une nouvelle application CGI.%sLe fichier programme est géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Créer un nouveau fichier dans l'éditeur.%sChoisir un type."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Créer un nouveau fichier texte vide"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Créer une nouvelle application graphique.%sLe fichier programme est géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Créer une nouvelle unité Pascal."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Créer un nouveau programme."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr "Créer un nouveau programme.%sLe fichier programme est maintenu par Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Créer un nouveau projet"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Créer un nouveau projet.%Choisir un type."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Créer un nouveau paquet standard.%sUn paquet est une collection d'unités et de composants."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Créer une nouvelle unité avec une fiche LCL."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Créer une nouvelle unité avec un module de données."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame"
|
||
msgstr "Créer une nouvelle unité avec un cadre"
|
||
|
||
#: lazarusidestrconsts:liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Veuillez d'abord créer un projet !"
|
||
|
||
#: lazarusidestrconsts:liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr "Créer le répertoire ?"
|
||
|
||
#: lazarusidestrconsts:liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr "Créer un item d'aide"
|
||
|
||
#: lazarusidestrconsts:liscreateit
|
||
msgid "Create it"
|
||
msgstr "Le créer"
|
||
|
||
#: lazarusidestrconsts:rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr "Créer une nouvelle définition"
|
||
|
||
#: lazarusidestrconsts:lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Créer un nouveau fichier"
|
||
|
||
#: lazarusidestrconsts:liscreatenewproject
|
||
msgid "Create new project"
|
||
msgstr "Créer un nouveau projet"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
||
msgid "Creation"
|
||
msgstr "Création"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolctrl
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts:liscurrent
|
||
msgid "Current"
|
||
msgstr "Courant"
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Projet courant"
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Répertoire du projet courant"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr "Date et heure courantes"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr "Utilisateur courant"
|
||
|
||
#: lazarusidestrconsts:dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Curseur au-delà de la fin de ligne"
|
||
|
||
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Colonne du curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr "Curseur n'est pas dans une déclaration de classe"
|
||
|
||
#: lazarusidestrconsts:srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Commandes de déplacement du curseur"
|
||
|
||
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Ligne du curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts:dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr "Le curseur saute la sélection"
|
||
|
||
#: lazarusidestrconsts:lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Personnalisé"
|
||
|
||
#: lazarusidestrconsts:liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Programme personnalisé"
|
||
|
||
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr "Programme personnalisé%sUn programme FreePascal"
|
||
|
||
#: lazarusidestrconsts:liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Commandes personnalisées"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Identificateur personnalisé"
|
||
|
||
#: lazarusidestrconsts:liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Options personnalisées"
|
||
|
||
#: lazarusidestrconsts:rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Position personnalisée"
|
||
|
||
#: lazarusidestrconsts:srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr "Outil personnalisé %d"
|
||
|
||
#: lazarusidestrconsts:lismenucut
|
||
msgid "Cut"
|
||
msgstr "Couper"
|
||
|
||
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Couper les composants choisis vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Couper les composants sélectionnés vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Couper la sélection vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "&Désactiver tout"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Bases de données"
|
||
|
||
#: lazarusidestrconsts:lisdate
|
||
msgid "Date"
|
||
msgstr "Date"
|
||
|
||
#: lazarusidestrconsts:liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "&Supprimer tout"
|
||
|
||
#: lazarusidestrconsts:uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Déboguer"
|
||
|
||
#: lazarusidestrconsts:lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr "Sortie de débogueur"
|
||
|
||
#: lazarusidestrconsts:lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr "Fenêtres de débogage"
|
||
|
||
#: lazarusidestrconsts:lismendebuggeroptions
|
||
msgid "Debugger Options ..."
|
||
msgstr "Options du débogueur ..."
|
||
|
||
#: lazarusidestrconsts:lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Erreur du débogueur"
|
||
|
||
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Erreur du débogueur%sLe débogueur est en état d'erreur%sEnregistrez votre travail maintenant!%sCliquez sur Stop et espérez; nous ne répondons plus de rien !"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Options général du débogueur"
|
||
|
||
#: lazarusidestrconsts:lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Débogueur non valide"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Ajout d'un chemin au débogueur (aucun):"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Options spécifiques du débogueur (dépend du type de débogueur)"
|
||
|
||
#: lazarusidestrconsts:dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Type de débogueur et chemin"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr "Déboguage :"
|
||
|
||
#: lazarusidestrconsts:lisdecimal
|
||
msgid "Decimal"
|
||
msgstr "Décimale"
|
||
|
||
#: lazarusidestrconsts:dlgassemblerdefault
|
||
msgid "Default"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts:dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Fonte par défaut pour l'éditeur"
|
||
|
||
#: lazarusidestrconsts:dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Extension Pascal par défaut"
|
||
|
||
#: lazarusidestrconsts:dlgdefvaluecolor
|
||
msgid "Default value"
|
||
msgstr "Valeur par défaut"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Définir"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Définir de manière récursive"
|
||
|
||
#: lazarusidestrconsts:lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Définir les modêles"
|
||
|
||
#: lazarusidestrconsts:dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Délai"
|
||
|
||
#: lazarusidestrconsts:dlgeddelete
|
||
msgid "Delete"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr "Supprimer tous dans le même source"
|
||
|
||
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr "Supprimer du modèle ..."
|
||
|
||
#: lazarusidestrconsts:lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Supprimer l'élément"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Supprimer le dernier caractère"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Supprimer l'ancien fichier paquet ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr "Supprimer tous les points d'arrêts dans le fichier %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr "Supprimer tous le points d'arrêts ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr "Supprimer tous les points d'arrêts sélectionnez ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Détruire ces fichiers ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Supprimer les fichier ambigus ?"
|
||
|
||
#: lazarusidestrconsts:lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr "Supprimer le point d'arrêt à%s\"%s\" ligne %d ?"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Supprimer le caractère sous le curseur"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Supprimer la ligne courante"
|
||
|
||
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Supprimer la dépendance pour %s ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "La suppression a échoué"
|
||
|
||
#: lazarusidestrconsts:lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "La suppression du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts:liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Effacer le dernier caractère"
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Supprimer le lien"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Supprimer un noeud"
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Supprimer l'ancien fichier %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr "Supprimer l'ancien fichier ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Supprimer l'ancien fichier paquet %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr "Supprimer les fichiers sélectionés ?"
|
||
|
||
#: lazarusidestrconsts:fdmdeleteselection
|
||
msgid "Delete selection"
|
||
msgstr "Supprimer la sélection"
|
||
|
||
#: lazarusidestrconsts:dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Supprimer le modèle"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Supprimer le début de la ligne"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Supprimer la fin de la ligne"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "supprimer la fin du mot"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Supprimer le début du mot"
|
||
|
||
#: lazarusidestrconsts:srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Supprimer tout le texte"
|
||
|
||
#: lazarusidestrconsts:lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "La suppression de l'ancien fichier %s%s%s a échoué."
|
||
|
||
#: lazarusidestrconsts:lisdelphi
|
||
msgid "Delphi"
|
||
msgstr "Delphi"
|
||
|
||
#: lazarusidestrconsts:dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr "Extensions Delphi 2"
|
||
|
||
#: lazarusidestrconsts:dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr "Compatible Delphi"
|
||
|
||
#: lazarusidestrconsts:lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Projet Delphi"
|
||
|
||
#: lazarusidestrconsts:lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Dépendance"
|
||
|
||
#: lazarusidestrconsts:lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Propriétés de dépendance"
|
||
|
||
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Dépendance déjà existante"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Dépendance sans attache : %s"
|
||
|
||
#: lazarusidestrconsts:lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Décroissant"
|
||
|
||
#: lazarusidestrconsts:listodoldescription
|
||
msgid "Description"
|
||
msgstr "Description"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr "Description/Résumé"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Description :"
|
||
|
||
#: lazarusidestrconsts:lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Description : "
|
||
|
||
#: lazarusidestrconsts:liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Commandes du concepteur"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr "Conception et exécution"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Conception seulement"
|
||
|
||
#: lazarusidestrconsts:dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Bureau"
|
||
|
||
#: lazarusidestrconsts:dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr "Fichiers du bureau"
|
||
|
||
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr "Paquet de destination"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Répertoire de destination"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "Le répertoire de destination %s%s%s est non valide.%s Choisissez un chemin complet svp."
|
||
|
||
#: lazarusidestrconsts:lismenudiff
|
||
msgid "Diff"
|
||
msgstr "Différences"
|
||
|
||
#: lazarusidestrconsts:liskmdiffeditorfiles
|
||
msgid "Diff editor files"
|
||
msgstr "Editeur de différences "
|
||
|
||
#: lazarusidestrconsts:lisdigits
|
||
msgid "Digits:"
|
||
msgstr "Chiffres :"
|
||
|
||
#: lazarusidestrconsts:dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Sens"
|
||
|
||
#: lazarusidestrconsts:lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Directives"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Répertoire"
|
||
|
||
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "Le répertoire n'existe pas"
|
||
|
||
#: lazarusidestrconsts:dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Répertoire pour construire les projets tests"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Répertoire non trouvé"
|
||
|
||
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Options de répertoire"
|
||
|
||
#: lazarusidestrconsts:lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr "Désactiver tout dans la même source"
|
||
|
||
#: lazarusidestrconsts:lisdisablegroup
|
||
msgid "Disable Group"
|
||
msgstr "Désactiver le groupe"
|
||
|
||
#: lazarusidestrconsts:lisdisabled
|
||
msgid "Disabled"
|
||
msgstr "Désactiver"
|
||
|
||
#: lazarusidestrconsts:lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Annuler les changements"
|
||
|
||
#: lazarusidestrconsts:dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Affichage"
|
||
|
||
#: lazarusidestrconsts:dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Affichage (pas pour Win32; par exemple : 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts:dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr "Afficher les numéros de ligne dans les traçages d'erreurs d'exécution"
|
||
|
||
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Différencier majuscules et minuscules (i.e. A et a)"
|
||
|
||
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
||
msgid "Divider Draw Level"
|
||
msgstr "Niveau d'affichage de diviseur"
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Ne pas fermer l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Ne pas fermer le projet "
|
||
|
||
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Ne pas conserver les informations de session"
|
||
|
||
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Ne pas afficher le splashscreen"
|
||
|
||
#: lazarusidestrconsts:lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Ne plus montrer ce message."
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr "Ne pas couper la ligne avant :"
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr "Ne pas couper la ligne après :"
|
||
|
||
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Voulez-vous réellement abandonner les changements sur le paquet %s et le recharger du fichier ?"
|
||
|
||
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr "Voulez-vous reconstruire Lazarus ?"
|
||
|
||
#: lazarusidestrconsts:rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Attaché"
|
||
|
||
#: lazarusidestrconsts:lismvdocking
|
||
msgid "Docking"
|
||
msgstr "Arrimage"
|
||
|
||
#: lazarusidestrconsts:lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Editeur de documentation"
|
||
|
||
#: lazarusidestrconsts:lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Domaine"
|
||
|
||
#: lazarusidestrconsts:listodoldone
|
||
msgid "Done"
|
||
msgstr "Fini"
|
||
|
||
#: lazarusidestrconsts:dlgdoubleclickline
|
||
msgid "Double click line"
|
||
msgstr "Double-cliquer sur la ligne"
|
||
|
||
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr "Double-cliquer sur les messages pour les déplacements (sinon simple clic)"
|
||
|
||
#: lazarusidestrconsts:dlgdownword
|
||
msgid "Down"
|
||
msgstr "Bas"
|
||
|
||
#: lazarusidestrconsts:dlgdragdroped
|
||
msgid "Drag Drop editing"
|
||
msgstr "Edition par glisser-déplacer"
|
||
|
||
#: lazarusidestrconsts:dlgdropfiles
|
||
msgid "Drop files"
|
||
msgstr "Abandonner les fichiers"
|
||
|
||
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Nom double : Un composant appelé %s%s%s existe déjà dans le composant hérité %s"
|
||
|
||
#: lazarusidestrconsts:rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Hollandais"
|
||
|
||
#: lazarusidestrconsts:liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "&Activer tout"
|
||
|
||
#: lazarusidestrconsts:lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr "Confi&guration"
|
||
|
||
#: lazarusidestrconsts:lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr "ERREUR :"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsedit
|
||
msgid "Edit"
|
||
msgstr "Editer"
|
||
|
||
#: lazarusidestrconsts:liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Editer les modèles de code"
|
||
|
||
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Editer les options générales"
|
||
|
||
#: lazarusidestrconsts:srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Editer les touches"
|
||
|
||
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Editer les options de compilation de paquet"
|
||
|
||
#: lazarusidestrconsts:lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Editer les outils"
|
||
|
||
#: lazarusidestrconsts:lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr "Editer l'unité virtuelle"
|
||
|
||
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Editer les modèles de code"
|
||
|
||
#: lazarusidestrconsts:lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Éditer l'aide sensible au contexte"
|
||
|
||
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Éditer l'aide sensible au contexte"
|
||
|
||
#: lazarusidestrconsts:liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr "Éditer les touches de commande"
|
||
|
||
#: lazarusidestrconsts:lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Éditer l'unité virtuelle"
|
||
|
||
#: lazarusidestrconsts:dlgededit
|
||
msgid "Edit..."
|
||
msgstr "Editer"
|
||
|
||
#: lazarusidestrconsts:dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr "Editeur de fichiers"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Fonte de l'éditeur"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr "Taille de la police de l'éditeur"
|
||
|
||
#: lazarusidestrconsts:liskmeditoroptions
|
||
msgid "Editor options"
|
||
msgstr "Options de l'éditeur"
|
||
|
||
#: lazarusidestrconsts:lismenueditoroptions
|
||
msgid "Editor options ..."
|
||
msgstr "Options de l'éditeur ..."
|
||
|
||
#: lazarusidestrconsts:uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr "Propriétés de l'éditeur"
|
||
|
||
#: lazarusidestrconsts:dlgedelement
|
||
msgid "Element"
|
||
msgstr "Elément "
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Autrement"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts:lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr "Méthodes vides"
|
||
|
||
#: lazarusidestrconsts:lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr "Activer tout dans la même source"
|
||
|
||
#: lazarusidestrconsts:lisenablegroup
|
||
msgid "Enable Group"
|
||
msgstr "Activer le groupe"
|
||
|
||
#: lazarusidestrconsts:lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Permettre les macros"
|
||
|
||
#: lazarusidestrconsts:rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr "Activer i18n"
|
||
|
||
#: lazarusidestrconsts:lisenabled
|
||
msgid "Enabled"
|
||
msgstr "Permis "
|
||
|
||
#: lazarusidestrconsts:lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Activer = Inclure %s dans des ancres"
|
||
|
||
#: lazarusidestrconsts:lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Entourer"
|
||
|
||
#: lazarusidestrconsts:uemencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr "Entourer la sélection"
|
||
|
||
#: lazarusidestrconsts:liskmencloseselection
|
||
msgid "Enclose selection"
|
||
msgstr "Entourer la sélection"
|
||
|
||
#: lazarusidestrconsts:lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr "Entourer la sélection ..."
|
||
|
||
#: lazarusidestrconsts:uemencoding
|
||
msgid "Encoding"
|
||
msgstr "Encodage"
|
||
|
||
#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr "Encodage du fichier %s%s%s%s sur disque est %s. Nouvelle encodage est %s."
|
||
|
||
#: lazarusidestrconsts:rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Anglais"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Entrez les données"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Entrez les paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts:lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Entrez la langue de traduction"
|
||
|
||
#: lazarusidestrconsts:dlgrunoenvironment
|
||
msgid "Environment"
|
||
msgstr "Environnement"
|
||
|
||
#: lazarusidestrconsts:srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Commandes du menu Environnement"
|
||
|
||
#: lazarusidestrconsts:lismenugeneraloptions
|
||
msgid "Environment options ..."
|
||
msgstr "Options d'environnement ..."
|
||
|
||
#: lazarusidestrconsts:lisccoerrorcaption
|
||
msgid "Error"
|
||
msgstr "Erreur"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Erreur de lecture du paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Erreur d'écriture du paquet"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Erreur d'accès xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Erreur d'accès au fichier xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Erreur à la création du fichier"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Erreur à la création du fichier lrs"
|
||
|
||
#: lazarusidestrconsts:liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Erreur à la suppression de fichier"
|
||
|
||
#: lazarusidestrconsts:liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Erreur dans %s"
|
||
|
||
#: lazarusidestrconsts:lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Erreur dans l'expression régulière"
|
||
|
||
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Erreur à l'initialisation du programme %s%s%s%s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr "Erreur de chargement %s depuis %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr "Erreur lors du chargement du fichier"
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Erreur de chargement xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Erreur de chargement du fichier xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Erreur en déplaçant le composant"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Erreur en déplaçant le composant %s:%s"
|
||
|
||
#: lazarusidestrconsts:lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr "Une erreur est survenue pendant la création du Bundle Application :"
|
||
|
||
#: lazarusidestrconsts:liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr "Erreur d'ouverture du composant"
|
||
|
||
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Erreur d'analyse du flux de composant lfm."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Erreur lors de la lecture de %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr "Erreur de lecture XML"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Erreur de lecture de fichier"
|
||
|
||
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Erreur de lecture du fichier : %s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Erreur en lisant la liste des paquets du fichier %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Erreur de lecture des infos de projet %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr "Erreur de lecture du fichier XML %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Erreur en renommant le fichier"
|
||
|
||
#: lazarusidestrconsts:liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr "Erreur d'enregistrement %s dans%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture du fichier infos projet %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lislazbuilderrorwritingfile
|
||
msgid "Error writing file"
|
||
msgstr "Erreur d'écriture de fichier"
|
||
|
||
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Erreur lors de l'écriture de la liste des paquets dans le fichier%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisinfobuilderror
|
||
msgid "Error..."
|
||
msgstr "Erreur..."
|
||
|
||
#: lazarusidestrconsts:liserror
|
||
msgid "Error: "
|
||
msgstr "Erreur :"
|
||
|
||
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Erreur : compilateur invalide: %s"
|
||
|
||
#: lazarusidestrconsts:liserrors
|
||
msgid "Errors"
|
||
msgstr "Erreurs"
|
||
|
||
#: lazarusidestrconsts:lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr "Erreurs :"
|
||
|
||
#: lazarusidestrconsts:liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Evaluer/modifier "
|
||
|
||
#: lazarusidestrconsts:lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr "Evaluer/Modifier ..."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
||
msgid "Event Log"
|
||
msgstr "Notation d'événement"
|
||
|
||
#: lazarusidestrconsts:liseverynthlinenumber
|
||
msgid "Every n-th line number:"
|
||
msgstr "Chaque n-ème numéro de ligne :"
|
||
|
||
#: lazarusidestrconsts:liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Exemple"
|
||
|
||
#: lazarusidestrconsts:lisexamples
|
||
msgid "Examples"
|
||
msgstr "Exemples"
|
||
|
||
#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr "Filtre d'exclusion"
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter2
|
||
msgid "Exclude filter"
|
||
msgstr "Filtre d'exclusion"
|
||
|
||
#: lazarusidestrconsts:liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Exécuter après"
|
||
|
||
#: lazarusidestrconsts:liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Exécuter avant"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Exécuter la commande suivante"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Exécuter la commande précédente"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Exécution suspendue"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Exécution suspendue%s Adresse : $%s%s Procédure : %s%s Fichier : %s%s(un jour une fenêtre d'assembleur pourrait apparaître ici :))%s"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Exécution interrompue"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstoppedon
|
||
msgid "Execution stopped%s"
|
||
msgstr "Exécution interrompue%s"
|
||
|
||
#: lazarusidestrconsts:lispldexists
|
||
msgid "Exists"
|
||
msgstr "Existe"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexit
|
||
msgid "Exit"
|
||
msgstr "Quitter"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Quitter sans enregistrer"
|
||
|
||
#: lazarusidestrconsts:lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Etendre toutes les classes"
|
||
|
||
#: lazarusidestrconsts:lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Etendre tous les paquets"
|
||
|
||
#: lazarusidestrconsts:lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Etendre toutes les unités"
|
||
|
||
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Nom étendu du fichier de l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts:lisexport
|
||
msgid "Export ..."
|
||
msgstr "Exporter ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Le fichier d'exportation %s%s%s existe.%sOuvrir le fichier et remplacer seulement les options du compilateur?%s(les autres paramètres seront gardés.)"
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Le fichier d'exportation existe"
|
||
|
||
#: lazarusidestrconsts:lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Liste d'exportation"
|
||
|
||
#: lazarusidestrconsts:liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Expression"
|
||
|
||
#: lazarusidestrconsts:lisexpression
|
||
msgid "Expression:"
|
||
msgstr "Expression :"
|
||
|
||
#: lazarusidestrconsts:lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Prolonger le chemin d'unité ?"
|
||
|
||
#: lazarusidestrconsts:liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Configuration d'outils externes "
|
||
|
||
#: lazarusidestrconsts:srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Outil externe %d"
|
||
|
||
#: lazarusidestrconsts:lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr "Outils externes"
|
||
|
||
#: lazarusidestrconsts:srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Configurations des outils externes"
|
||
|
||
#: lazarusidestrconsts:dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Interligne supplémentaire"
|
||
|
||
#: lazarusidestrconsts:lisextract
|
||
msgid "Extract"
|
||
msgstr "Extraire"
|
||
|
||
#: lazarusidestrconsts:uemextractproc
|
||
msgid "Extract Procedure"
|
||
msgstr "Extraire procédure"
|
||
|
||
#: lazarusidestrconsts:srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr "Extraire procédure"
|
||
|
||
#: lazarusidestrconsts:lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr "Extraire procédure ..."
|
||
|
||
#: lazarusidestrconsts:lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "Chemin FPC Doc HTML"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Répertoire des sources FPC SVN"
|
||
|
||
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Erreur sur le répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts:lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr "Version FPC (ex. 2.2.2)"
|
||
|
||
#: lazarusidestrconsts:lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr "Version FPC :"
|
||
|
||
#: lazarusidestrconsts:dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Répertoire des sources de FPC"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Répertoire des sources de FPC \"%s\" non trouvé."
|
||
|
||
#: lazarusidestrconsts:lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr "Chemin des unités FPC contient une source :"
|
||
|
||
#: lazarusidestrconsts:lismenufpdoceditor
|
||
msgid "FPDoc Editor"
|
||
msgstr "Editeur FPDoc"
|
||
|
||
#: lazarusidestrconsts:lisfpdoceditor
|
||
msgid "FPDoc editor"
|
||
msgstr "Editeur FPDoc"
|
||
|
||
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
|
||
msgid "FPDoc files path"
|
||
msgstr "Chemin des fichiers FPDoc"
|
||
|
||
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "L'exécution de l'outil a échoué"
|
||
|
||
#: lazarusidestrconsts:dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr "Code plus rapide"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefile
|
||
msgid "File"
|
||
msgstr "Fichier"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr "Le fichier %s%s% existe déjà dans le projet."
|
||
|
||
#: lazarusidestrconsts:lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "Le fichier %s%s%s a été modifié. L'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts:lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Le fichier %s%s%s est virtuel."
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "Fichier %s%s% non trouvé."
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "Fichier %s%s%s non trouvé.%s"
|
||
|
||
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "Fichier %s%s% non trouvé.%sSouhaitez-vous le créer ?%s"
|
||
|
||
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Le fichier %s%s%s n'a pas l'air d'un fichier texte.%sL'ouvrir quand même ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Propriétés du fichier"
|
||
|
||
#: lazarusidestrconsts:lisfilesettings
|
||
msgid "File Settings ..."
|
||
msgstr "paramêtres fichiers"
|
||
|
||
#: lazarusidestrconsts:lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr "Type de fichier"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Fichier déjà existant"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Fichier déjà dans le paquet"
|
||
|
||
#: lazarusidestrconsts:lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr "Extension de fichier des programmes"
|
||
|
||
#: lazarusidestrconsts:dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Extensions de fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Le fichier est déjà dans le paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Le fichier est dans le projet"
|
||
|
||
#: lazarusidestrconsts:lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "Fichier protégé en écriture"
|
||
|
||
#: lazarusidestrconsts:uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Fichier en lecture seule"
|
||
|
||
#: lazarusidestrconsts:lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr "Le fichier est un lien symbolique"
|
||
|
||
#: lazarusidestrconsts:lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Fichier en cours d'utilisation"
|
||
|
||
#: lazarusidestrconsts:lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr "Erreur de fichier lien"
|
||
|
||
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr "Filtre de fichier (*;*.*;*.bak?)"
|
||
|
||
#: lazarusidestrconsts:srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Commandes du menu fichier"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Nom de fichier:"
|
||
|
||
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Fichier non exécutable"
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Fichier non trouvé"
|
||
|
||
#: lazarusidestrconsts:lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Fichier pas en minuscules"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Fichier non enregistré"
|
||
|
||
#: lazarusidestrconsts:lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Pas un fichier texte"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Le fichier n'est pas une unité"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Nom de fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Nom de fichier différent du nom de paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Nom de fichier utilisé par un autre paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Nom de fichier utilisé par un projet"
|
||
|
||
#: lazarusidestrconsts:lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr "Nom de fichier/Adresse"
|
||
|
||
#: lazarusidestrconsts:lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Nom de fichier :"
|
||
|
||
#: lazarusidestrconsts:lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Nom de fichier : %s"
|
||
|
||
#: lazarusidestrconsts:dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Fichiers"
|
||
|
||
#: lazarusidestrconsts:lisfilter
|
||
msgid "Filter"
|
||
msgstr "Filtre"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Filtre en assortissant toute partie de la méthode"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Filtre par l'assortiment avec le début de la méthode"
|
||
|
||
#: lazarusidestrconsts:lismenufind
|
||
msgid "Find"
|
||
msgstr "Chercher"
|
||
|
||
#: lazarusidestrconsts:lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Chercher l'occurrence &suivante"
|
||
|
||
#: lazarusidestrconsts:lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Chercher l'occurrence &précédente"
|
||
|
||
#: lazarusidestrconsts:lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr "Chercher dans les &fichiers ..."
|
||
|
||
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr "Rechercher la déclaration sous le curseur"
|
||
|
||
#: lazarusidestrconsts:uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr "Trouver la référence de l'identificateur"
|
||
|
||
#: lazarusidestrconsts:lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Trouver la référence de l'identificateur ..."
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr "Trouver l'occurence suivante"
|
||
|
||
#: lazarusidestrconsts:lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Trouver les références"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Chercher la fin d'un bloc"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Chercher le début d'un bloc"
|
||
|
||
#: lazarusidestrconsts:lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr "Chercher le début du bloc de code"
|
||
|
||
#: lazarusidestrconsts:liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Rechercher un Composant"
|
||
|
||
#: lazarusidestrconsts:srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr "Chercher la déclaration"
|
||
|
||
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr "Trouver les références de l'identificateur"
|
||
|
||
#: lazarusidestrconsts:srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr "Chercher dans les fichiers"
|
||
|
||
#: lazarusidestrconsts:liskmfindincremental
|
||
msgid "Find incremental"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts:lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr "Trouver la combinaison de touches"
|
||
|
||
#: lazarusidestrconsts:srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr "Trouver l'occurence suivante"
|
||
|
||
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr "Rechercher l'occurrence de mot Suivante"
|
||
|
||
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Trouver ou renommer l'identificateur"
|
||
|
||
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr "Chercher la fin du bloc de code"
|
||
|
||
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr "Rechercher la palette des composants"
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr "Chercher l'occurence précédente"
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr "Rechercher l'occurrence de mot précédente"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr "Chercher la définition de procédure"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr "Chercher la méthode"
|
||
|
||
#: lazarusidestrconsts:srkmecfind
|
||
msgid "Find text"
|
||
msgstr "Chercher le texte"
|
||
|
||
#: lazarusidestrconsts:dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Chercher le texte sous le curseur"
|
||
|
||
#: lazarusidestrconsts:rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Finnois"
|
||
|
||
#: lazarusidestrconsts:lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr "Corriger la casse des fichiers"
|
||
|
||
#: lazarusidestrconsts:lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Corriger fichier LFM"
|
||
|
||
#: lazarusidestrconsts:lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr "Virgule flottante"
|
||
|
||
#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr "Focus messages après compilation"
|
||
|
||
#: lazarusidestrconsts:srkmecjumptoeditor
|
||
msgid "Focus to source editor"
|
||
msgstr "Activer l'éditeur de source"
|
||
|
||
#: lazarusidestrconsts:liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Suivre le curseur"
|
||
|
||
#: lazarusidestrconsts:lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Police sans UTF-8"
|
||
|
||
#: lazarusidestrconsts:lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Forcer le renommage"
|
||
|
||
#: lazarusidestrconsts:dlgforecolor
|
||
msgid "Foreground color"
|
||
msgstr "Couleur d'avant-plan"
|
||
|
||
#: lazarusidestrconsts:dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Editeur de fiches"
|
||
|
||
#: lazarusidestrconsts:rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Fichier de données Fiche (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts:lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Erreur au chargement de la fiche"
|
||
|
||
#: lazarusidestrconsts:lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Erreur de format"
|
||
|
||
#: lazarusidestrconsts:dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Fiches"
|
||
|
||
#: lazarusidestrconsts:lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr "Fiches ..."
|
||
|
||
#: lazarusidestrconsts:lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr "Recherche vers l'&avant"
|
||
|
||
#: lazarusidestrconsts:lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr "Recherche vers l'avant"
|
||
|
||
#: lazarusidestrconsts:fdmorderforwardone
|
||
msgid "Forward one"
|
||
msgstr "Avancer d'un"
|
||
|
||
#: lazarusidestrconsts:lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr "Trouvé les méthodes vide :"
|
||
|
||
#: lazarusidestrconsts:lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr "Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Compilateur Free Pascal introuvable"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Sources Free Pascal introuvables"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr "Fichier source FreePascal"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr "Répertoire des sources FreePascal"
|
||
|
||
#: lazarusidestrconsts:rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Français"
|
||
|
||
#: lazarusidestrconsts:lisfunction
|
||
msgid "Function"
|
||
msgstr "Fonction"
|
||
|
||
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Fonction : ajouter un délimiteur de chemin"
|
||
|
||
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Fonction : enlever un délimiteur de chemin"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Fonction : extraire l'extension du fichier"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Fonction : extraire le nom de fichier seul."
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Fonction : extraire le nom et l'extension du fichier"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Fonction : extraire le chemin du fichier"
|
||
|
||
#: lazarusidestrconsts:dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr "Compatibilité GPC (GNU Pascal Compiler)"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr "Notice GPL"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgeneral
|
||
msgid "General"
|
||
msgstr "Général"
|
||
|
||
#: lazarusidestrconsts:lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Options générales"
|
||
|
||
#: lazarusidestrconsts:srkmecenvironmentoptions
|
||
msgid "General environment options"
|
||
msgstr "Options d'environement générales"
|
||
|
||
#: lazarusidestrconsts:dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr "Générer des infos pour le débogueur DBX (ralentit la compilation)"
|
||
|
||
#: lazarusidestrconsts:dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr "Générer des infos pour le débogueur GDB (ralentit la compilation)"
|
||
|
||
#: lazarusidestrconsts:dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Générer du code pour gprof"
|
||
|
||
#: lazarusidestrconsts:dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Générer le code pour valgrind"
|
||
|
||
#: lazarusidestrconsts:dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr "Générer:"
|
||
|
||
#: lazarusidestrconsts:rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Allemand"
|
||
|
||
#: lazarusidestrconsts:dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Lire la position"
|
||
|
||
#: lazarusidestrconsts:lispldglobal
|
||
msgid "Global"
|
||
msgstr "Global"
|
||
|
||
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Chemin complémentaire de sources globales"
|
||
|
||
#: lazarusidestrconsts:srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Aller au signet %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Aller à l'éditeur %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr "Aller à la ligne numéro"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Aller au marqueur 0"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Aller au marqueur 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Aller au marqueur 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Aller au marqueur 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Aller au marqueur 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Aller au marqueur 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Aller au marqueur 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Aller au marqueur 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Aller au marqueur 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Aller au marqueur 9"
|
||
|
||
#: lazarusidestrconsts:srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Aller à la parenthèse assortie"
|
||
|
||
#: lazarusidestrconsts:srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Aller à l'éditeur suivant"
|
||
|
||
#: lazarusidestrconsts:srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Aller à l'éditeur précédent"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Aller à éditeur de source 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Aller à éditeur de source 10"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Aller à éditeur de source 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Aller à éditeur de source 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Aller à éditeur de source 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Aller à éditeur de source 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Aller à éditeur de source 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Aller à éditeur de source 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Aller à éditeur de source 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Aller à éditeur de source 9"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr "Aller à la déclaration d'inclusion du fichier courant"
|
||
|
||
#: lazarusidestrconsts:listodogoto
|
||
msgid "Goto"
|
||
msgstr "Aller"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Aller en XY"
|
||
|
||
#: lazarusidestrconsts:lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr "Aller à la directive \"Include\""
|
||
|
||
#: lazarusidestrconsts:lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr "Aller à la ligne ..."
|
||
|
||
#: lazarusidestrconsts:lisuegotoline
|
||
msgid "Goto line :"
|
||
msgstr "Aller à la ligne :"
|
||
|
||
#: lazarusidestrconsts:uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr "Aller au prochain marqueur"
|
||
|
||
#: lazarusidestrconsts:uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr "Aller au marqueur précédent"
|
||
|
||
#: lazarusidestrconsts:listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr "Aller à la ligne du source sélectionnée"
|
||
|
||
#: lazarusidestrconsts:srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr "Touche d'accroche"
|
||
|
||
#: lazarusidestrconsts:srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr "Saisir la deuxième touche"
|
||
|
||
#: lazarusidestrconsts:dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Couleur d'accroches"
|
||
|
||
#: lazarusidestrconsts:dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Grille"
|
||
|
||
#: lazarusidestrconsts:dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Couleur de la grille"
|
||
|
||
#: lazarusidestrconsts:dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Taille de grille X"
|
||
|
||
#: lazarusidestrconsts:dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Taille de grille Y"
|
||
|
||
#: lazarusidestrconsts:lisgroup
|
||
msgid "Group"
|
||
msgstr "Groupe"
|
||
|
||
#: lazarusidestrconsts:dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Groupe défaire"
|
||
|
||
#: lazarusidestrconsts:lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr "Agradir au plus grand"
|
||
|
||
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr "Identifier les $IFDEF mal placés"
|
||
|
||
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr "Identifier les IFDEF/ENDIF mal placés"
|
||
|
||
#: lazarusidestrconsts:lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr "Identifier les blocs non terminés"
|
||
|
||
#: lazarusidestrconsts:dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Lignes guides"
|
||
|
||
#: lazarusidestrconsts:dlgguttercolor
|
||
msgid "Gutter color"
|
||
msgstr "Couleur de gouttière"
|
||
|
||
#: lazarusidestrconsts:dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Largeur de gouttière"
|
||
|
||
#: lazarusidestrconsts:lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr "CONSEIL :"
|
||
|
||
#: lazarusidestrconsts:dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Défilement d'une demi-page"
|
||
|
||
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Gérer l'événement OnClick"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Gérer par"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Handled by Debugger"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Handled by Program"
|
||
|
||
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "A une procédure Register"
|
||
|
||
#: lazarusidestrconsts:lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Commentaire d'en-tête pour la classe"
|
||
|
||
#: lazarusidestrconsts:dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr "Taille de pile"
|
||
|
||
#: lazarusidestrconsts:rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Hébreu"
|
||
|
||
#: lazarusidestrconsts:dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Hauteur:"
|
||
|
||
#: lazarusidestrconsts:lispckedithelp
|
||
msgid "Help"
|
||
msgstr "Aide"
|
||
|
||
#: lazarusidestrconsts:lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Options de l'aide"
|
||
|
||
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr "Aide pour les messages du compilateur FreePascal"
|
||
|
||
#: lazarusidestrconsts:srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Commandes du menu Aide"
|
||
|
||
#: lazarusidestrconsts:lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Sélecteur d'aide"
|
||
|
||
#: lazarusidestrconsts:lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr "Hexadécimal"
|
||
|
||
#: lazarusidestrconsts:dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Cacher l'IDE à l'exécution"
|
||
|
||
#: lazarusidestrconsts:uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr "Surligneur"
|
||
|
||
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr "Suggestion : Vérifier si deux paquets contiennent une unité du même nom."
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Conseil : la fonction Make Ressourcestring s'attend à une constante chaîne.%sVeuillez choisir seulement une expression de type chaîne et essayer de nouveau."
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Conseil : la fonction Make Ressourcestring s'attend à une constante chaîne.%sVeuillez choisir l'expression et essayer de nouveau."
|
||
|
||
#: lazarusidestrconsts:dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr "Conseil : cliquez sur une commande pour l'éditer"
|
||
|
||
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr "Conseil : vous pouvez définir le chemin du compilateur dans Configuration->Options d'environnement->Fichiers->Chemin du compilateur."
|
||
|
||
#: lazarusidestrconsts:dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Conseils pour la palette de composants"
|
||
|
||
#: lazarusidestrconsts:dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Conseils pour les principaux boutons rapides (Ouvrir, Enregistrer, ...) "
|
||
|
||
#: lazarusidestrconsts:lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr "Conseils :"
|
||
|
||
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "La touche Home va au plus proche début"
|
||
|
||
#: lazarusidestrconsts:lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Horizontal"
|
||
|
||
#: lazarusidestrconsts:dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Espacement horizontal de la grille"
|
||
|
||
#: lazarusidestrconsts:dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Application hôte"
|
||
|
||
#: lazarusidestrconsts:uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Je vous l'ai dit : pas encore implémenté"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts:liside
|
||
msgid "IDE"
|
||
msgstr "IDE"
|
||
|
||
#: lazarusidestrconsts:lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Intégration de l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisideintf
|
||
msgid "IDE Interface"
|
||
msgstr "Iinterface IDE"
|
||
|
||
#: lazarusidestrconsts:lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Options de l'IDE :"
|
||
|
||
#: lazarusidestrconsts:lismenuideinternals
|
||
msgid "IDE internals"
|
||
msgstr "IDE Internes"
|
||
|
||
#: lazarusidestrconsts:lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr "L'IDE est occupé"
|
||
|
||
#: lazarusidestrconsts:uepins
|
||
msgid "INS"
|
||
msgstr "INS"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
||
msgid "Identifier"
|
||
msgstr "Identificateur"
|
||
|
||
#: lazarusidestrconsts:lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "L'identificateur commence par…"
|
||
|
||
#: lazarusidestrconsts:dlgedidcomlet
|
||
msgid "Identifier completion"
|
||
msgstr "Compléter l'identificateur"
|
||
|
||
#: lazarusidestrconsts:lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "Identificateur contient ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Longueur d'identificateur :"
|
||
|
||
#: lazarusidestrconsts:dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Politique des identificateurs"
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Préfixe de l'identificateur :"
|
||
|
||
#: lazarusidestrconsts:lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Identificateur : %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts:uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Si VOUS souhaitez aider à implémenter cette fonctionnalité, envoyez un mail à lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts:dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ignorer"
|
||
|
||
#: lazarusidestrconsts:lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ignorer les espaces"
|
||
|
||
#: lazarusidestrconsts:lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr "Ignorer tout"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ignorer le nombre d'espaces"
|
||
|
||
#: lazarusidestrconsts:lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr "Ignorer et continuer"
|
||
|
||
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ignorer et sauver le paquet maintenant "
|
||
|
||
#: lazarusidestrconsts:lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ignorer les binaires"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ignorer les différences de fin de lignes (#10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ignorer les changements sur disque"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ignorer lignes vides ajoutées ou supprimées"
|
||
|
||
#: lazarusidestrconsts:lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ignorer le fichier absent"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ignorer les espaces (sauf caract. de nouvelle ligne)"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ignorer les espaces en fin de ligne"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ignorer les espaces en début de ligne"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ignorer ces exceptions"
|
||
|
||
#: lazarusidestrconsts:lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr "Ignorer, employer TForm comme ancêtre "
|
||
|
||
#: lazarusidestrconsts:srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Ime Str"
|
||
|
||
#: lazarusidestrconsts:lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Liste d'importation"
|
||
|
||
#: lazarusidestrconsts:dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Devant les méthodes"
|
||
|
||
#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr "Afin de créer une copie prope du projet/paquet, tous les fichiers dans le répertoire suivant seront supprimés et tout son contenu sera perdu.%s%sSupprimer tous les fichiers dans %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Inclure"
|
||
|
||
#: lazarusidestrconsts:dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr "Inclure le code d'assertion"
|
||
|
||
#: lazarusidestrconsts:dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr "Inclusion des fichiers (-Fi) :"
|
||
|
||
#: lazarusidestrconsts:lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr "Inclure le filtre"
|
||
|
||
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
|
||
msgid "Include Version Info in executable"
|
||
msgstr "Inclure Version Info dans l'exécutable"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Fichier inclus"
|
||
|
||
#: lazarusidestrconsts:lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Inclure les chemins"
|
||
|
||
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr "Inclure les sous-répertoires"
|
||
|
||
#: lazarusidestrconsts:dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Inclure les variables système"
|
||
|
||
#: lazarusidestrconsts:lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Inclus par :"
|
||
|
||
#: lazarusidestrconsts:lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Recherche incrémentale"
|
||
|
||
#: lazarusidestrconsts:srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Indenter le bloc"
|
||
|
||
#: lazarusidestrconsts:dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Indenter jusqu'à"
|
||
|
||
#: lazarusidestrconsts:lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr "Indenter la sélection"
|
||
|
||
#: lazarusidestrconsts:lisindex
|
||
msgid "Index"
|
||
msgstr "Index"
|
||
|
||
#: lazarusidestrconsts:rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Indonésien"
|
||
|
||
#: lazarusidestrconsts:lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Informations sur %s"
|
||
|
||
#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
|
||
msgid "Inherit from an existing component."
|
||
msgstr "Hériter d'un élément existant."
|
||
|
||
#: lazarusidestrconsts:liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr "Héritage"
|
||
|
||
#: lazarusidestrconsts:dlgcoinherited
|
||
msgid "Inherited"
|
||
msgstr "Hérité"
|
||
|
||
#: lazarusidestrconsts:lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr "Élément héritée"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolinsert
|
||
msgid "Insert"
|
||
msgstr "Insérer"
|
||
|
||
#: lazarusidestrconsts:liskminsertifdef
|
||
msgid "Insert $IFDEF"
|
||
msgstr "Insérer $IFDEF..."
|
||
|
||
#: lazarusidestrconsts:lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr "Insérer $IFDEF..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Insérer le mot-clé CVS Author"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Insérer le mot-clé CVS Date"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Insérer le mot-clé CVS Header"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Insérer le mot-clé CVS ID"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Insérer le mot-clé CVS Log"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Insérer le mot-clé CVS Name"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Insérer le mot-clé CVS Revision"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Insérer le mot-clé CVS Source"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Ajouter une entrée au ChangeLog"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Insérer un modèle projet Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Insérer un modèle projet Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Insérer la source d'exemple Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr "Insérer depuis le modèle ..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Insérer la notice GPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Insérer un modèle compilateur Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Insérer un modèle répertoire Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Insérer un modèle projet Kylix 3"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Insérer la notice LGPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Insérer un modèle répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr "Insérer une macro"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Mode insertion"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Insérer un nouvel élément (après)"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Insérer un nouvel élément (avant)"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Insérer un modèle"
|
||
|
||
#: lazarusidestrconsts:listddinserttodo
|
||
msgid "Insert ToDo"
|
||
msgstr "Insérer ToDo"
|
||
|
||
#: lazarusidestrconsts:ueminserttodo
|
||
msgid "Insert Todo"
|
||
msgstr "Insérer Todo"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr "Insérer un GUID"
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr "Insérer un lien"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Insérer par ordre alphabétique"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Insérer une balise de formatage gras"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Insérer une balise de formatage code"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Insérer en tenant compte du contexte"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Insérer la date et l'heure courantes"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Insérer le nom d'utilisateur"
|
||
|
||
#: lazarusidestrconsts:liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Insérer la date et l'heure"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr "Insérer depuis la table des caractères"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Insérer depuis la table des caractères"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Insérer une balise de formatage italique"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Insérer la notice modifié LGPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Insérer un noeud enfant"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Insérer un noeud ci-dessous"
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr "Insérer une balise de formatage paragraphe"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Insérer une balise de formatage remarque"
|
||
|
||
#: lazarusidestrconsts:dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Insérer un espace après"
|
||
|
||
#: lazarusidestrconsts:dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Insérer un espace devant"
|
||
|
||
#: lazarusidestrconsts:lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr "Insérer un texte"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Insérer une balise de formatage souligner"
|
||
|
||
#: lazarusidestrconsts:liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Insérer le nom d'utilisateur"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Insérer une balise de formatage variable"
|
||
|
||
#: lazarusidestrconsts:liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Inspecter"
|
||
|
||
#: lazarusidestrconsts:lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr "Inspecter..."
|
||
|
||
#: lazarusidestrconsts:lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Installer"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Installer au prochain démarrage"
|
||
|
||
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Installer le paquet dans l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Installer la sélection"
|
||
|
||
#: lazarusidestrconsts:lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Installation ratée"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Installé"
|
||
|
||
#: lazarusidestrconsts:lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr "Paquets installés"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "Intaller le paquet %s installera automatiquement le paquet :"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "Installer le paquet %s installera automatiquement les paquets :"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
||
msgid "Interface"
|
||
msgstr "Interface"
|
||
|
||
#: lazarusidestrconsts:listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Erreur interne du compilateur ! (%d)"
|
||
|
||
#: lazarusidestrconsts:dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Intervalle en sec"
|
||
|
||
#: lazarusidestrconsts:lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr "Invalide (Off)"
|
||
|
||
#: lazarusidestrconsts:lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr "Invalide (On)"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Type d'ancêtre non valide"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr "Cercle invalide"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Nom de class non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr "Nom de compilateur non valide"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Filtre d'exclusion non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Répertoire source Free Pascal non valide"
|
||
|
||
#: lazarusidestrconsts:lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "identificateur non valide"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr "Filtre d'inclusion non valide"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Version Min-Max non valide"
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Identificateur Pascal invalide"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Section ResourceString non valide"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr "Répertoire Test non valide"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Nom d'unité non valide : %s"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcircle
|
||
msgid "Invalid circle"
|
||
msgstr "Cercle invalide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Commande non valide"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr "Compilateur non valide"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Nom de fichier compilateur invalide"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Classe de composant non valide"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Nom de débogueur invalide"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Effacement non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Répertoire de destination non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Expression non valide.%sConseil: la fonction Make Resourcestring s'attend à une constante de type chaîne dans un fichier unique. Veuillez choisir l'expression et réessayer."
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr "Expression non valide :%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Fichier non valide"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Extension de fichier non valide"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nom de fichier non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr "Filtre non valide"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Nom de fichier 'make' non valide"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Version maximum non valide"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Version minimum non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Sélection multiple non valide"
|
||
|
||
#: lazarusidestrconsts:liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Option non valide à la position %d : \"%s \""
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "ID de paquet non valide : %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Extension de fichier paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Nom de fichier paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Type de paquet non valide"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Nom de paquet non valide"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Parent non valide"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Noeud parent non valide"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Nom d'unité Pascal invalide"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Noeud précédent non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Nom de procédure non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Nom de fichier projet non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr "Répertoire de publication non valide"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr "Chemin de recherche non valide"
|
||
|
||
#: lazarusidestrconsts:lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Sélection non valide"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Nom de fichier d'unité non valide"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Nom de variable non valide"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Version non valide"
|
||
|
||
#: lazarusidestrconsts:dlgedinvert
|
||
msgid "Invert"
|
||
msgstr "Inverser"
|
||
|
||
#: lazarusidestrconsts:ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr "Inverser l'assignation"
|
||
|
||
#: lazarusidestrconsts:srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr "Inverser l'assignation"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr "Fichier xml des restrictions"
|
||
|
||
#: lazarusidestrconsts:rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Italien"
|
||
|
||
#: lazarusidestrconsts:dlgedital
|
||
msgid "Italic"
|
||
msgstr "Italique"
|
||
|
||
#: lazarusidestrconsts:dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Hauteur d'élément"
|
||
|
||
#: lazarusidestrconsts:lisjitform
|
||
msgid "JIT Form"
|
||
msgstr "Fiche JIT"
|
||
|
||
#: lazarusidestrconsts:rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Japonais"
|
||
|
||
#: lazarusidestrconsts:lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Aller à la sélection"
|
||
|
||
#: lazarusidestrconsts:lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr "En arrière"
|
||
|
||
#: lazarusidestrconsts:lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr "En avant"
|
||
|
||
#: lazarusidestrconsts:lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Aller à"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr "Aller au prochain signet"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr "Erreur suivante"
|
||
|
||
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr "Aller au précédent signet"
|
||
|
||
#: lazarusidestrconsts:lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr "Erreur précédente"
|
||
|
||
#: lazarusidestrconsts:dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Sauts"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Préserver tous les fichiers texte"
|
||
|
||
#: lazarusidestrconsts:dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr "Préserver certaines variables dans les registres"
|
||
|
||
#: lazarusidestrconsts:dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr "Préserver la position X du curseur"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Préserver les fichiers correspondant au filtre"
|
||
|
||
#: lazarusidestrconsts:liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Préserver le nom"
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Préserver l'ordre des procédures"
|
||
|
||
#: lazarusidestrconsts:liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Préserver et continuer"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolkey
|
||
msgid "Key"
|
||
msgstr "Touche"
|
||
|
||
#: lazarusidestrconsts:liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr "Touche (ou combinaison de 2 touches)"
|
||
|
||
#: lazarusidestrconsts:srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr "Touche (ou combinaison de 2 touches)"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Modèle de clavier"
|
||
|
||
#: lazarusidestrconsts:dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Assignation des touches"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Erreurs d'assignation de touches"
|
||
|
||
#: lazarusidestrconsts:liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Modèle de clavier"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Mot-clé"
|
||
|
||
#: lazarusidestrconsts:dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Politique de mot-clé"
|
||
|
||
#: lazarusidestrconsts:lislcl
|
||
msgid "LCL"
|
||
msgstr "LCL"
|
||
|
||
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Options spécifiques à l'interface LCL:"
|
||
|
||
#: lazarusidestrconsts:lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr "Type composant graphique LCL"
|
||
|
||
#: lazarusidestrconsts:lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr "Interface LCL"
|
||
|
||
#: lazarusidestrconsts:lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr "Chemin de l'unité LCL manquant"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "Fiche Lazarus texte - LFM"
|
||
|
||
#: lazarusidestrconsts:lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "Fichier LFM"
|
||
|
||
#: lazarusidestrconsts:lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Fichier LFM corrompu"
|
||
|
||
#: lazarusidestrconsts:lislfmfilenotfound
|
||
msgid "LFM file not found"
|
||
msgstr "Fichier LFM introuvable"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr "Notice LGPL"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "Fichier ressource Lazarus - LRS"
|
||
|
||
#: lazarusidestrconsts:dlgenvlanguage
|
||
msgid "Language"
|
||
msgstr "Langue"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Exceptions de langue"
|
||
|
||
#: lazarusidestrconsts:rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr "Options de langue"
|
||
|
||
#: lazarusidestrconsts:rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr "Sélection de la langue:"
|
||
|
||
#: lazarusidestrconsts:dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Fin"
|
||
|
||
#: lazarusidestrconsts:dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Fin (du source)"
|
||
|
||
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Lancer l'application"
|
||
|
||
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Lancement de l'application non valide"
|
||
|
||
#: lazarusidestrconsts:lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Lancement de la cible avec la ligne de commande"
|
||
|
||
#: lazarusidestrconsts:lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Paramêtres du bureau Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Répertoire Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr "Fichier Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "Lazarus IDE"
|
||
|
||
#: lazarusidestrconsts:lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr "Lazarus IDE v%s"
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "fichier d'information du projet Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Répertoire de configuration de Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Répertoire de Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Répertoire de Lazarus (défaut pour tous les projets)"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Répertoire de Lazarus \"%s\" non trouvé"
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Répertoire de Lazarus introuvable"
|
||
|
||
#: lazarusidestrconsts:lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "fiche Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr "Lazarus incluent le fichier"
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Identification de langue de Lazarrus (par exemple en, De, Br, fi)"
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Nom de langue de Lazarrus (par exemple english, deutsch)"
|
||
|
||
#: lazarusidestrconsts:lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "paquet Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "projet Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "source du projet Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "unité Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Laissez vide pour le fichier .po par défaut"
|
||
|
||
#: lazarusidestrconsts:lisleft
|
||
msgid "Left"
|
||
msgstr "Gauche"
|
||
|
||
#: lazarusidestrconsts:lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Côtés gauches"
|
||
|
||
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr "L'espace de bordure gauche. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à gauche du contrôle."
|
||
|
||
#: lazarusidestrconsts:lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Côtés gauches"
|
||
|
||
#: lazarusidestrconsts:lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Espacement gauche égal"
|
||
|
||
#: lazarusidestrconsts:dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Gauche :"
|
||
|
||
#: lazarusidestrconsts:dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr "Niveau 0 (pas d'optimisations additionnelles)"
|
||
|
||
#: lazarusidestrconsts:dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr "Niveau 1 (rapide et débogueur amical)"
|
||
|
||
#: lazarusidestrconsts:dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr "Niveau 2 (niveau 1 + optimisations rapide)"
|
||
|
||
#: lazarusidestrconsts:dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr "Niveau 3 (niveau 2 + optimisations lentes)"
|
||
|
||
#: lazarusidestrconsts:lislevels
|
||
msgid "Levels"
|
||
msgstr "Niveaux"
|
||
|
||
#: lazarusidestrconsts:dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Librairies (-Fl):"
|
||
|
||
#: lazarusidestrconsts:lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Librairie"
|
||
|
||
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr "Bibliothèque%sune bibliothèque freepascal (.dll sous windows, .so linux, .dylib sous macosx). Le fichier source de la bibliothèque est automatiquement maintenu par Lazarrus."
|
||
|
||
#: lazarusidestrconsts:lispckoptslicense
|
||
msgid "License:"
|
||
msgstr "Licence :"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr "Licence : GPL/LGPL%sLazarus est un IDE pour créer des applications (graphiques et consoles ) avec Free Pascal. Free Pascal est un compilateur (L)GPL Pascal et Objet Pascal fonctionnent sur Windows, Linux, Mac OS X, FreeBSD et plus .%sLazarus est une pièce maitresse pour le développement d'applications multi-plateformes. A l'image de Delphi (uniquement sous Windows) cet EDI (Environnement de développement intégré ou IDE en anglais) est un outil de \"Développement rapide d'applications\" (ou RAD an anglais).%sComme Lazarus est grandissant nous avons besoin de plus de développeurs."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr "Limite de linecount à "
|
||
|
||
#: lazarusidestrconsts:listodolline
|
||
msgid "Line"
|
||
msgstr "Ligne"
|
||
|
||
#: lazarusidestrconsts:dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Coupure de ligne"
|
||
|
||
#: lazarusidestrconsts:srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Mode sélection de ligne"
|
||
|
||
#: lazarusidestrconsts:lislinelength
|
||
msgid "Line/Length"
|
||
msgstr "Ligne/longueur"
|
||
|
||
#: lazarusidestrconsts:lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Lignes"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildlines
|
||
msgid "Lines:"
|
||
msgstr "Lignes :"
|
||
|
||
#: lazarusidestrconsts:dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr "Lien intelligent"
|
||
|
||
#: lazarusidestrconsts:dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr "Style de lien :"
|
||
|
||
#: lazarusidestrconsts:lislinktarget
|
||
msgid "Link target"
|
||
msgstr "Lien cible"
|
||
|
||
#: lazarusidestrconsts:lislink
|
||
msgid "Link:"
|
||
msgstr "Lien :"
|
||
|
||
#: lazarusidestrconsts:lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Editeur de liens"
|
||
|
||
#: lazarusidestrconsts:dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Edition des liens"
|
||
|
||
#: lazarusidestrconsts:liscmplstlist
|
||
msgid "List"
|
||
msgstr "Liste"
|
||
|
||
#: lazarusidestrconsts:rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Lithuanian"
|
||
|
||
#: lazarusidestrconsts:dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Charger les paramètres du bureau"
|
||
|
||
#: lazarusidestrconsts:lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Chager depuis un fichier"
|
||
|
||
#: lazarusidestrconsts:dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Charger/Enregistrer"
|
||
|
||
#: lazarusidestrconsts:lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Paquets chargés :"
|
||
|
||
#: lazarusidestrconsts:lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr "Le chargement de%s a échoué."
|
||
|
||
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Le chargement du paquet %s remplacera le paquet %s%sdu fichier %s.%sL'ancien paquet est modifié.%s%s Enregister l'ancien paquet %s ?"
|
||
|
||
#: lazarusidestrconsts:dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Local"
|
||
|
||
#: lazarusidestrconsts:lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Variables locales"
|
||
|
||
#: lazarusidestrconsts:lislocals
|
||
msgid "Locals"
|
||
msgstr "Locales"
|
||
|
||
#: lazarusidestrconsts:lislogo
|
||
msgid "Logo"
|
||
msgstr "Logo"
|
||
|
||
#: lazarusidestrconsts:lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr "Mettre la sélection en minuscules"
|
||
|
||
#: lazarusidestrconsts:dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Minuscules mais première lettre en majuscule"
|
||
|
||
#: lazarusidestrconsts:liskmmacosx
|
||
msgid "Mac OS X"
|
||
msgstr "Mac OS X"
|
||
|
||
#: lazarusidestrconsts:lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr "Mac Pascal"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Macros"
|
||
|
||
#: lazarusidestrconsts:dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Menu principal"
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr "L'unité principale a une déclaration Application.CreateForm"
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr "L'unité principale a une déclaration Application.Title"
|
||
|
||
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr "L'unité principale a une section Uses contenant toutes les unités du projet"
|
||
|
||
#: lazarusidestrconsts:lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr "L'unité principale est un source Pascal"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Principal"
|
||
|
||
#: lazarusidestrconsts:rsmajorrevision
|
||
msgid "Major revision:"
|
||
msgstr "Révision Majeur :"
|
||
|
||
#: lazarusidestrconsts:lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Créer un exécutable"
|
||
|
||
#: lazarusidestrconsts:lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Construire une chaîne ressource ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Construire une chaîne ressource"
|
||
|
||
#: lazarusidestrconsts:lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "'Make' introuvable"
|
||
|
||
#: lazarusidestrconsts:dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Chemin de 'make'"
|
||
|
||
#: lazarusidestrconsts:srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr "Faire une chaîne ressource"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Compilation manuelle (jamais automatique)"
|
||
|
||
#: lazarusidestrconsts:dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Marge et gouttière"
|
||
|
||
#: lazarusidestrconsts:dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Couleur de signet"
|
||
|
||
#: lazarusidestrconsts:lissmatches
|
||
msgid "Matches"
|
||
msgstr "Matchs"
|
||
|
||
#: lazarusidestrconsts:lismaxs
|
||
msgid "Max %d"
|
||
msgstr "Max %d"
|
||
|
||
#: lazarusidestrconsts:dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Longueur maxi d'une ligne:"
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Fichiers récents max."
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Fichiers projet récents max."
|
||
|
||
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Nombre maximum d'outils atteint"
|
||
|
||
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Version max. (optionnel)"
|
||
|
||
#: lazarusidestrconsts:lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Version maximum :"
|
||
|
||
#: lazarusidestrconsts:dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Nombre maximum"
|
||
|
||
#: lazarusidestrconsts:lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr "Mémoire Dump"
|
||
|
||
#: lazarusidestrconsts:lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Editeur de menu"
|
||
|
||
#: lazarusidestrconsts:lismenuviewmessages
|
||
msgid "Messages"
|
||
msgstr "Messages"
|
||
|
||
#: lazarusidestrconsts:lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr "Méthode classe introuvable"
|
||
|
||
#: lazarusidestrconsts:dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Politique d'insertion des méthodes"
|
||
|
||
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
||
msgid "Minimize all on minimize main"
|
||
msgstr "Réduire toutes les fenêtre en même temps que la principale"
|
||
|
||
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Version min. (optionnel) :"
|
||
|
||
#: lazarusidestrconsts:lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Version minimum :"
|
||
|
||
#: lazarusidestrconsts:lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Mineur"
|
||
|
||
#: lazarusidestrconsts:rsminorrevision
|
||
msgid "Minor revision:"
|
||
msgstr "Révision mineur :"
|
||
|
||
#: lazarusidestrconsts:fdmmirrorhorizontal
|
||
msgid "Mirror horizontal"
|
||
msgstr "Miroir horizontal"
|
||
|
||
#: lazarusidestrconsts:fdmmirrorvertical
|
||
msgid "Mirror vertical"
|
||
msgstr "Miroir vertical"
|
||
|
||
#: lazarusidestrconsts:dlgenvmisc
|
||
msgid "Miscellaneous"
|
||
msgstr "Divers"
|
||
|
||
#: lazarusidestrconsts:lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Evènement manquants"
|
||
|
||
#: lazarusidestrconsts:lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Paquets manquants"
|
||
|
||
#: lazarusidestrconsts:lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr "Identificateurs manquent"
|
||
|
||
#: lazarusidestrconsts:lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr "Unité manquante"
|
||
|
||
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Mélange de méthodes et de propriétés"
|
||
|
||
#: lazarusidestrconsts:uemodified
|
||
msgid "Modified"
|
||
msgstr "Modifié"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL notice"
|
||
msgstr "Notification modifiée de LGPL"
|
||
|
||
#: lazarusidestrconsts:lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Modifié : %s"
|
||
|
||
#: lazarusidestrconsts:listodolfile
|
||
msgid "Module"
|
||
msgstr "Module"
|
||
|
||
#: lazarusidestrconsts:lismore
|
||
msgid "More"
|
||
msgstr "Plus"
|
||
|
||
#: lazarusidestrconsts:lispckeditmore
|
||
msgid "More ..."
|
||
msgstr "Plus ..."
|
||
|
||
#: lazarusidestrconsts:dlgmouselinks
|
||
msgid "Mouse links"
|
||
msgstr "Liens souris"
|
||
|
||
#: lazarusidestrconsts:lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Déplacer vers le bas (ou à droite)"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleft
|
||
msgid "Move Editor Left"
|
||
msgstr "Déplacer la page vers la gauche"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleftmost
|
||
msgid "Move Editor Leftmost"
|
||
msgstr "Déplacer l'editeur vers la gauche"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorright
|
||
msgid "Move Editor Right"
|
||
msgstr "Déplacer la page vers la droite"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorrightmost
|
||
msgid "Move Editor Rightmost"
|
||
msgstr "Déplacer l'editeur vers la droite"
|
||
|
||
#: lazarusidestrconsts:lismovepage
|
||
msgid "Move Page ..."
|
||
msgstr "Déplacer la page..."
|
||
|
||
#: lazarusidestrconsts:lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Déplacer vers le haut (ou gauche)"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Déplacer le composant vers l'arrière de un"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Déplacer le composant vers l'avant de un"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Déplacer le composant à arrière"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Déplacer le composant à avant"
|
||
|
||
#: lazarusidestrconsts:srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Déplacer le curseur une page vers le bas"
|
||
|
||
#: lazarusidestrconsts:srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Déplacer le curseur une page à gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Déplacer le curseur une page à droite"
|
||
|
||
#: lazarusidestrconsts:srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Déplacer le curseur au début absolu"
|
||
|
||
#: lazarusidestrconsts:srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Déplacer le curseur à la fin absolue"
|
||
|
||
#: lazarusidestrconsts:srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Déplacer le curseur au bas de la page"
|
||
|
||
#: lazarusidestrconsts:srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Déplacer le curseur en fin de ligne"
|
||
|
||
#: lazarusidestrconsts:srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Déplacer le curseur en début de ligne"
|
||
|
||
#: lazarusidestrconsts:srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Déplacer le curseur en haut de la page"
|
||
|
||
#: lazarusidestrconsts:srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Déplacer le curseur d'une page vers le haut"
|
||
|
||
#: lazarusidestrconsts:srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Déplacer le curseur d'un mot à gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Déplacer le curseur d'un mot à droite"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Déplacer la dépendance vers le bas"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Déplacer la dépendance vers le haut"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Déplacer l'éditeur vers la gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr "Déplacer l'editeur vers la gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Déplacer l'éditeur vers la droite"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr "Déplacer l'editeur vers la droite"
|
||
|
||
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Déplacer les entrées à hérité"
|
||
|
||
#: lazarusidestrconsts:lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr "Déplacez le fichier vers le bas"
|
||
|
||
#: lazarusidestrconsts:lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr "Déplacez le fichier vers le haut"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Déplacer le noeud vers le bas"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Déplacer le noeud d'un niveau vers le bas"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Déplacer le noeud d'un niveau vers le haut"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Déplacer le noeud vers le haut"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Descendre le chemin"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Monter le Chemin"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetoback
|
||
msgid "Move to back"
|
||
msgstr "Déplacer en arrière"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetofront
|
||
msgid "Move to front"
|
||
msgstr "Déplacer en avant"
|
||
|
||
#: lazarusidestrconsts:dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Multi sélection"
|
||
|
||
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Les composants sélectionnés doivent être sur une même fiche."
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "NOTE : fichier de configuration codetools non trouvé. Valeurs par défaut utilisées."
|
||
|
||
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "NOTE : chargement de l'ancien fichier d'options de codetools"
|
||
|
||
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "NOTE : seulement des chemins absolus sont supporté maintenant"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
||
msgid "Name"
|
||
msgstr "Nom"
|
||
|
||
#: lazarusidestrconsts:lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr "Conflit de nom"
|
||
|
||
#: lazarusidestrconsts:lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Nom de la nouvelle procédure"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsname
|
||
msgid "Name:"
|
||
msgstr "Nom :"
|
||
|
||
#: lazarusidestrconsts:dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Appellation"
|
||
|
||
#: lazarusidestrconsts:lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Jamais, seulement manuel"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Nouveau"
|
||
|
||
#: lazarusidestrconsts:lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Nouveau..."
|
||
|
||
#: lazarusidestrconsts:lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Nouveaux ancêtres"
|
||
|
||
#: lazarusidestrconsts:lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Nouvelle classe"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Nouveau composant"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Nouveau fichier"
|
||
|
||
#: lazarusidestrconsts:lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Nouvelle fiche"
|
||
|
||
#: lazarusidestrconsts:lispwnewproject
|
||
msgid "New Project"
|
||
msgstr "Nouveau projet"
|
||
|
||
#: lazarusidestrconsts:lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Nouveau projet ..."
|
||
|
||
#: lazarusidestrconsts:lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr "Nouveau projet depuis le fichier ..."
|
||
|
||
#: lazarusidestrconsts:lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Nouvelle condition"
|
||
|
||
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr "Nouvelle description de modèle..."
|
||
|
||
#: lazarusidestrconsts:lismenunewunit
|
||
msgid "New Unit"
|
||
msgstr "Nouvelle unité"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Nouveau nom de class:"
|
||
|
||
#: lazarusidestrconsts:liskmnewpackage
|
||
msgid "New package"
|
||
msgstr "Nouveau paquet"
|
||
|
||
#: lazarusidestrconsts:lismenunewpackage
|
||
msgid "New package ..."
|
||
msgstr "Nouveau paquet ..."
|
||
|
||
#: lazarusidestrconsts:liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Nouveau projet"
|
||
|
||
#: lazarusidestrconsts:liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Nouveau projet depuis le fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Nouvelle unité pas dans le chemin de recherche"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "NouveauNoeud"
|
||
|
||
#: lazarusidestrconsts:lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "NouveauPaquet"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "NouvelleLigne"
|
||
|
||
#: lazarusidestrconsts:srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Prochain signet"
|
||
|
||
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Section ResourceString non trouvée"
|
||
|
||
#: lazarusidestrconsts:lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr "Aucune méthode abstraite trouvé"
|
||
|
||
#: lazarusidestrconsts:lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Pas de fichiers de sauvegarde"
|
||
|
||
#: lazarusidestrconsts:lisnochange
|
||
msgid "No change"
|
||
msgstr "Pas de changement"
|
||
|
||
#: lazarusidestrconsts:lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Aucun code sélectionné"
|
||
|
||
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Aucune options de compilateur héritées"
|
||
|
||
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Pas de débugger spécifié"
|
||
|
||
#: lazarusidestrconsts:dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Pas d'erreurs trouvées dans l'assignation des touches"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Pas d'élément sélectionné"
|
||
|
||
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Pas de paquet trouvé pour la dépendance %s%s%s.%sChoisissez un paquet existant svp."
|
||
|
||
#: lazarusidestrconsts:lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Pas de paquet sélectionné"
|
||
|
||
#: lazarusidestrconsts:lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Fichier programme %s%s%s non trouvé."
|
||
|
||
#: lazarusidestrconsts:lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Constante chaîne non trouvée"
|
||
|
||
#: lazarusidestrconsts:lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr "Chemin LazDoc non valide"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Le noeud et ses enfants sont seulement valides pour ce projet"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Noeud en lecture seule"
|
||
|
||
#: lazarusidestrconsts:dlgenvnone
|
||
msgid "None"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts:dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr "Code normal"
|
||
|
||
#: lazarusidestrconsts:srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Mode de sélection normal"
|
||
|
||
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Normalement le filtre est une expression régulière. En syntaxe simple a . est un caractère normal, a * pour n'importe quoi , a ? pour tout caractère, et la virgule et le point-virgule sépare les solutions de rechange . Par exemple : Syntaxe simple *.pas;*.pp correspond à ^(.*\\.pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr "Pas un projet Delphi"
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr "Pas une unité Delphi"
|
||
|
||
#: lazarusidestrconsts:lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Non trouvé"
|
||
|
||
#: lazarusidestrconsts:lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr "Non implémenté"
|
||
|
||
#: lazarusidestrconsts:uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Non implémenté à ce jour"
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr "Non implémenté à ce jour."
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr "Non implémenté à ce jour :%s%s"
|
||
|
||
#: lazarusidestrconsts:lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Pas maintenant"
|
||
|
||
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
||
msgid "Note: All keys will be set to the values of the choosen scheme."
|
||
msgstr "Note : Toutes les clefs seront placées aux valeurs du thème choisie."
|
||
|
||
#: lazarusidestrconsts:lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr "Notes :"
|
||
|
||
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Note : les fichiers du projet sont tous ceux dans son répertoire"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Nombre"
|
||
|
||
#: lazarusidestrconsts:lisifdok
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Exceptions de l'OS"
|
||
|
||
#: lazarusidestrconsts:uepovr
|
||
msgid "OVR"
|
||
msgstr "REC"
|
||
|
||
#: lazarusidestrconsts:lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Objet"
|
||
|
||
#: lazarusidestrconsts:lismenuviewobjectinspector
|
||
msgid "Object Inspector"
|
||
msgstr "Inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts:liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Commandes de l'inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts:lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr "Objet Pascal - default"
|
||
|
||
#: lazarusidestrconsts:dlgedoff
|
||
msgid "Off"
|
||
msgstr "Off"
|
||
|
||
#: lazarusidestrconsts:lisokbtn
|
||
msgid "Ok"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts:lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Anciens ancêtres"
|
||
|
||
#: lazarusidestrconsts:lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Ancienne classe"
|
||
|
||
#: lazarusidestrconsts:dlgedon
|
||
msgid "On"
|
||
msgstr "On"
|
||
|
||
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Sur construire le projet, exécuter la commande du fichier à la place"
|
||
|
||
#: lazarusidestrconsts:lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "Quand inoccupée."
|
||
|
||
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Sur exécution du projet, exécuter la commande du fichier à la place"
|
||
|
||
#: lazarusidestrconsts:lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Aide en ligne"
|
||
|
||
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Aide en ligne pas encore implémentée"
|
||
|
||
#: lazarusidestrconsts:lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr "Seulement les fichiers existants"
|
||
|
||
#: lazarusidestrconsts:lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr "Publié seulement"
|
||
|
||
#: lazarusidestrconsts:lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Chercher les mots entiers seulement"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Sélection seulement"
|
||
|
||
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Seulement les fichiers texte"
|
||
|
||
#: lazarusidestrconsts:lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr "Seulement utilisé dans le mode catégorie"
|
||
|
||
#: lazarusidestrconsts:lishintopen
|
||
msgid "Open"
|
||
msgstr "Ouvrir"
|
||
|
||
#: lazarusidestrconsts:lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Ouvrir %s"
|
||
|
||
#: lazarusidestrconsts:lismenuopen
|
||
msgid "Open ..."
|
||
msgstr "Ouvrir ..."
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Ouvrir Différences dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts:lisopenfile2
|
||
msgid "Open File ..."
|
||
msgstr "Ouvrir un fichier..."
|
||
|
||
#: lazarusidestrconsts:liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Ouvrir le paquet %s"
|
||
|
||
#: lazarusidestrconsts:lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Ouvrir un fichier paquet"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Ouvrir le paquet ?"
|
||
|
||
#: lazarusidestrconsts:lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Ouvrir l'aperçu"
|
||
|
||
#: lazarusidestrconsts:lispwopenproject
|
||
msgid "Open Project"
|
||
msgstr "Ouvrir un projet"
|
||
|
||
#: lazarusidestrconsts:lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Ouvrir un projet ..."
|
||
|
||
#: lazarusidestrconsts:lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Ouvrir un fichier projet"
|
||
|
||
#: lazarusidestrconsts:lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Ouvrir le projet ?"
|
||
|
||
#: lazarusidestrconsts:lismenutemplateopenrecent
|
||
msgid "Open Recent"
|
||
msgstr "Réouvrir"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecent
|
||
msgid "Open Recent ..."
|
||
msgstr "Réouvrir ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr "Réouvrir un projet ..."
|
||
|
||
#: lazarusidestrconsts:liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Ouvrir l'unité %s"
|
||
|
||
#: lazarusidestrconsts:lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Ouvrir un fichier XML"
|
||
|
||
#: lazarusidestrconsts:lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Ouvrir le fichier existent"
|
||
|
||
#: lazarusidestrconsts:lisopenfile
|
||
msgid "Open file"
|
||
msgstr "Ouvrir un fichier"
|
||
|
||
#: lazarusidestrconsts:srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr "Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr "Ouvrir le fichier sous le curseur"
|
||
|
||
#: lazarusidestrconsts:dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "Ouvrir le dernier projet au démarrage"
|
||
|
||
#: lazarusidestrconsts:lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr "Ouvrir le paquet chargé"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr "Ouvrir le paquet chargé ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Ouvrir ou charger les options du compilateur"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Ouvrir un paquet"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr "Ouvrir le paquet %s"
|
||
|
||
#: lazarusidestrconsts:liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Ouvrir un fichier paquet"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr "Ouvrir un fichier paquet (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr "Ouvrir le paquet de l'unité courante"
|
||
|
||
#: lazarusidestrconsts:lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Ouvrir projet"
|
||
|
||
#: lazarusidestrconsts:lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Réouvrir projet"
|
||
|
||
#: lazarusidestrconsts:lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Ouverture récente"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr "Ouvrir un paquet récent ..."
|
||
|
||
#: lazarusidestrconsts:lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr "Ouvrir le lien symbolique"
|
||
|
||
#: lazarusidestrconsts:lisopentarget
|
||
msgid "Open target"
|
||
msgstr "Ouvrir la cible"
|
||
|
||
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Ouvrir le fichier en tant que source normale"
|
||
|
||
#: lazarusidestrconsts:lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Ouvrir le paquet %s ?"
|
||
|
||
#: lazarusidestrconsts:lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Ouvrir le projet %s ?"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Ouvrir l'unité"
|
||
|
||
#: lazarusidestrconsts:dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr "Optimisations:"
|
||
|
||
#: lazarusidestrconsts:liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "L'option à la position %d ne permet pas un argument : %s"
|
||
|
||
#: lazarusidestrconsts:liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "L'option à la position %d a besoin d'un argument : %s"
|
||
|
||
#: lazarusidestrconsts:fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Option : aligner sur la grille"
|
||
|
||
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Option : aligner sur les lignes guides"
|
||
|
||
#: lazarusidestrconsts:dlgfropts
|
||
msgid "Options"
|
||
msgstr "Options"
|
||
|
||
#: lazarusidestrconsts:lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Options :"
|
||
|
||
#: lazarusidestrconsts:dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Options : "
|
||
|
||
#: lazarusidestrconsts:fdmorder
|
||
msgid "Order"
|
||
msgstr "Ordre"
|
||
|
||
#: lazarusidestrconsts:dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Origine"
|
||
|
||
#: lazarusidestrconsts:dlgcoother
|
||
msgid "Other"
|
||
msgstr "Autre"
|
||
|
||
#: lazarusidestrconsts:dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Autres sources (fichiers .pp/.pas; utilisé seulement par l'IDE, pas par le compilateur)"
|
||
|
||
#: lazarusidestrconsts:dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr "Autres fichiers unité (-Fu) (le délimiteur est le point-virgule):"
|
||
|
||
#: lazarusidestrconsts:dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr "Autres fichiers"
|
||
|
||
#: lazarusidestrconsts:rsotherinfo
|
||
msgid "Other info"
|
||
msgstr "Autre information"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Sortie"
|
||
|
||
#: lazarusidestrconsts:dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr "Réglages de sortie"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Répertoire de destination"
|
||
|
||
#: lazarusidestrconsts:dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Débordement"
|
||
|
||
#: lazarusidestrconsts:lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr "Écraser la selection"
|
||
|
||
#: lazarusidestrconsts:lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr "Écraser la première selection"
|
||
|
||
#: lazarusidestrconsts:lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Outrepasser le langage. Par exemple --language=de. Pour les valeurs possibles voir dans le dossier languages."
|
||
|
||
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Surcharger une variable système"
|
||
|
||
#: lazarusidestrconsts:srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Mode recouvrement"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Ecraser les fichiers sur le disque"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Ecraser le fichier ?"
|
||
|
||
#: lazarusidestrconsts:listodolowner
|
||
msgid "Owner"
|
||
msgstr "Propriétaire"
|
||
|
||
#: lazarusidestrconsts:rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr "Répertoire de sortie PO"
|
||
|
||
#: lazarusidestrconsts:lispackage
|
||
msgid "Package"
|
||
msgstr "Paquet"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Paquet %s"
|
||
|
||
#: lazarusidestrconsts:lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Paquet %s non trouvé"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr "Paquet %s%s%s modifié. L'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Le paquet %s%s%s a changé.%sL'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Le paquet %s%s%s n'a pas de répertoire de destination valide : %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Paquet %s%s%s non trouvé"
|
||
|
||
#: lazarusidestrconsts:lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr "Graphique des paquets ..."
|
||
|
||
#: lazarusidestrconsts:lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr "Information paquet"
|
||
|
||
#: lazarusidestrconsts:lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr "Liens Paquet"
|
||
|
||
#: lazarusidestrconsts:lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Nom de paquet"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Nom du paquet :"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Options de paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgreg
|
||
msgid "Package Registration"
|
||
msgstr "Enregistrement d'un paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Marque de répertoire source des paquets"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Conflits de paquets"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Fichier paquet introuvable"
|
||
|
||
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Fichier paquet non trouvé"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr "Fichier paquet non enregistrer"
|
||
|
||
#: lazarusidestrconsts:liskmpackagegraph
|
||
msgid "Package graph"
|
||
msgstr "Graphique des paquets"
|
||
|
||
#: lazarusidestrconsts:dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Le paquet n'est pas un paquet de conception"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Le paquet est en lecture seule"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Le paquet est requis"
|
||
|
||
#: lazarusidestrconsts:lismenupackagelinks
|
||
msgid "Package links ..."
|
||
msgstr "Liens Paquet ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr "Commandes du menu Package"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Nom de paquet déjà existant"
|
||
|
||
#: lazarusidestrconsts:lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Le nom de paquet commence par…"
|
||
|
||
#: lazarusidestrconsts:lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Nom de paquet contient ..."
|
||
|
||
#: lazarusidestrconsts:lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Le paquet doit être installé"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Paquet non trouvé"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Paquet : %s"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr "Type de paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Les paquets doivent avoir l'extension .lpk"
|
||
|
||
#: lazarusidestrconsts:lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Paquets à installer dans l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Nom de page trop long"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Dessiner les éléments du designer seulement quand inactif (réduit la charge sur ordinateurs lents)"
|
||
|
||
#: lazarusidestrconsts:liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr "Palette"
|
||
|
||
#: lazarusidestrconsts:lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Page de palette :"
|
||
|
||
#: lazarusidestrconsts:lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Paragraphes"
|
||
|
||
#: lazarusidestrconsts:liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Paramêtre"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Paramètres :"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Le noeud parent ne peut contenir d'enfants"
|
||
|
||
#: lazarusidestrconsts:dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Analyse"
|
||
|
||
#: lazarusidestrconsts:lislazbuildabopart
|
||
msgid "Part"
|
||
msgstr "Partie"
|
||
|
||
#: lazarusidestrconsts:lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "Fichier source pascal"
|
||
|
||
#: lazarusidestrconsts:lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "Unité pascal"
|
||
|
||
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Les unités Pascal doivent avoir l'extension .pp ou .pas"
|
||
|
||
#: lazarusidestrconsts:lispasscount
|
||
msgid "Pass Count"
|
||
msgstr "Nombre de passe"
|
||
|
||
#: lazarusidestrconsts:dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr "Passez des options à l'éditeur de liens (séparés par des espaces)"
|
||
|
||
#: lazarusidestrconsts:lismenupaste
|
||
msgid "Paste"
|
||
msgstr "Coller"
|
||
|
||
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Coller les composants depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Coller le contenu du presse-papiers à la position courante"
|
||
|
||
#: lazarusidestrconsts:lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Coller les composants sélectionnés depuis le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr "Editeur de chemin"
|
||
|
||
#: lazarusidestrconsts:lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Chemin des modèles"
|
||
|
||
#: lazarusidestrconsts:listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Chemin :"
|
||
|
||
#: lazarusidestrconsts:dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Chemins"
|
||
|
||
#: lazarusidestrconsts:lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Chemins (lecture seule)"
|
||
|
||
#: lazarusidestrconsts:lismenupause
|
||
msgid "Pause"
|
||
msgstr "Pause"
|
||
|
||
#: lazarusidestrconsts:liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "suspendre le programme"
|
||
|
||
#: lazarusidestrconsts:dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr "Curseur persistant"
|
||
|
||
#: lazarusidestrconsts:lisccochecktestdir
|
||
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgstr "Veuillez vérifier le répertoire de Test dans %sEnvironment -> Options d'environnement -> Fichiers -> Répertoire pour construire les projets tests"
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr "Veuillez vérifier le nom du compilateur"
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr "Veuillez vérifier le répertoire des sources de FreePascal"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr "S’il vous plaît choisisser une section Resourcestring de la liste."
|
||
|
||
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Veuillez ouvrir une unité avant l'exécution"
|
||
|
||
#: lazarusidestrconsts:srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr "Pressez une touche"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Veuillez enregistrer le fichier avant de l'ajouter à un paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr "SVP sauver le paquet d'abord"
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Veuillez sélectionner un paquet"
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Veuillez sélectionner un paquet à ouvrir"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Veuillez d'abord sélectionner un élément"
|
||
|
||
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Veuillez sélectionner du code pour extraire une nouvelle procédure/méthode."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Point"
|
||
|
||
#: lazarusidestrconsts:lispointer
|
||
msgid "Pointer"
|
||
msgstr "Pointeur"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Polonais"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishwin
|
||
msgid "Polish(CP1250)"
|
||
msgstr "Polonais(CP1250)"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishiso
|
||
msgid "Polish(ISO 8859-2)"
|
||
msgstr "Polonais(ISO 8859-2)"
|
||
|
||
#: lazarusidestrconsts:rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr "Portuguais"
|
||
|
||
#: lazarusidestrconsts:lisceomode
|
||
msgid "Preferred Exhibition Mode"
|
||
msgstr "Mode d'exposition préférer"
|
||
|
||
#: lazarusidestrconsts:dlgwrdpreview
|
||
msgid "Preview"
|
||
msgstr "Aperçu"
|
||
|
||
#: lazarusidestrconsts:dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr "Aperçu (longueur de ligne max. = 1)"
|
||
|
||
#: lazarusidestrconsts:srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Précédent signet"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Le noeud précédent ne peut contenir des noeuds enfant"
|
||
|
||
#: lazarusidestrconsts:lisprint
|
||
msgid "Print"
|
||
msgstr "Imprimer"
|
||
|
||
#: lazarusidestrconsts:listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr "Imprimer les ToDo"
|
||
|
||
#: lazarusidestrconsts:listodolpriority
|
||
msgid "Priority"
|
||
msgstr "Priorité"
|
||
|
||
#: lazarusidestrconsts:lisprivate
|
||
msgid "Private"
|
||
msgstr "Méthode privée"
|
||
|
||
#: lazarusidestrconsts:lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Méthode privée"
|
||
|
||
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr "Vous devez probablement installer quelques paquets avant de pouvoir continuer.%s%sAttention:%sLe projet dépend de quelques paquets, qui contiennent des unités avec des procédures enregistrer. L'enregistrement de procédure est normalement employé pour installer des composants dans l'ide. Mais les unités suivantes appartiennent aux paquets qui ne sont pas encore installés dans l'ide. Si vous essayez d'ouvrir une fiche dans l'ide, qui emploie de tels composants, vous obtiendrez des erreurs au sujet des composants absents et le chargement de la fiche créera probablement des résultats très désagréables.%s%sceci n'a aucun impact pour ouvrir le projet ou n'importe lequel de ses sources.%s%sça signifie seulement : Que c'est une mauvaise idée d'ouvrir les fiches pour concevoir, avant d'installer les paquets absents.%s%s"
|
||
|
||
#: lazarusidestrconsts:lisprocedure
|
||
msgid "Procedure"
|
||
msgstr "Procédure"
|
||
|
||
#: lazarusidestrconsts:uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Aller à la procédure"
|
||
|
||
#: lazarusidestrconsts:srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr "Liste de procédure ..."
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Politique d'insertion de procédure"
|
||
|
||
#: lazarusidestrconsts:lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Procédure avec interface"
|
||
|
||
#: lazarusidestrconsts:lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr "Procedures"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Processus"
|
||
|
||
#: lazarusidestrconsts:lisprogram
|
||
msgid "Program"
|
||
msgstr "Programme"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Fichier du programme"
|
||
|
||
#: lazarusidestrconsts:lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Programme détecté"
|
||
|
||
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "Le fichier source du programme doit avoir une extension Pascal comme .pas, .pp ou .lpr"
|
||
|
||
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Programme%sUn programme FreePascal. Le fichier source du programme est automatiquement géré par Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisexeprograms
|
||
msgid "Programs"
|
||
msgstr "Programmes"
|
||
|
||
#: lazarusidestrconsts:lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Progrès"
|
||
|
||
#: lazarusidestrconsts:dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
||
msgid "Project %s%s%s successfully built. :)"
|
||
msgstr "Projet %s%s%s compilé avec succès :o)"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Chemin des fichier inc du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Chemin des 'Include' du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr "Informations sur le projet"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Inspecteur de projet"
|
||
|
||
#: lazarusidestrconsts:lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Inspecteur de projet - %s"
|
||
|
||
#: lazarusidestrconsts:dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Options du projet"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Options du projet ..."
|
||
|
||
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Marque de répertoire source du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Chemin des sources du projet"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "Chemin des sources du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Chemin des unités du projet"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "Chemin des unités du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr "Assistant de projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Projet modifié"
|
||
|
||
#: lazarusidestrconsts:lisprojectdirectory
|
||
msgid "Project directory"
|
||
msgstr "Répertoire du projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Nom de fichier du projet"
|
||
|
||
#: lazarusidestrconsts:dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr "Fichiers projet"
|
||
|
||
#: lazarusidestrconsts:lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Fichier info du projet détecté"
|
||
|
||
#: lazarusidestrconsts:lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Le projet est exécutable"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Propriétés du projet macro"
|
||
|
||
#: lazarusidestrconsts:srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Commandes du menu Projet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Projet: %s"
|
||
|
||
#: lazarusidestrconsts:lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Demander la valeur"
|
||
|
||
#: lazarusidestrconsts:lisceproperties
|
||
msgid "Properties"
|
||
msgstr "Propriétés "
|
||
|
||
#: lazarusidestrconsts:lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Propriétés:"
|
||
|
||
#: lazarusidestrconsts:dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Achèvement de propriété"
|
||
|
||
#: lazarusidestrconsts:dlgpropnamecolor
|
||
msgid "Property name"
|
||
msgstr "nom de propriété"
|
||
|
||
#: lazarusidestrconsts:lisprotected
|
||
msgid "Protected"
|
||
msgstr "Méthode protégée"
|
||
|
||
#: lazarusidestrconsts:lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Méthode protégée"
|
||
|
||
#: lazarusidestrconsts:lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr "Fournit"
|
||
|
||
#: lazarusidestrconsts:lisemdpublic
|
||
msgid "Public"
|
||
msgstr "Publique"
|
||
|
||
#: lazarusidestrconsts:lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Méthode publique"
|
||
|
||
#: lazarusidestrconsts:lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Publier le paquet"
|
||
|
||
#: lazarusidestrconsts:lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Publier le projet ..."
|
||
|
||
#: lazarusidestrconsts:liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Publier le projet ..."
|
||
|
||
#: lazarusidestrconsts:lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Répertoire de publication du projet"
|
||
|
||
#: lazarusidestrconsts:lisemdpublished
|
||
msgid "Published"
|
||
msgstr "Publiée"
|
||
|
||
#: lazarusidestrconsts:lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Méthode publiée"
|
||
|
||
#: lazarusidestrconsts:lislazbuildquickbuildoptions
|
||
msgid "Quick Build Options"
|
||
msgstr "Options de construction rapide"
|
||
|
||
#: lazarusidestrconsts:lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr "Construire vite "
|
||
|
||
#: lazarusidestrconsts:liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Compiler vite, aucun liens"
|
||
|
||
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr "Vérification rapide de la syntaxe"
|
||
|
||
#: lazarusidestrconsts:lismenuquit
|
||
msgid "Quit"
|
||
msgstr "Quitter"
|
||
|
||
#: lazarusidestrconsts:lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Quitter Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlgcorange
|
||
msgid "Range"
|
||
msgstr "Intervalle"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Re-ajouter la dépendance"
|
||
|
||
#: lazarusidestrconsts:lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Ré-ajouter le fichier"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Re-compiler ceci et tous les paquets requis ?"
|
||
|
||
#: lazarusidestrconsts:lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Erreur de lecture"
|
||
|
||
#: lazarusidestrconsts:uemreadonly
|
||
msgid "Read Only"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Lecture seule: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Erreur de lecture"
|
||
|
||
#: lazarusidestrconsts:dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Préfixe \"Read\""
|
||
|
||
#: lazarusidestrconsts:uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Reconstruire Lazarus ?"
|
||
|
||
#: lazarusidestrconsts:lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Fichiers récents"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr "Recompiler tout ce qui est requis"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr "Nettoyer et recompiler"
|
||
|
||
#: lazarusidestrconsts:lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr "Record/Structure"
|
||
|
||
#: lazarusidestrconsts:lismenuredo
|
||
msgid "Redo"
|
||
msgstr "Refaire"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Réduire le traçage du designer"
|
||
|
||
#: lazarusidestrconsts:uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Retravailler"
|
||
|
||
#: lazarusidestrconsts:dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Référence"
|
||
|
||
#: lazarusidestrconsts:dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr "Rafraîchir"
|
||
|
||
#: lazarusidestrconsts:lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Rafraichir automatiquement"
|
||
|
||
#: lazarusidestrconsts:listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr "Rafraîchir les éléments ToDo"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "La procédure Register est à nil"
|
||
|
||
#: lazarusidestrconsts:lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Référencer l'unité"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "RegisterUnit a été appellé, mais aucun paquet n'est référencé."
|
||
|
||
#: lazarusidestrconsts:lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Référencer les plugins"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr "Erreur de référencement"
|
||
|
||
#: lazarusidestrconsts:lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr "Expression régulière"
|
||
|
||
#: lazarusidestrconsts:lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Chemins relatifs "
|
||
|
||
#: lazarusidestrconsts:lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Libérer"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Recharger depuis le disque"
|
||
|
||
#: lazarusidestrconsts:lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr "Retirer"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Retirer la dépendance?"
|
||
|
||
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
|
||
msgid "Remove active unit from project"
|
||
msgstr "Retirer l'unité active du projet"
|
||
|
||
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Retirer toutes les propriétés non valides"
|
||
|
||
#: lazarusidestrconsts:liskmremovebreakpoint
|
||
msgid "Remove break point"
|
||
msgstr "Retirer le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Retirer la dépendance"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Retirer la dépendance %s%s%s%du paquet %s%s% ?"
|
||
|
||
#: lazarusidestrconsts:srkmecremoveemptymethods
|
||
msgid "Remove empty methods"
|
||
msgstr "Supprimer les méthodes vides"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Retirer le fichier"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Retirer le fichier %s du projet ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Retirer le fichier %s%s%s%sdu paquet %s%s% ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Retirer le fichier ?"
|
||
|
||
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Retirer les fichiers correspondant au filtre"
|
||
|
||
#: lazarusidestrconsts:lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Retirer du projet ..."
|
||
|
||
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Retirer des propriétés favorites"
|
||
|
||
#: lazarusidestrconsts:lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr "Retirer du projet"
|
||
|
||
#: lazarusidestrconsts:lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr "Supprimer les méthodes"
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Retirer le chemin"
|
||
|
||
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Retirer l'élément sélectionné"
|
||
|
||
#: lazarusidestrconsts:lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Les retirer"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr "Fichiers retirés (ces entrées ne sont pas enregistrées dans le fichier lpk)"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr "Paquets requis retirés"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr "Les paquets requis ont été retirés (ces entrées ne sont pas enregistrées dans le fichier lpk)"
|
||
|
||
#: lazarusidestrconsts:lisfrirename
|
||
msgid "Rename"
|
||
msgstr "Renommer"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Renommer le fichier en minuscules ?"
|
||
|
||
#: lazarusidestrconsts:uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Renommer l'identificateur"
|
||
|
||
#: lazarusidestrconsts:lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Renommer l'identificateur ..."
|
||
|
||
#: lazarusidestrconsts:lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Renommer toutes les références"
|
||
|
||
#: lazarusidestrconsts:lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Le changement du nom du fichier a échoué"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr "Renommer le fichier dans le paquet?"
|
||
|
||
#: lazarusidestrconsts:lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Renommer le fichier ?"
|
||
|
||
#: lazarusidestrconsts:srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr "Renommer l'identificateur"
|
||
|
||
#: lazarusidestrconsts:lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Renommer en"
|
||
|
||
#: lazarusidestrconsts:lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Renommer en minuscules"
|
||
|
||
#: lazarusidestrconsts:lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr "Rouvrir avec un autre encodage"
|
||
|
||
#: lazarusidestrconsts:lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr "Nombre de répétition :"
|
||
|
||
#: lazarusidestrconsts:lismenureplace
|
||
msgid "Replace"
|
||
msgstr "Remplacer"
|
||
|
||
#: lazarusidestrconsts:dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "&Remplacer tout"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Remplacer le fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Remplacer le fichier existant %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr "Texte à remplacer"
|
||
|
||
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Remplacer cette occurence de %s%s%s%s par %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Remplacement de la sélection ratée"
|
||
|
||
#: lazarusidestrconsts:dlgreport
|
||
msgid "Report"
|
||
msgstr "Rapport"
|
||
|
||
#: lazarusidestrconsts:lismenureportingbug
|
||
msgid "Reporting a bug..."
|
||
msgstr "Signaler un bogue ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Paquets requis"
|
||
|
||
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr "Reparcourir le répertoire des sources FPC"
|
||
|
||
#: lazarusidestrconsts:lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr "Réinitialiser la liste des résultats"
|
||
|
||
#: lazarusidestrconsts:lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr "Réinitialiser le débogueur"
|
||
|
||
#: lazarusidestrconsts:lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Erreur de lecture de ressource"
|
||
|
||
#: lazarusidestrconsts:lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Erreur d'enregistrement de ressource"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Resourcestring existe déjà"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Section Resourcestring :"
|
||
|
||
#: lazarusidestrconsts:lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Redémarrer"
|
||
|
||
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
||
msgid "Restart after successful Build"
|
||
msgstr "Redémarrer après une construction réussi"
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Restaurer la géométrie de la fenêtre"
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Restaurer la taille de la fenêtre"
|
||
|
||
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr "Explorateur de restrictions"
|
||
|
||
#: lazarusidestrconsts:dlgccoresults
|
||
msgid "Results"
|
||
msgstr "Résultats"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Résumé"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Résumer le Handled"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Resume Unhandled"
|
||
|
||
#: lazarusidestrconsts:lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Restaurer"
|
||
|
||
#: lazarusidestrconsts:lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Echec de la restauration"
|
||
|
||
#: lazarusidestrconsts:lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Restaurer le paquet?"
|
||
|
||
#: lazarusidestrconsts:lisright
|
||
msgid "Right"
|
||
msgstr "Droite"
|
||
|
||
#: lazarusidestrconsts:dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr "Clic droit pour sélectionner"
|
||
|
||
#: lazarusidestrconsts:lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Côtés droits"
|
||
|
||
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr "L'espace de bordure droit. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à droite du contrôle."
|
||
|
||
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Cliquez-droit sur l'arbre des éléments pour ouvrir le menu contextuel avec toutes les fonctions de paquet."
|
||
|
||
#: lazarusidestrconsts:dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Marge droite"
|
||
|
||
#: lazarusidestrconsts:dlgrightmargincolor
|
||
msgid "Right margin color"
|
||
msgstr "Couleur de la marge droite"
|
||
|
||
#: lazarusidestrconsts:dlgrightmousemovescursor
|
||
msgid "Right mouse moves cursor"
|
||
msgstr "Le bouton droit de la souris déplace le curseur"
|
||
|
||
#: lazarusidestrconsts:lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Côtés droits"
|
||
|
||
#: lazarusidestrconsts:lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "Espacement droit égal"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandgroup
|
||
msgid "Rubber band"
|
||
msgstr "Elastique"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectrun
|
||
msgid "Run"
|
||
msgstr "Exécuter"
|
||
|
||
#: lazarusidestrconsts:lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Exécuter une commande"
|
||
|
||
#: lazarusidestrconsts:lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Exécuter le fichier"
|
||
|
||
#: lazarusidestrconsts:lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr "Paramètres d'exécution..."
|
||
|
||
#: lazarusidestrconsts:srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Commandes du menu Exécuter"
|
||
|
||
#: lazarusidestrconsts:dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr "Paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts:liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Exécuter un programme"
|
||
|
||
#: lazarusidestrconsts:lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr "Exécuter jusqu'au curseur"
|
||
|
||
#: lazarusidestrconsts:lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Exécuter jusqu'à l'échec"
|
||
|
||
#: lazarusidestrconsts:lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "Exécution seulement"
|
||
|
||
#: lazarusidestrconsts:rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Russe"
|
||
|
||
#: lazarusidestrconsts:lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Révision SVN:"
|
||
|
||
#: lazarusidestrconsts:dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Même nom (dans un sous-répertoire)"
|
||
|
||
#: lazarusidestrconsts:lismenusave
|
||
msgid "Save"
|
||
msgstr "Enregistrer"
|
||
|
||
#: lazarusidestrconsts:lissavespace
|
||
msgid "Save "
|
||
msgstr "Enregistrer "
|
||
|
||
#: lazarusidestrconsts:lissave
|
||
msgid "Save ..."
|
||
msgstr "Enregistrer ..."
|
||
|
||
#: lazarusidestrconsts:lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Tout enregistrer"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Enregistrer sous"
|
||
|
||
#: lazarusidestrconsts:dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Enregistrer sous - renommer automatiquement les fichiers pascal en minuscule"
|
||
|
||
#: lazarusidestrconsts:lismenusaveas
|
||
msgid "Save As ..."
|
||
msgstr "Enregistrer sous ..."
|
||
|
||
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr "Enregister comme modèle..."
|
||
|
||
#: lazarusidestrconsts:lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr "Enregistrer les modifications ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Enregistrer le paquet %s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr "Enregistrer le paquet ?"
|
||
|
||
#: lazarusidestrconsts:lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Enregistrer le projet"
|
||
|
||
#: lazarusidestrconsts:lissaveprojectlpi
|
||
msgid "Save Project %s (*.lpi)"
|
||
msgstr "Enregistrer le projet %s (*.lpi)"
|
||
|
||
#: lazarusidestrconsts:lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Enregistrer le projet sous ..."
|
||
|
||
#: lazarusidestrconsts:lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Enregistrer les paramêtres"
|
||
|
||
#: lazarusidestrconsts:lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Tout enregistrer"
|
||
|
||
#: lazarusidestrconsts:lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr "Enregistrer tous les messages dans un fichier"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Enregistrer et quitter"
|
||
|
||
#: lazarusidestrconsts:lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Enregistrer et quitter la dialogue"
|
||
|
||
#: lazarusidestrconsts:lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Enregistrer et reconstruire l'IDE"
|
||
|
||
#: lazarusidestrconsts:lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Enregistrer les modifications du projet %s ?"
|
||
|
||
#: lazarusidestrconsts:lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Enregistrer les modifications ?"
|
||
|
||
#: lazarusidestrconsts:dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Enregistrer les paramètres du bureau"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
|
||
|
||
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Enregistrer les infos de l'éditeur sauf pour les fichiers projet"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Enregistrer les infos de l'éditeur seulement pour les fichiers projet"
|
||
|
||
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Enregistrer le fichier %s%s%s%savant de fermer la fiche %s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Enregistrer le fichier sous"
|
||
|
||
#: lazarusidestrconsts:lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Dialogue d'enregistrer de fichier"
|
||
|
||
#: lazarusidestrconsts:fdmsaveformasxml
|
||
msgid "Save form as xml"
|
||
msgstr "Enregistrer le formulaire en xml"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Sauver dans un fichier .lpi"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Sauver dans un fichier .lps du dossier projet"
|
||
|
||
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Sauver dans le dossier de configuration de l'IDE"
|
||
|
||
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
|
||
|
||
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Sauver les messages dans un fichier (*.txt)"
|
||
|
||
#: lazarusidestrconsts:lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr "Enregistrer le paquet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr "Enregistrer le paquet ?"
|
||
|
||
#: lazarusidestrconsts:liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Enregistrer le projet"
|
||
|
||
#: lazarusidestrconsts:liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Enregistrer le projet sous"
|
||
|
||
#: lazarusidestrconsts:lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Sauver les informations de session dans"
|
||
|
||
#: lazarusidestrconsts:lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr "Enregistrer la configuration"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Enregistrer dans un fichier"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Enregistrer dans un fichier récent"
|
||
|
||
#: lazarusidestrconsts:liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "Enregistrer tout"
|
||
|
||
#: lazarusidestrconsts:liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "Enregistrer sous"
|
||
|
||
#: lazarusidestrconsts:fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Ajuster"
|
||
|
||
#: lazarusidestrconsts:lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Facteur d'ajustement:"
|
||
|
||
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Rechercher dans l'unité son nom et la procédure Register"
|
||
|
||
#: lazarusidestrconsts:liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Rechercher les messages FPC"
|
||
|
||
#: lazarusidestrconsts:liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Rechercher les message Make"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Rechercher les messages de sortie de FPC"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Rechercher les message Make de sortie"
|
||
|
||
#: lazarusidestrconsts:dlgscope
|
||
msgid "Scope"
|
||
msgstr "Portée"
|
||
|
||
#: lazarusidestrconsts:dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Défilement d'un de moins"
|
||
|
||
#: lazarusidestrconsts:srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Défilement d'une ligne vers le bas"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Défilement d'un caractère vers la gauche"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Défilement après la fin du fichier"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendline
|
||
msgid "Scroll past end of line"
|
||
msgstr "Défilement après la fin d'une ligne"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Défilement d'un caractère vers la droite"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Défilement d'une ligne vers le haut"
|
||
|
||
#: lazarusidestrconsts:lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Rechercher "
|
||
|
||
#: lazarusidestrconsts:lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Résultats de la recherche"
|
||
|
||
#: lazarusidestrconsts:lissearchagain
|
||
msgid "Search again"
|
||
msgstr "Répéter la recherche"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Chercher aussi dans les commentaires"
|
||
|
||
#: lazarusidestrconsts:lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr "Recherche dans ces classes :"
|
||
|
||
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
|
||
msgid "Search or Filter Phrases In List"
|
||
msgstr "Rechercher ou filtrer les expressions dans la liste"
|
||
|
||
#: lazarusidestrconsts:lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Chemins de recherche:"
|
||
|
||
#: lazarusidestrconsts:lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Chaîne recherchée '%s' non trouvée !"
|
||
|
||
#: lazarusidestrconsts:dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Recherche interrompue par l'utilisateur."
|
||
|
||
#: lazarusidestrconsts:lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Texte à rechercher"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Chercher o"
|
||
|
||
#: lazarusidestrconsts:lisssearching
|
||
msgid "Searching"
|
||
msgstr "Recherche"
|
||
|
||
#: lazarusidestrconsts:dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr "Recherche ..."
|
||
|
||
#: lazarusidestrconsts:lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Recherche de: %s"
|
||
|
||
#: lazarusidestrconsts:liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Voir aussi"
|
||
|
||
#: lazarusidestrconsts:lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Voir les messages."
|
||
|
||
#: lazarusidestrconsts:srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "Sélection gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "Sélection droite"
|
||
|
||
#: lazarusidestrconsts:lismenuselect
|
||
msgid "Select"
|
||
msgstr "Sélectionner"
|
||
|
||
#: lazarusidestrconsts:srkmecselectall
|
||
msgid "Select All"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: lazarusidestrconsts:lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "veuillez choisir une macro"
|
||
|
||
#: lazarusidestrconsts:lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Sélectionner les fiches Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts:srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Sélection vers le bas"
|
||
|
||
#: lazarusidestrconsts:srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Sélection en XY"
|
||
|
||
#: lazarusidestrconsts:srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr "Sélection de la fin de ligne"
|
||
|
||
#: lazarusidestrconsts:srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr "Sélection du début de ligne"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Menu sélectionner:"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr "Sélection du bas de page"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Sélection de la page vers le bas"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Sélection de la page vers la gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Sélection de la page vers la droite"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr "Sélection du haut de la page"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Sélection de la page vers le haut"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Choisir le modèle:"
|
||
|
||
#: lazarusidestrconsts:srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Sélection vers le haut"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr "Sélection du mot de gauche"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr "Sélection du mot de droite"
|
||
|
||
#: lazarusidestrconsts:lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Choisir un élément d'aide:"
|
||
|
||
#: lazarusidestrconsts:lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Choisir un noeud"
|
||
|
||
#: lazarusidestrconsts:lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Choisir un type de projet"
|
||
|
||
#: lazarusidestrconsts:lismenuselectall
|
||
msgid "Select all"
|
||
msgstr "Tout sélectionner"
|
||
|
||
#: lazarusidestrconsts:lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr "Sélectionner le bloc de code"
|
||
|
||
#: lazarusidestrconsts:lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Sélectionner un répertoire"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
||
msgid "Select grand childs"
|
||
msgstr "Choisir les enfants"
|
||
|
||
#: lazarusidestrconsts:lismenuselectline
|
||
msgid "Select line"
|
||
msgstr "Sélectionner la ligne"
|
||
|
||
#: lazarusidestrconsts:liskmselectlineend
|
||
msgid "Select line end"
|
||
msgstr "Sélection de la fin de ligne"
|
||
|
||
#: lazarusidestrconsts:liskmselectlinestart
|
||
msgid "Select line start"
|
||
msgstr "Sélection du début de ligne"
|
||
|
||
#: lazarusidestrconsts:lissamselectnone
|
||
msgid "Select none"
|
||
msgstr "Aucune sélection"
|
||
|
||
#: lazarusidestrconsts:liskmselectpagebottom
|
||
msgid "Select page bottom"
|
||
msgstr "Sélection du bas de page"
|
||
|
||
#: lazarusidestrconsts:liskmselectpagetop
|
||
msgid "Select page top"
|
||
msgstr "Sélection du haut de la page"
|
||
|
||
#: lazarusidestrconsts:lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr "Sélectionner le paragraphe"
|
||
|
||
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Sélectionner le composant parent"
|
||
|
||
#: lazarusidestrconsts:lisselectfile
|
||
msgid "Select the file"
|
||
msgstr "Sélectionner le fichier"
|
||
|
||
#: lazarusidestrconsts:srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Sélectionner jusqu'au début absolu"
|
||
|
||
#: lazarusidestrconsts:srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Sélectionner jusqu'à la fin absolue"
|
||
|
||
#: lazarusidestrconsts:lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr "Ancrer la sélection"
|
||
|
||
#: lazarusidestrconsts:lismenuselectword
|
||
msgid "Select word"
|
||
msgstr "Sléectionner un mot"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordleft
|
||
msgid "Select word left"
|
||
msgstr "Sélection du mot de gauche"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordright
|
||
msgid "Select word right"
|
||
msgstr "Sélection du mot de droite"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Noeud sélectionné:"
|
||
|
||
#: lazarusidestrconsts:lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Le paquet sélectionné est requis par:"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
||
msgid "Selection"
|
||
msgstr "Sélectionner"
|
||
|
||
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "La sélection dépasse la taille de constante chaîne"
|
||
|
||
#: lazarusidestrconsts:lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Sélection d'outils"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Point-virgule"
|
||
|
||
#: lazarusidestrconsts:dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Session"
|
||
|
||
#: lazarusidestrconsts:srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Définir le signet %d"
|
||
|
||
#: lazarusidestrconsts:uemsetfreebookmark
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts:lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts:dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Réinitialiser tous les éléments"
|
||
|
||
#: lazarusidestrconsts:dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Réinitialiser l'élément"
|
||
|
||
#: lazarusidestrconsts:liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Mettre un signet libre"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Placer le marqueur 0"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Placer le marqueur 1"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Placer le marqueur 2"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Placer le marqueur 3"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Placer le marqueur 4"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Placer le marqueur 5"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Placer le marqueur 6"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Placer le marqueur 7"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Placer le marqueur 8"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Placer le marqueur 9"
|
||
|
||
#: lazarusidestrconsts:dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Variable d'affectation"
|
||
|
||
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Placer le point d'arrêt de toute façon"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolshift
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts:srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Shift Tab"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Court"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr "Courte description de"
|
||
|
||
#: lazarusidestrconsts:lisshort
|
||
msgid "Short:"
|
||
msgstr "Court :"
|
||
|
||
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Raccourcir ou augmenter le nom de fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "Souhaitez-vous renommer en minuscule comme %s%s%s%s ?"
|
||
|
||
#: lazarusidestrconsts:lisshow
|
||
msgid "Show"
|
||
msgstr "Voir"
|
||
|
||
#: lazarusidestrconsts:lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr "Afficher tout"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr "Afficher les catégories"
|
||
|
||
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Afficher les valeurs des Outils de code"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr "Affiche les erreurs"
|
||
|
||
#: lazarusidestrconsts:dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Afficher les lignes guides"
|
||
|
||
#: lazarusidestrconsts:dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr "Afficher les conseils"
|
||
|
||
#: lazarusidestrconsts:dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr "Afficher les conseils pour le paramètre \"Sender\" non utilisé"
|
||
|
||
#: lazarusidestrconsts:dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr "Afficher les conseils pour les unités non utilisées"
|
||
|
||
#: lazarusidestrconsts:uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Afficher les numéros de ligne"
|
||
|
||
#: lazarusidestrconsts:dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr "Afficher les notes"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowoptions
|
||
msgid "Show Options"
|
||
msgstr "Afficher les options"
|
||
|
||
#: lazarusidestrconsts:fdmshowoptions
|
||
msgid "Show Options for form editing"
|
||
msgstr "Afficher les options d'édition de fiche"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr "Afficher les nœuds sources"
|
||
|
||
#: lazarusidestrconsts:dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr "Afficher les avertissements"
|
||
|
||
#: lazarusidestrconsts:srkmecshowabstractmethods
|
||
msgid "Show abstract methods"
|
||
msgstr "Afficher les méthodes abstraites"
|
||
|
||
#: lazarusidestrconsts:lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr "Afficher Tout"
|
||
|
||
#: lazarusidestrconsts:liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Afficher tous les messages"
|
||
|
||
#: lazarusidestrconsts:dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Afficher les procédures en cas d'erreur"
|
||
|
||
#: lazarusidestrconsts:dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Afficher l'espacement de frontière "
|
||
|
||
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Afficher un bouton fermer par onglet"
|
||
|
||
#: lazarusidestrconsts:srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr "Afficher le contexte de code"
|
||
|
||
#: lazarusidestrconsts:dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr "Afficher le dialogue de compilation"
|
||
|
||
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Afficher les procédures compilées"
|
||
|
||
#: lazarusidestrconsts:dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Afficher les options du compilateur"
|
||
|
||
#: lazarusidestrconsts:dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Afficher les légendes des composants"
|
||
|
||
#: lazarusidestrconsts:dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Afficher les expressions conditionnelles"
|
||
|
||
#: lazarusidestrconsts:dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Afficher les informations de déboguage"
|
||
|
||
#: lazarusidestrconsts:dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Afficher les macros définies"
|
||
|
||
#: lazarusidestrconsts:dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Afficher les conseils dans l'éditeur"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshowemptymethods
|
||
msgid "Show empty methods"
|
||
msgstr "Afficher les méthodes vides"
|
||
|
||
#: lazarusidestrconsts:dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Tout afficher"
|
||
|
||
#: lazarusidestrconsts:dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Afficher les infos de l'exe (Win32 seulement)"
|
||
|
||
#: lazarusidestrconsts:dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Afficher les informations générales"
|
||
|
||
#: lazarusidestrconsts:lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr "Afficher les liens globaux"
|
||
|
||
#: lazarusidestrconsts:dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Afficher la grille"
|
||
|
||
#: lazarusidestrconsts:dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Afficher les astuces de gouttière"
|
||
|
||
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
||
msgid "Show hints in Object Inspector"
|
||
msgstr "Afficher les conseils dans l'inspecteur d'objet"
|
||
|
||
#: lazarusidestrconsts:lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Afficher les marques"
|
||
|
||
#: lazarusidestrconsts:dlgshowlinenumbers
|
||
msgid "Show line numbers"
|
||
msgstr "Afficher les numéros de ligne"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Afficher le message sur l'arrêt"
|
||
|
||
#: lazarusidestrconsts:dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Ne rien afficher (sauf les erreurs)"
|
||
|
||
#: lazarusidestrconsts:lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr "Afficher l'ancien ordre de tabulation"
|
||
|
||
#: lazarusidestrconsts:lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Afficher les paquets"
|
||
|
||
#: lazarusidestrconsts:dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr "Afficher les conseils de défilement"
|
||
|
||
#: lazarusidestrconsts:lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr "Afficher les caractères spéciaux"
|
||
|
||
#: lazarusidestrconsts:dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Afficher le récapitulatif"
|
||
|
||
#: lazarusidestrconsts:dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Afficher les fichiers essayés"
|
||
|
||
#: lazarusidestrconsts:lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Afficher les unités"
|
||
|
||
#: lazarusidestrconsts:dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Afficher les fichiers utilisés"
|
||
|
||
#: lazarusidestrconsts:lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr "Afficher les liens utilisateur"
|
||
|
||
#: lazarusidestrconsts:lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr "Réduction au plus petite"
|
||
|
||
#: lazarusidestrconsts:lissibling
|
||
msgid "Sibling"
|
||
msgstr "Contrôle"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Signaux"
|
||
|
||
#: lazarusidestrconsts:lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr "Syntaxe simple"
|
||
|
||
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Syntaxe simple (i.e. * au lieu de .*)"
|
||
|
||
#: lazarusidestrconsts:fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Taille"
|
||
|
||
#: lazarusidestrconsts:lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Taille :"
|
||
|
||
#: lazarusidestrconsts:lisccoskip
|
||
msgid "Skip"
|
||
msgstr "Ignorer"
|
||
|
||
#: lazarusidestrconsts:liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr "Pas d'appel au compilateur"
|
||
|
||
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Passer le fichier et continuer le chargement"
|
||
|
||
#: lazarusidestrconsts:lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Passer le chargement du dernier projet"
|
||
|
||
#: lazarusidestrconsts:lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Sauter ce paquet"
|
||
|
||
#: lazarusidestrconsts:rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr "Slovak"
|
||
|
||
#: lazarusidestrconsts:dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr "Code plus petit"
|
||
|
||
#: lazarusidestrconsts:dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr "Table des liens intelligente"
|
||
|
||
#: lazarusidestrconsts:dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Tabulations intelligentes"
|
||
|
||
#: lazarusidestrconsts:dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Aligner sur les lignes guides"
|
||
|
||
#: lazarusidestrconsts:dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Aligner sur la grille"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Certains fichiers ont changé sur le disque :"
|
||
|
||
#: lazarusidestrconsts:lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr "Désolé, non implémenté à ce jour"
|
||
|
||
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Désolé, ce type n'est pas encore implémenté"
|
||
|
||
#: lazarusidestrconsts:lispesortfiles
|
||
msgid "Sort files"
|
||
msgstr "Trier les fichiers"
|
||
|
||
#: lazarusidestrconsts:lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Trier la sélection"
|
||
|
||
#: lazarusidestrconsts:lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr "Trier la sélection ..."
|
||
|
||
#: lazarusidestrconsts:lisceomodesource
|
||
msgid "Source"
|
||
msgstr "Source"
|
||
|
||
#: lazarusidestrconsts:lismenuviewsourceeditor
|
||
msgid "Source Editor"
|
||
msgstr "Editeur de source"
|
||
|
||
#: lazarusidestrconsts:srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Commandes des onglets de sources"
|
||
|
||
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "La source et la destination sont identiques:%s%s"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr "Point d'arrêt source"
|
||
|
||
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "Le dossier source %s%s%s n'existe pas."
|
||
|
||
#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr "Le répertoire source %s%s%s%s et le répertoire de destination %s%s%s% sont les mêmes.%s%s Vous avez peut-être mal conpris cette fonctionnalité.%s Il nettoiera/recréera le répertoire de destination%s et copies le paquet/projet dedans."
|
||
|
||
#: lazarusidestrconsts:lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Source modifié"
|
||
|
||
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Le source de la page %s%s%s a changé. L'enregistrer ?"
|
||
|
||
#: lazarusidestrconsts:lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Chemins des sources"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Prévisualisation du code source"
|
||
|
||
#: lazarusidestrconsts:dlgspacenotcosmos
|
||
msgid "Space"
|
||
msgstr "Espace"
|
||
|
||
#: lazarusidestrconsts:lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Espacement régulier"
|
||
|
||
#: lazarusidestrconsts:rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Espagnol"
|
||
|
||
#: lazarusidestrconsts:lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Src"
|
||
|
||
#: lazarusidestrconsts:dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Pile"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Menu Edition standard"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Menu Fichier standard"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Menu Aide standard"
|
||
|
||
#: lazarusidestrconsts:lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Démarrer avec un nouveau projet"
|
||
|
||
#: lazarusidestrconsts:lisoipstate
|
||
msgid "State"
|
||
msgstr "Etat"
|
||
|
||
#: lazarusidestrconsts:dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr "Mot-clé \"static\" dans les objets"
|
||
|
||
#: lazarusidestrconsts:lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "Pas à pas approfondi"
|
||
|
||
#: lazarusidestrconsts:lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "Pas à pas"
|
||
|
||
#: lazarusidestrconsts:lismenustepinto
|
||
msgid "Step into"
|
||
msgstr "Pas à pas approfondi"
|
||
|
||
#: lazarusidestrconsts:lismenustepover
|
||
msgid "Step over"
|
||
msgstr "Pas à pas"
|
||
|
||
#: lazarusidestrconsts:lismenustop
|
||
msgid "Stop"
|
||
msgstr "Arrêter"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Arrêt du déboguage ?"
|
||
|
||
#: lazarusidestrconsts:dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Arrêt après ce nombre d'erreurs:"
|
||
|
||
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Arrêter le débogage courant et reconstruire le projet ?"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Arrêter le débogage ?"
|
||
|
||
#: lazarusidestrconsts:liskmstopprogram
|
||
msgid "Stop program"
|
||
msgstr "Arrêter le programme"
|
||
|
||
#: lazarusidestrconsts:lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Arrêt du déboguage ?"
|
||
|
||
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr "Stocker le nom de fichier de dépendance"
|
||
|
||
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Suffixe \"Stored\""
|
||
|
||
#: lazarusidestrconsts:lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr "Erreur de Stream"
|
||
|
||
#: lazarusidestrconsts:lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Erreur de flux"
|
||
|
||
#: lazarusidestrconsts:lisstring
|
||
msgid "String"
|
||
msgstr "Chaîne"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Constante chaîne"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Constante chaîne dans le source"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Chaînes avec la même valeur:"
|
||
|
||
#: lazarusidestrconsts:dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr "Eliminer les symboles de l'exécutable"
|
||
|
||
#: lazarusidestrconsts:lisstyle
|
||
msgid "Style"
|
||
msgstr "Style"
|
||
|
||
#: lazarusidestrconsts:lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Sous-procédure"
|
||
|
||
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Sous-procédure de même niveau"
|
||
|
||
#: lazarusidestrconsts:dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Sous-répertoire"
|
||
|
||
#: lazarusidestrconsts:dlgsubpropkcolor
|
||
msgid "Subpropertes"
|
||
msgstr "Sous-propriétés"
|
||
|
||
#: lazarusidestrconsts:lissuccess
|
||
msgid "Success"
|
||
msgstr "Succès"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildsuccess
|
||
msgid "Success..."
|
||
msgstr "Succès..."
|
||
|
||
#: lazarusidestrconsts:lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Echanger les chemins"
|
||
|
||
#: lazarusidestrconsts:srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Basculer entre Fiche et Unité"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Symbole"
|
||
|
||
#: lazarusidestrconsts:dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Symbole après (.pp~)"
|
||
|
||
#: lazarusidestrconsts:dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Symbole avant (.~pp)"
|
||
|
||
#: lazarusidestrconsts:lissynedit
|
||
msgid "SynEdit"
|
||
msgstr "SynEdit"
|
||
|
||
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SynEdit - l'éditeur de composants utilisé par Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts:srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr "Vérification de la syntaxe"
|
||
|
||
#: lazarusidestrconsts:lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr "Mode syntaxe"
|
||
|
||
#: lazarusidestrconsts:dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Options des syntaxes"
|
||
|
||
#: lazarusidestrconsts:dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Variables système"
|
||
|
||
#: lazarusidestrconsts:dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr "Compatibilité TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts:listab
|
||
msgid "Tab"
|
||
msgstr "Tab"
|
||
|
||
#: lazarusidestrconsts:listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr "Odre de tabulation de"
|
||
|
||
#: lazarusidestrconsts:dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "La touche tabulation indente les blocs"
|
||
|
||
#: lazarusidestrconsts:fdmtaborder
|
||
msgid "Tab order..."
|
||
msgstr "Odre de Tabulation..."
|
||
|
||
#: lazarusidestrconsts:liseotabwidths
|
||
msgid "Tab widths"
|
||
msgstr "Largeur de tabulation"
|
||
|
||
#: lazarusidestrconsts:dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "Tabulations en espaces"
|
||
|
||
#: lazarusidestrconsts:lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr "Remplacer les tabulation par des espaces dans la sélection"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqboapplcltarget
|
||
msgid "Target"
|
||
msgstr "Cible"
|
||
|
||
#: lazarusidestrconsts:listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "CPU de destination"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "CPU de destination"
|
||
|
||
#: lazarusidestrconsts:listargetos
|
||
msgid "Target OS"
|
||
msgstr "OS de destination"
|
||
|
||
#: lazarusidestrconsts:liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Options spécifiques à l'OS de destination"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "OS de destination :"
|
||
|
||
#: lazarusidestrconsts:dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr "Plateformes cibles :"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr "Répertoire cible :"
|
||
|
||
#: lazarusidestrconsts:dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Fichier de destination:"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Nom du fichier de destination + paramètres"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Fichier de destination du projet"
|
||
|
||
#: lazarusidestrconsts:dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr "Processeur cible"
|
||
|
||
#: lazarusidestrconsts:lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Prévisualisation d'un modèle"
|
||
|
||
#: lazarusidestrconsts:dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Fichier modèle"
|
||
|
||
#: lazarusidestrconsts:lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Modèles"
|
||
|
||
#: lazarusidestrconsts:dlgccotest
|
||
msgid "Test"
|
||
msgstr "Test"
|
||
|
||
#: lazarusidestrconsts:listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Répertoire de test"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Répertoire de test \"%s\" non trouvé."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "Test : Vérification compilateur ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "Test : Vérification de la configuration du compilateur ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr "Test : Vérification de la date du compilateur ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr "Test : Vérification de la configuration fpc ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr "Test : Vérification ppu fpc manquante ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr "Test : Vérification des sources dans le chemin de recherche ppu fpc ..."
|
||
|
||
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr "Test : Compilation d'un fichier vide"
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr "Test : Compilation d'un fichier vide ..."
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypetext
|
||
msgid "Text"
|
||
msgstr "Texte"
|
||
|
||
#: lazarusidestrconsts:dlgtextattributes
|
||
msgid "Text attributes"
|
||
msgstr "Attributs du texte"
|
||
|
||
#: lazarusidestrconsts:srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Commandes d'édition de texte"
|
||
|
||
#: lazarusidestrconsts:srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Commandes des signets"
|
||
|
||
#: lazarusidestrconsts:srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Commandes de recherche et remplacement"
|
||
|
||
#: lazarusidestrconsts:srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Commandes de sélection de texte"
|
||
|
||
#: lazarusidestrconsts:lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr "Texte à trouver : "
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Texte1"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Texte2"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "Le répertoire principal %s, o Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Le répertoire principal %s o Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "Le réperoire principal %s %so Borland a installé tous les sources %s.%sPar exemple: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Le réperoire principal %s %so Borland a installé tous les sources %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "Le répertoire projet %s,%squi contient les fichiers .dpr, .dpk."
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr "Le Bundle Application %s%s nécessaire à l'exécution n'existe pas ou n'est pas exécutable.%s Voulez-vous en créer un ? %s%s Voir Project->Options du Project...->Paramètresde l'application."
|
||
|
||
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr "la FCL (FreePascal Component Library) fournit les classes de base pour le Pascal objet."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgstr "Le répertoire source de FPC \"%s\" ne semble pas correct. Normalement il contient des répertoires comme rtl, packages, compiler, ... ."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "Le dossier source SVN Free Pascal "
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr "Le répertoire source de Free Pascal SVN. Non requis. Ceci améliorera la déclaration et le déboguage."
|
||
|
||
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "The compilateur Free Pascal (nom de fichier: %s) est introuvable.%sIl est recommandé que vous installiez FPC."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Le répertoire du projet Free Pascal."
|
||
|
||
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr "The répertoire source Free Pascal est introuvable.%sQuelques fonctions de code ne fonctionneront pas.%sIl est recommandé que vous l'installiez et définissiez le chemin%Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "la LCL (Lazarus Component Library) contient tous les composants de base des fiches."
|
||
|
||
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "Le fichier LFM (Lazarus form) contient des propriétés invalides. Cela veut dire qu'il contient des propriétés/classes qui n'existent pas dans la LCL actuelle. L'action recommandée est de retirer ces propriétés du LFM et de corriger le code Pascal manuellement."
|
||
|
||
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "The répertoire de Lazarus est introuvable.%sVous ne pourrez pas créer d'application LCL.%sVeuillez vérifier l'environnement dans Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "Le répertoire principal de Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version maximale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "La version maximale est inférieure à la version minimale."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La version minimale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr "Le RTL - Le Run Time Library est la base de tous les programmes Free Pascal. "
|
||
|
||
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr "Le répertoire test est introuvable:%s%s%s%s%s(voir les options d'environnement)"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Le type parent %s%s%s a le même nom que%sl'unité %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le type parent %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "La classe %s%s%s est un TControl et ne peut pas être collée ailleurs que dans un contrôle.%sCollage imposible."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "Le nom de classe %s%s%s et le type ancêtre %s%s%s sont identiques"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "Le nom de classe %s%s%s existe déjà dans%sPaquet %s%sFichier : %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Le nom de classe %s%s%s est identique au nom de%sl'unité %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom de classe %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr "L'outil de code a décelé une erreur:% s% s% s"
|
||
|
||
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "La commande après %s%s%s n'est pas exécutable."
|
||
|
||
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "La commande après publication est non valide:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr "L'unité FPC compilée %s.ppu n'a pas été retrouvé.%s Ce message signifie généralement que votre fpc.cfg a un bug. Ou que votre installation FPC est cassée."
|
||
|
||
#: lazarusidestrconsts:lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr "Le compilateur \"%s\" n'est pas un fichier exécutable. %s Details : %s"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "Le compilateur \"%s\" n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "La fichier compilateur pour le paquet %s n'est pas un exécutable valide:%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr "Le composant %s ne peut être supprimé, car il n'est pas détenu par %s."
|
||
|
||
#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr "Le composant %s est hérité de%s.%sPour supprimer un composant hérité ouvrir l'ancêtre et supprimez-le."
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr "L'éditeur de composants de la classe %s%s%sa provoqué l'erreur:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "L'éditeur de composants de la classe %s%s%s%sappelé avec le verbe #%s %s%s%s%s a provoqué l'erreur:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Le répertoire présent de Free Pascal %s%s%s%sne semble pas correct.%sVérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Le répertoire présent des sources Free Pascal %s%s%s%sne semble pas correct.%sChoisissez OK pour revenir à la valeur par défaut%s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers"
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "Le répertoire présent de Lazarus %s%s%s%sne semble pas correct.%sAinsi, vous ne pourrez pas créer d'applications LCL.%sVérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Le répertoire présent de Lazarus %s%s%s%sne semble pas correct.%sAinsi, vous ne pourrez pas créer d'applications LCL.%sChoisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Le nom de compilateur actuel %s%s%s%sn'est pas un exécutable valide. Choisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Le nom de compilateur actuel %s%s%s%sn'est pas un exécutable valide.%sVeuillez vérifier dans Configuration->Options d'environnement->Fichiers."
|
||
|
||
#: lazarusidestrconsts:lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr "La police courante de l'éditeur ne supporte pas UTF-8, mais votre système semble l'employer. %sCela signifie que des caractères non ASCII seront probablement montrés incorrectement. %sVous pouvez choisir une autre police dans les options de l'éditeur."
|
||
|
||
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr "Le chemin d'unité actuel pour le fichier%s%s%s%s est%s%s%s%s.%s%sLe chemin vers les unités LCL %s%s%s manque.%s%sSuggestion pour les nouveaux venus à Lazarus:%sCréez une application Lazarus et placez le fichier dans le dossier du projet."
|
||
|
||
#: lazarusidestrconsts:lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr "Les dates des fichiers . Ppu de FPC sont diffèrent de plus d'une heure. %s Cela peut signifier, qu'elles sont de deux installations différentes. %s Fichier1 : %s%s Fichier 2 : %s"
|
||
|
||
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr "Le débogueur %s%s%sn'existe pas ou n'est pas exécutable. %s%sVoir Environnement -> Debugger Options"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Le débogueur \"%s\" n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "La dépendance %s%s%s est introuvable.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr "Le répertoire de destination %s%s%s n'existe pas.%sS’il vous plaît vérifier le nom de ficher du projet Menu>Projet>Options du projet."
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "Le répertoire de destination %s%s%s%s n'existe pas."
|
||
|
||
#: lazarusidestrconsts:listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr "Répertoire %s non trouvé"
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "Le répertoire %s%s%s n'est plus nécessaire dans le chemin d'unité. %sL'enlever ?"
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "Le répertoire %s%s%s n'est pas encore dans le chemin d'unité .%sL'ajouter ?"
|
||
|
||
#: lazarusidestrconsts:dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "Le répertoire \""
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "Le fichier %s semble être le fichier programme d'un projet Lazarus existant."
|
||
|
||
#: lazarusidestrconsts:listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "Le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr "Le fichier %s%s%s est un lien symbolique.%s%sOuvrir %s%s%s à la place ?"
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "Le fichier %s%s%s est déjà dans le paquet."
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr "Le fichier %s%s%s n'est pas un projet Delphi (.dpr)"
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr "Le fichier %s%s%s n'est pas une unité Delphi."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "Le fichier %s%s%s n'est pas un paquet Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Le fichier %s%s%s fait partie du projet en cours.%sC'est une mauvaise idée de partager des fichiers entre projets et paquets."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Le fichier %s%s%s%s est déjà dans le paquet %s."
|
||
|
||
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr "Le fichier %s%s%s%s n'est pas actuellement dans le chemin des unités du paquet.%s%sAjouter %s%s%s au chemin ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "Le fichier %s%s%s%s du paquet %s est manquant"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "Le fichier %s%s%s%sdu paquet %s a besoins d'être sauvé d'abord."
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Le fichier %s%s%s%ssemble être un programme. Fermer le projet en cours et créer un nouveau projet Lazarus pour ce programme?%s'Non' chargera le fichier comme un fichier source normal."
|
||
|
||
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "Le fichier %s%s%s%sa été trouvé dans un des répertoires source du paquet %s et semble être une unité compilée. Les unités compilées doivent être dans le répertoire de destination du paquet, sinon d'autres paquets risquent d'avoir des problèmes à utiliser ce paquet.%s%sEffacer le fichier douteux ?"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "Le fichier %s%s%s%s n'a pas été trouvé.%sSouhaitez-vous le rechercher manuellement ?%s"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Le fichier %s%s%s%s est introuvable.%sIgnorer continuera à charger le projet;%sAbandonner arrêtera le chargement."
|
||
|
||
#: lazarusidestrconsts:uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Le fichier \""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Le fichier nommé %s%s%s fait partie du projet en cours.%sLes projets et paquets ne devraient pas partager de fichiers."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "Le fichier nommé %s%s%s est utilisé par%sle paquet %s%s%s%sdans le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "Le nom de fichier %s%s%s ne correspond pas au paquet nommé %s%s%s dans le fichier.%sChanger le nom du paquet pour %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Le nom de fichier %s%s%s est ambigu, parce que le paquet n'a aucun répertoire par défaut.%sVeuillez indiquer un nom de fichier avec le chemin complet."
|
||
|
||
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Les méthodes suivantes sont employées %s ne sont pas dans la source %s%s%s%s%s%sEnlever les références balançantes ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Le paquet suivant ne se charge pas :"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Les paquets suivants ne se chargent pas :"
|
||
|
||
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
||
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
||
msgstr "Les unités suivantes n'ont pas été trouvées:%s%s%s%s1) L'une ou l'autre de ces unités ne sont pas dans le chemin d'unité, alors vous pouvez abandonner maintenant, fixer le chemin d'unité et essayer encore.%s2) Ou vous pouvez ignorer les unités absentes et les commenter."
|
||
|
||
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "L'application hôte %s%s%s n'est pas exécutable."
|
||
|
||
#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr "La touche %s%s est déjà attribué à %s.%s%s Retirez l'ancienne affectation et affecter la touche à la nouvelle fonction %s%s ?"
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "L'application de lancement %s%s%s%sn'existe pas ou n'est pas exécutable.%s%sVoir Exécuter -> Paramètres d'exécution -> Local"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "Le répertoire Lazarus '\"%s\" n'a pas la composition correcte. Il contient normalement des répertoires comme lcl, debugger, designer, components, ... ."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "Le fichier 'make' '%s' n'est pas un exécutable."
|
||
|
||
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La version maximale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La version minimale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "Le nom \"%s\" n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr "La nouvelle unité n'est pas encore dans le chemin recherche des unités. %s Ajouter le répertoire %s ?"
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr "Le répertoire de sortie %s%s%s est absent."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche inclusion dans %s."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche hérité d'inclusion dans %s."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche hérité d'unités dans %s."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche unités dans %s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "Le paquet %s est un paquet runtime seulement.%sLes paquets runtime ne peuvent pas être installés dans l'IDE."
|
||
|
||
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Le paquet %s est en lecture seule."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Le paquet %s est requis par %s, qui est marqué pour l'installation.%sVoir le graphique des paquets."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr "La paquet %s possède le fichier%s%s%s%s.%sLe fichier doit-il être renommé dans le paquet aussi?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Le paquet %s%s%s n'a pas été compilé.%sL'enlever de la liste d'installation ?"
|
||
|
||
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "Le paquet %s%s%s est marqué pour installation automatique.%sCeci implique qu'il sera installé dans l'IDE. Les paquets d'installation%sdoivent être des paquets conception."
|
||
|
||
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Le paquet %s%s%s est installé, mais aucun fichier de paquet valide(.lpk) n'a été trouvé.%s Un paquet factice a été créé."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Le paquet %s%s%s est marqué pour l'installation mais est introuvable.%sRetirer la dépendance de la liste d'installation des paquets?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Le paquet %s%s%s a été marqué pour l'installation.%sActuellement Lazarus ne supporte que les paquets liés statiquement. L'installation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous reconstruire Lazarus maintenant ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Le paquet %s%s%s a été marqué. %sActuellement Lazarus ne supporte que les paquets liés statiquement. La désinstallation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous reconstruire Lazarus maintenant ?"
|
||
|
||
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr "Le paquet contient déjà une unité avec ce nom."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "Le nom de paquet %s%s%s dans%s%s%s%s n'est pas un nom de paquet Lazarus valable."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "Le paquet a déjà une dépendance avec le paquet %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Le nom de paquet %s%s%s n'est pas un nom de paquet invalide.%sVeuillez choisir un autre nom (comme package1.lpk)."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "Le nom de paquet %s%s%s du%sfichier %s%s%s est invalide"
|
||
|
||
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "Le nom de page %s%s%s est trop long (max 100 caractères)."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Le chemin du compilateur de Free Pascal pour ce projet . Seulement requis si vous placiez la source de FPC SVN ci-dessous. Utilisé pour l'auto création de macros."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Le chemin du compilateur Free Pascal.%s Par exemple %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "Le programme %smake%s est introuvable.%sCet outil est nécessaire pour construire Lazarus.%s"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "Le projet a déjàune dépendance avec le paquet %s%s%s."
|
||
|
||
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "Le fichier d'information projet %s%s%s%sest identique au fichier principal du source!"
|
||
|
||
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Le projet doit être enregistré avant d'être construit%sSi vous définissez un répertoire de test dans les options d'environnement,%svous pourrez créer de nouveaux projets et les construire aussitôt.%sEnregistrer le projet ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Le projet nécessite le paquet %s%s%s.%sMais il est introuvable. Voir Projet->Inspecteur de projet."
|
||
|
||
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr "La classe de ressource %s%s%s descend de %s%s%s. C'est probablement un typo pour TForm."
|
||
|
||
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "La chaîne ressource %s%s%s existe déjà %sVeuillez choisir un autre nom.%sUtilisez Ignorer pour l'ajouter quand même."
|
||
|
||
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "Le composant racine ne peut pas être supprimé."
|
||
|
||
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr "L'unité %s existe deux fois dans le chemin des unités %s :"
|
||
|
||
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr "L'unité %s n'appartient à aucun paquet ou projet. %s S’il vous plaît ajouter l'unité à un paquet ou à un projet. %s Impossible de créer le fichier fpdoc."
|
||
|
||
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "L'unité %s%s%s existe déjà %sIgnorer forcera un changement de nom;%sAnnuler annulera l'enregistrement de ce source et%sArrêter interrompra toute l'opération de sauvegarde."
|
||
|
||
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
||
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
||
msgstr "Le nom d'unité %s%s%s n'est pas en minuscules.%sLe compilateur FreePascal 1.0.x exige des noms de fichiers en minuscules. Si vous n'utilisez pas FPC 1.0.x pour compiler cette unité, vous pouvez ignorer ce message.%s%sRenommer ce fichier ?"
|
||
|
||
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "L'unité a déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans le projet%savec le fichier: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans la sélection%savec le fichier: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "Le nom d'unité %s%s%s ne correspond pas au nom de fichier."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Le nom d'unité %s%s%s n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Le nom d'unité %s%s%s est le même qu'un composant installé.%sUtiliser ce nom peut causer d'étranges messages erreurs."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "Le nom d'unité %s%s%s%set nom de fichier %s%s%s diffère."
|
||
|
||
#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr "Le chemin de recherche d'unité %s%s%s contient le répertoire des sources %s%s%s du paquet %s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans le paquet:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "Le nom d'unité %s%s%s existe déjà dans ce paquet."
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Le nom d'unité n'est pas un identificateur Pascal valide."
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr "Le nom d'unité est employé quand l'ide prolonge les clauses uses."
|
||
|
||
#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr "Le répertoire de travail %s%s%s n'existe pas.%sS’il vous plaît vérifier le répertoire de travail dans le Menu>Exécuter>Configurer construire."
|
||
|
||
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr "Il y a %s méthodes abstraites pour passer outre. %sSélectionnez les méthodes pour lesquelles ils doivent être créés :"
|
||
|
||
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "Il y a plus de fonctions dans le menu contextuel."
|
||
|
||
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr "Il n'existe pas de méthodes abstraites pour passer outre."
|
||
|
||
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "D'autres fichiers dans le répertoire portent le même nom,%sne différant que par la casse:%s%s%sLes effacer ?"
|
||
|
||
#: lazarusidestrconsts:lisccoseveralcompilers
|
||
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr "Il y a plusieurs FreePascal Compilateurs dans votre chemin. %s%s%s Peut-être avez-vous oublié de supprimer un vieux compilateur ?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Deux unités portent le même nom: %s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr "Il y a un fichier .ppu plus ancien que le compilateur lui-même: %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Une unité de FPC porte le même nom que le paquet:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Une unité de FPC porte le même nom que:%s%s%s%s%s de %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr "Il y a une dépendance circulaire dans les paquets requis. Voir le graphique des paquets."
|
||
|
||
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "Un fichier porte le même nom et une extension similaire%sFichier: %s%sFichier litigieux: %s%s%sEffacer le fichier litigieux ?"
|
||
|
||
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Le nombre d'outils est limité à %s."
|
||
|
||
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "Une unité du projet porte déjà le nom %s%s%s.%sVeuillez choisir un nom différent."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Une unité porte le même nom qu'un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "Il y a déjà une fiche avec le nom %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Il y a déjà un paquet %s%s%s de chargé%sdu fichier %s%s%s.%sVoir Composants -> Graphique des paquets"
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "Une autre unité porte déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
|
||
|
||
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Il y a déjà une unité avec ce nom.%sFichier: %s"
|
||
|
||
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Il y a déjà un autre composant avec le nom %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "Un autre paquet porte déjà le nom %s%s%s.%sPaquet en conflit: %s%s%s%sFichier: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Il y a un paquet non enregistré dans les paquets requis. Voir le graphique des paquets."
|
||
|
||
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Il n'y a aucun débogueur d'indiqué.%sPlaçer des points d'arrêts n'ont aucun effet jusqu'à ce q'un débogueur ne soit installer dans le dialogue Options du débogueur dans le menu. débogueur "
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Il y a eu une erreur lors de l'écriture du composant sélectionné %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Il y a eu une erreur lors de la conversion du flux binaire du composant sélectionné %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Il y a eu une erreur lors de la copie du flux du composant vers le presse-papiers:%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Ce fichier n'est dans aucun des paquets chargés."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr "Ce fichier a été automatiquement créé par Lazarus. Ne pas l'éditer !"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "C'est un paquet virtuel. Il n'a aucune source encore. Veuillez sauvegarder le paquet d'abord."
|
||
|
||
#: lazarusidestrconsts:lisresourcefilecomment
|
||
msgid "This is an automatically generated lazarus resource file"
|
||
msgstr "Ceci est un fichier ressource généré automatiquement par Lazarus"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "C'est le paquet par défaut. Utilisez-le seulement pour les composants sans paquet. Ces composants sont obsolètes."
|
||
|
||
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr "C'est la commande du contrôle à laquelle le côté inférieur est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr "C'est la commande du contrôle à laquelle le côté gauche est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr "C'est la commande du contrôle à laquelle le côté droit est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr "C'est la commande du contrôle à laquelle le côté supérieur est ancré. Laisser vide pour le parent."
|
||
|
||
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Ceci ressemble à un fichier Pascal.%sIl est recommandé d'employer des noms de fichier en minuscules, pour éviter de divers problèmes sur quelques systèmes de fichiers et différents compilateurs.%srenommer en lettres minuscules?"
|
||
|
||
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr "Cette méthode ne peut pas être surchargé, car elle est définie dans la classe courante"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Ce paquet est installé, mais le fichier de lpk n'a pas été trouvé. Tous ses composants sont désactivés. Veuillez fixer ceci."
|
||
|
||
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr "Ce paquet fournit les mêmes que les paquets suivants :"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr "Cette source est seulement employée pour compiler et installer le paquet."
|
||
|
||
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Cette sélection ne peut pas être extraite.%sVeuillez sélectionner du code pour en extraire une nouvelle procédure/méthode."
|
||
|
||
#: lazarusidestrconsts:listhiswillhappencontinue
|
||
msgid "This will happen:%s%s%sContinue?"
|
||
msgstr "Ceci va arriver : %s%s%s Continuer ?"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Thread"
|
||
|
||
#: lazarusidestrconsts:listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr "Titre (laissez vide pour le défaut)"
|
||
|
||
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Titre et nom de fichier requis"
|
||
|
||
#: lazarusidestrconsts:dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Titre:"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtodolist
|
||
msgid "ToDo List"
|
||
msgstr "Liste ToDo"
|
||
|
||
#: lazarusidestrconsts:listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr "Options ToDo..."
|
||
|
||
#: lazarusidestrconsts:lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Commutation Fiche/Unité"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Commuter le mode"
|
||
|
||
#: lazarusidestrconsts:liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Commuter entre l'unité et la fiche"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr "Commutation Fiche/Unité"
|
||
|
||
#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr "Commuter entre afficher les noms de fichiers avec chemin d'accès ou chemin relatif"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr "Commutation Point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr "Commutation Pile d'appels"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Commutation Explorateur de code"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr "Commutation Sortie du débogueur"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Commutation Editeur de documentation"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Commutation IDE boutons rapide"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr "Commutation Variables local"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Commutation Messages"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Commutation Inspecteur d'objet"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Commutation Résultats de recherche"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Commutation Editeur de source"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr "Commutation suivi"
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
|
||
msgid "Toggle view component palette"
|
||
msgstr "Commutation Palette de composent"
|
||
|
||
#: lazarusidestrconsts:liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Nom de raccourci:"
|
||
|
||
#: lazarusidestrconsts:lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Outils"
|
||
|
||
#: lazarusidestrconsts:srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Commandes du menu Outils"
|
||
|
||
#: lazarusidestrconsts:dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Evaluation d'expression ToolTip"
|
||
|
||
#: lazarusidestrconsts:dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Outils des symboles Tooltip"
|
||
|
||
#: lazarusidestrconsts:listop
|
||
msgid "Top"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts:listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Sélection du haut de la page"
|
||
|
||
#: lazarusidestrconsts:listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "L'espace supérieur de frontière. Cette valeur est ajoutée à la base de l'espace de frontière et utilisé pour l'espace au-dessus de la commande."
|
||
|
||
#: lazarusidestrconsts:listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Espacement égal en haut"
|
||
|
||
#: lazarusidestrconsts:dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Haut:"
|
||
|
||
#: lazarusidestrconsts:listops
|
||
msgid "Tops"
|
||
msgstr "Hauts"
|
||
|
||
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Enlever les espaces à la fin"
|
||
|
||
#: lazarusidestrconsts:listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr "Turbo Pascal"
|
||
|
||
#: lazarusidestrconsts:rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr "Turque"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Tutorial"
|
||
|
||
#: lazarusidestrconsts:dlgenvtype
|
||
msgid "Type"
|
||
msgstr "Type"
|
||
|
||
#: lazarusidestrconsts:lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Type:"
|
||
|
||
#: lazarusidestrconsts:liscetypes
|
||
msgid "Types"
|
||
msgstr "Types"
|
||
|
||
#: lazarusidestrconsts:dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "MAJUSCULE"
|
||
|
||
#: lazarusidestrconsts:rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Ukrainien "
|
||
|
||
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Impossible de convertir le flux binaire en texte"
|
||
|
||
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Impossible de copier des composants vers le presse-papiers"
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Impossible d'ajouter %s au projet, car ce dernier contient déjà une unité portant le même nom."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossible d'ajouter la ressource T%s:FORMDATA au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossible d'ajouter le commentaire d'en-tête de la ressource au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts:lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Impossible de faire une copie de sauvegarde du fichier %s%s%s vers %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Impossible de modifier la liste de création automatique des fiches dans le source du programme.%sVeuillez d'abord corriger les erreurs."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Impossible de nettoyer %s%s%s.Veuillez vérifier les permissions."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Impossible de nettoyer le répertoire de destination"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Impossible de convertir le composant texte en format binaire:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Impossible de convertir le fichier %s%s%s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Impossible de convertir le fichier lfm en lrs et d'écrire le fichier lrs."
|
||
|
||
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Impossible de convertir les données texte de la fiche du fichier %s%s%s%s%sen flux binaire. (%s)"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Impossible de copier le fichier"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossible de copier le fichier %s%s%s%s vers %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossible de copier le fichier %s%s%s%svers %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr "Impossible de créer le fichier de test"
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr "Impossible de créer le fichier de test Pascal \"%s\"."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Impossible de créer le répertoire de sauvegarde %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Impossible de créer le répertoire"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Impossible de créer le répertoire %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Impossible de créer le répertoire %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Impossible de créer le fichier"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Impossible de créer le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "Impossible de créer le fichier %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
|
||
msgid "Unable to create new method. Please fix the error shown in the message window."
|
||
msgstr "Impossible de créer une nouvelle méthode. Veuillez corriger l'erreur affichée dans le fenêtre de messages."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Impossible de créer le répertoire de destination %s%s%s%s pour le paquet %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Impossible de créer le répertoire %s%s%s%spour les sources du paquet %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Impossible de créer le répertoire cible pour Lazarus:%s%s%s%s.%sCe répertoire est nécessaire pour le nouvel IDE modifié avec vos paquets personalisés."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Impossible de créer tampon temporaire lfm."
|
||
|
||
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Impossible de supprimer le fichier litigieux %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Impossible de supprimer le fichier"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Impossible de supprimer le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Impossible de supprimer l'ancien fichier d'état %s%s%s%spour le paquet %s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Impossible de trouver %s dans le flux LFM."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Impossible de trouver la section ResourceString dans cette unité ou toute autre utilisée."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Impossible de trouver un nom de classe valide dans %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Impossible de trouver le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgstr "Impossible de trouver le fichier %s%s%s.%sS'il appartient à votre projet, vérifiez le chemin de recherche dans%sProjet->Options du compilateur...->Chemins->Autres fichiers unité. Si ce fichier appartient à un paquet, vérifier les options de compilation approprié du package. Si ce fichier appartient à Lazarus, assurez-vous que la compilation est propre. Si le fichier appartient à FPC vérifier fpc.cfg. En cas de doute, vérifiez Projet->Options du compilateur...->Test."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Please fix the error shown in the message window."
|
||
msgstr "Impossible de trouver la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr "Impossible de trouver l'unité de la classe composante %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Impossible de recueillir les changements de l'éditeur."
|
||
|
||
#: lazarusidestrconsts:lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr "Impossible d'obtenir la date du fichier %s."
|
||
|
||
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Impossible d'obtenir le source pour le concepteur."
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Impossible de charger le fichier."
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Impossible de charger le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Impossible de charger l'ancien fichier ressource.%sLe fichier ressource est le premier fichier inclu dans%sla section initialization.%sPar exemple {$I %s.lrs}.%sProbablement une erreur de syntaxe."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Impossible de charger le paquet."
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr "Impossible de charger le paquet %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr "Impossible de charger le composant de classe %s%s%s, parce qu'il dépend de lui-même."
|
||
|
||
#: lazarusidestrconsts:lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr "Impossible d'ouvrir le composant ancêtre"
|
||
|
||
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Impossible d'ouvrir le concepteur .%sLa classe %s ne descend pas d'une classe designable comme TForm ou TDataModule."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Impossible d'ouvrir le paquet %s%s%s.%sCe paquet a été marqué pour l'installation."
|
||
|
||
#: lazarusidestrconsts:lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr "Impossible de lire %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Impossible de lire le fichier."
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Impossible de lire le fichier %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Impossible de lire le fichier %s%s%s%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Impossible de lire le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Impossible de lire le fichier du paquet %s%s%s.%sError: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Impossible de lire l'état du fichier %s du projet %s%sError : %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossible de lire l'état du fichier %s%s%s%sdu paquet %s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Impossible de supprimer l'ancienne copie de sauvegarde %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossible de renommer le fichier litigieux %s%s%s%sen %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Impossible de renommer le fichier"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Impossible de renommer le fichier %s%s%s en %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossible de renommer le fichier %s%s%s%sen %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Impossible de renommer la fiche dans le source."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Impossible de renommer la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Impossible de renommer la variable dans le source."
|
||
|
||
#: lazarusidestrconsts:lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr "Impossible d'exécute"
|
||
|
||
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Impossible d'exécuter l'outil %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Impossible d'enregistrer le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Impossible de placer la Commande latérale d'ancre "
|
||
|
||
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr "Impossible de montrer les méthodes abstraites de la classe courante, parce que"
|
||
|
||
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Please fix the error shown in the message window."
|
||
msgstr "Impossible d'afficher la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Impossible de créer le flux %s:T%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Impossible de créer un flux pour les composants sélectionnés."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Impossible de créer un flux pour les composants sélectionnés."
|
||
|
||
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Impossible de transformer le flux binaire du composant %s:T%s en texte."
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Impossible de mettre à jour la déclaration CreateForm dans le source du projet."
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
|
||
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
||
msgstr "Impossible de mettre à jour le fichier de ressources binaire %s%s%s à partir d'u fichier de ressource texte %s%s%s%s Le fichier texte est probablement corrompu."
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr "Impossible d'écrire %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Impossible d'écrire %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Impossible d'écrire le fichier"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile2
|
||
msgid "Unable to write file %s%s%s"
|
||
msgstr "Impossible d'écrire le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Impossible d'écrire le fichier %s%s%s%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefilename
|
||
msgid "Unable to write file %s%s%s."
|
||
msgstr "Impossible d'écrire le fichier %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr "Impossible d'écrire le fichier \"%s\":%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Impossible d'écrire le paquet %s%s%s%sdans le fichier %s%s%s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossible d'écrire le fichier d'état %s%s%s%sdu paquet %s.%sErreur: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Impossible d'écrire l'état du fichier pour le projet %s%sError : %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile2
|
||
msgid "Unable to write to file %s%s%s"
|
||
msgstr "Impossible d'écrire vers le fichier %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile
|
||
msgid "Unable to write to file %s%s%s!"
|
||
msgstr "Impossible d'écrire vers le fichier %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr "Impossible d'écrire le flux xml vers %s%sErreur : %s"
|
||
|
||
#: lazarusidestrconsts:dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr "Optimisations incertaines"
|
||
|
||
#: lazarusidestrconsts:lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr "Décommenter la sélection"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Supprimer la définition"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Supprimer toutes les définitions"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Supprimer les définitions récursivement"
|
||
|
||
#: lazarusidestrconsts:dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Souligner"
|
||
|
||
#: lazarusidestrconsts:lismenuundo
|
||
msgid "Undo"
|
||
msgstr "Défaire"
|
||
|
||
#: lazarusidestrconsts:dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Défaire après enregistrement"
|
||
|
||
#: lazarusidestrconsts:dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Mémoire maximale pour l'annulation"
|
||
|
||
#: lazarusidestrconsts:srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Désindenter le bloc"
|
||
|
||
#: lazarusidestrconsts:lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr "Désindenter la sélection"
|
||
|
||
#: lazarusidestrconsts:lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Désinstaller"
|
||
|
||
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Désinstaller au prochain démarrage"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Désinstaller le paquet %s? "
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Désinstaller le paquet ?"
|
||
|
||
#: lazarusidestrconsts:lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Désinstaller la sélection"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeunit
|
||
msgid "Unit"
|
||
msgstr "Unité"
|
||
|
||
#: lazarusidestrconsts:lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "L'unité %s%s%s a été modifiée. L'enregistrer?"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr "L'unité %s%s%s a été retirée du paquet"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Nom du fichier de l'unité:"
|
||
|
||
#: lazarusidestrconsts:uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr "Information sur l'unité"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Nom d'unité non valide"
|
||
|
||
#: lazarusidestrconsts:lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Nom d'unité:"
|
||
|
||
#: lazarusidestrconsts:lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr "Nom d'unité: "
|
||
|
||
#: lazarusidestrconsts:lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Répertoire de sortie de l'unité"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Chemin de l'unité"
|
||
|
||
#: lazarusidestrconsts:dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr "Style de l'unité"
|
||
|
||
#: lazarusidestrconsts:dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Dépendances de l'unité"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Nom de fichier de l'unité:"
|
||
|
||
#: lazarusidestrconsts:lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Identificateur d'unité existant"
|
||
|
||
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Nom d'unité déjà existant"
|
||
|
||
#: lazarusidestrconsts:lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Le nom d'unité commence par…"
|
||
|
||
#: lazarusidestrconsts:lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Nom d'unité contient ..."
|
||
|
||
#: lazarusidestrconsts:lisunitnotfound
|
||
msgid "Unit not found"
|
||
msgstr "Unité non trouvée"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr "Unité introuvable: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Répertoire de sortie pour les unités (-FU):"
|
||
|
||
#: lazarusidestrconsts:lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Chemin des unités"
|
||
|
||
#: lazarusidestrconsts:lisunitlfmfile
|
||
msgid "Unit: %s%sLFM file: %s"
|
||
msgstr "Unité: %s%sFichier LFM: %s"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Nom d'unité déjà existant"
|
||
|
||
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Nom d'unité déjà existant dans le projet"
|
||
|
||
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Le nom d'unité et de fichier ne doivent pas être identique. %s Example: unit1.pas and Unit1"
|
||
|
||
#: lazarusidestrconsts:lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Nom d'unité:"
|
||
|
||
#: lazarusidestrconsts:lisunitsnotfound2
|
||
msgid "Units not found"
|
||
msgstr "Unités non trouvées"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr "Unités ..."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Paquet non enregistré"
|
||
|
||
#: lazarusidestrconsts:dlgupword
|
||
msgid "Up"
|
||
msgstr "Haut"
|
||
|
||
#: lazarusidestrconsts:lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Mise à jour "
|
||
|
||
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr "Mettre à jour/Reconstruire"
|
||
|
||
#: lazarusidestrconsts:lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr "Mettre la sélection en majuscules"
|
||
|
||
#: lazarusidestrconsts:lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Utilisation"
|
||
|
||
#: lazarusidestrconsts:dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr "Utiliser les chaînes ANSI"
|
||
|
||
#: lazarusidestrconsts:dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgstr "Utiliser le paquet d'application pour exécuter et corriger (Darwin seulement)"
|
||
|
||
#: lazarusidestrconsts:lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr "Utiliser le Filtre d'exclusion"
|
||
|
||
#: lazarusidestrconsts:dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr "Utiliser l'unité \"Heaptrc\""
|
||
|
||
#: lazarusidestrconsts:lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr "Utiliser le filtre d'inclusion"
|
||
|
||
#: lazarusidestrconsts:dlgusecustomconfig
|
||
msgid "Use addional Compiler Config File"
|
||
msgstr "Utiliser un fichier de configuration supplémentaire du compilateur"
|
||
|
||
#: lazarusidestrconsts:dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr "Utiliser la couleur par défaut"
|
||
|
||
#: lazarusidestrconsts:dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Utiliser l'affichage"
|
||
|
||
#: lazarusidestrconsts:dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Utiliser une application de démarrage"
|
||
|
||
#: lazarusidestrconsts:dlgpousemanifest
|
||
msgid "Use manifest file to enable themes (windows only)"
|
||
msgstr "Utiliser le fichier manifeste pour activer les thèmes (Windows seulement)"
|
||
|
||
#: lazarusidestrconsts:dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr "Utiliser le fichier de configuration standard du compilateur (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Mise en évidence de la syntaxe"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Utiliser l'unité"
|
||
|
||
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Utiliser le gestionnaire de fenêtres"
|
||
|
||
#: lazarusidestrconsts:lisplduser
|
||
msgid "User"
|
||
msgstr "Utilisateur"
|
||
|
||
#: lazarusidestrconsts:srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Utilisateur d'abord"
|
||
|
||
#: lazarusidestrconsts:dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Extension utilisateur"
|
||
|
||
#: lazarusidestrconsts:dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Extension utilisateur (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts:dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Surcharge utilisateur"
|
||
|
||
#: lazarusidestrconsts:lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr "Répertoire Home de l'utilisateur"
|
||
|
||
#: lazarusidestrconsts:lisceuses
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts:dlgvaluecolor
|
||
msgid "Value"
|
||
msgstr "Valeur"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Valeur en chemins fichier"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Valeur en texte"
|
||
|
||
#: lazarusidestrconsts:dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Variable"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Nom de variable"
|
||
|
||
#: lazarusidestrconsts:dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Préfixe des champs"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Variable:"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Variable: %s"
|
||
|
||
#: lazarusidestrconsts:liscevariables
|
||
msgid "Variables"
|
||
msgstr "Variables"
|
||
|
||
#: lazarusidestrconsts:dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Messages détaillés pendant la compilation:"
|
||
|
||
#: lazarusidestrconsts:lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr "Vérifiez les appels de méthodes"
|
||
|
||
#: lazarusidestrconsts:lisversion
|
||
msgid "Version"
|
||
msgstr "Version"
|
||
|
||
#: lazarusidestrconsts:versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Information sur la version"
|
||
|
||
#: lazarusidestrconsts:rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr "Numérotation de version"
|
||
|
||
#: lazarusidestrconsts:rsversion
|
||
msgid "Version:"
|
||
msgstr "Version :"
|
||
|
||
#: lazarusidestrconsts:lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Vertical"
|
||
|
||
#: lazarusidestrconsts:dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Espacement vertical de la grille"
|
||
|
||
#: lazarusidestrconsts:lismenuviewanchoreditor
|
||
msgid "View Anchor Editor"
|
||
msgstr "Afficher l'éditeur d'ancres"
|
||
|
||
#: lazarusidestrconsts:uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Afficher la pile d'appels"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Afficher l'explorateur de code"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
||
msgid "View Component Palette"
|
||
msgstr "Afficher la palette des composants"
|
||
|
||
#: lazarusidestrconsts:srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Afficher l'éditeur de documentation"
|
||
|
||
#: lazarusidestrconsts:lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Afficher les fiches"
|
||
|
||
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Afficher les boutons rapides de l'IDE"
|
||
|
||
#: lazarusidestrconsts:lismenuviewjumphistory
|
||
msgid "View Jump-History ..."
|
||
msgstr "Afficher l'historique des déplacement ..."
|
||
|
||
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Afficher l'inspecteur d'objets"
|
||
|
||
#: lazarusidestrconsts:lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr "Afficher le source du paquet"
|
||
|
||
#: lazarusidestrconsts:lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr "Afficher les unités du projet"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Afficher les résultats de recherches"
|
||
|
||
#: lazarusidestrconsts:lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Afficher le source (.lfm)"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Afficher l'éditeur de source"
|
||
|
||
#: lazarusidestrconsts:lispeviewtodolist
|
||
msgid "View ToDo list"
|
||
msgstr "Afficher la ToDo liste"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitdependencies
|
||
msgid "View Unit Dependencies"
|
||
msgstr "Afficher les dépendances de l'unités"
|
||
|
||
#: lazarusidestrconsts:liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Afficher l'info d'unité"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitinfo
|
||
msgid "View Unit Information"
|
||
msgstr "Afficher information sur l'unité"
|
||
|
||
#: lazarusidestrconsts:lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Afficher les unités"
|
||
|
||
#: lazarusidestrconsts:srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Afficher l'éditeur d'ancres"
|
||
|
||
#: lazarusidestrconsts:srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Afficher les points d'arrêt"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Afficher la pile d'appel"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Afficher le navigateur de code"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Afficher la palette de composant"
|
||
|
||
#: lazarusidestrconsts:srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr "Afficher les composants"
|
||
|
||
#: lazarusidestrconsts:srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Afficher la fenêtre de sortie du débogueur"
|
||
|
||
#: lazarusidestrconsts:srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Afficher les fiches"
|
||
|
||
#: lazarusidestrconsts:liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Afficher l'historique des déplacement ..."
|
||
|
||
#: lazarusidestrconsts:srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Afficher les variables locales"
|
||
|
||
#: lazarusidestrconsts:srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Afficher les Commandes du menu"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Afficher les messages"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr "Afficher les fiches du projet"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewframes
|
||
msgid "View project frames"
|
||
msgstr "Afficher les cadres du projet"
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Afficher les options du projet"
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectsource
|
||
msgid "View project source"
|
||
msgstr "Afficher les sources du projet"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr "Afficher les unités du projet"
|
||
|
||
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr "Afficher l'explorateur d'incompatibilités"
|
||
|
||
#: lazarusidestrconsts:srkmecviewtodolist
|
||
msgid "View todo list"
|
||
msgstr "Afficher la liste des ToDo"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Afficher les dépendances de l'unité"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Afficher les informations de l'unité"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Afficher les unités"
|
||
|
||
#: lazarusidestrconsts:srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Afficher les points de suivi"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Visualiseurs"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Unité virtuelle"
|
||
|
||
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Unité virtuelle (source pas dans le paquet)"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Gouttière visible"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Marge droite visible"
|
||
|
||
#: lazarusidestrconsts:lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr "ATTENTION :"
|
||
|
||
#: lazarusidestrconsts:dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Prévenir à la compilation"
|
||
|
||
#: lazarusidestrconsts:lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr "Attention"
|
||
|
||
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Avertissement: le fichier additionnel de configuration du compilateur porte le même nom qu'un des fichiers standards utilisés par le compilateur FreePascal. La conséquence risque d'être que SEUL le fichier additionnel sera utilisé tandis que le fichier standard sera ignoré."
|
||
|
||
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Avertissement: le fichier %s%s%s%sappartient au présent projet."
|
||
|
||
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Avertissement: fichier litigieux trouvé: %s%s%s. Le fichier source est: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr "Avertissements"
|
||
|
||
#: lazarusidestrconsts:liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr "Propriétés des points de suivi"
|
||
|
||
#: lazarusidestrconsts:liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr "Liste de suivi"
|
||
|
||
#: lazarusidestrconsts:lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Points de suivi"
|
||
|
||
#: lazarusidestrconsts:dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "Ajouter les nouvelles fiches à celles créées automatiquement"
|
||
|
||
#: lazarusidestrconsts:lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "En commutant le fichier dans l'éditeur de source "
|
||
|
||
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor ..."
|
||
msgstr "Quand ce fichier est en cours d'utilisation dans l'éditeur de source…"
|
||
|
||
#: lazarusidestrconsts:lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Ou"
|
||
|
||
#: lazarusidestrconsts:dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Largeur:"
|
||
|
||
#: lazarusidestrconsts:dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr "Application Win32 gui"
|
||
|
||
#: lazarusidestrconsts:dlgwindow
|
||
msgid "Window"
|
||
msgstr "Fenêtre "
|
||
|
||
#: lazarusidestrconsts:dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr "Positions des fenêtres"
|
||
|
||
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
||
msgid "With packages"
|
||
msgstr "Avec paquets"
|
||
|
||
#: lazarusidestrconsts:liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "Avec les paquets requis "
|
||
|
||
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Mot sous le curseur dans l'éditeur courant"
|
||
|
||
#: lazarusidestrconsts:srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr "Compléter le mot"
|
||
|
||
#: lazarusidestrconsts:dlgwordspolicies
|
||
msgid "Words"
|
||
msgstr "Mots"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
|
||
msgid "Working Directory (Leave empty for file path)"
|
||
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Répertoire de travail:"
|
||
|
||
#: lazarusidestrconsts:dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Répertoire de travail"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (Leave empty for file path)"
|
||
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Répertoire pour construire"
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Répertoire pour éxécuter"
|
||
|
||
#: lazarusidestrconsts:liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Erreur d'écriture"
|
||
|
||
#: lazarusidestrconsts:dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr "Insérer un logo FPC"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Erreur d'écriture"
|
||
|
||
#: lazarusidestrconsts:liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr "Erreur d'écriture : %s%s Fichier : %s%s%s"
|
||
|
||
#: lazarusidestrconsts:dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Préfixe \"Write\""
|
||
|
||
#: lazarusidestrconsts:lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr "Erreur XML"
|
||
|
||
#: lazarusidestrconsts:lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Fichier XML"
|
||
|
||
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr "Erreur de l'analyseur XML dans le fichier% s% sErreur :% s"
|
||
|
||
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Vous ne pouvez pas construire Lazarus pendant que vous déboguez ou compilez."
|
||
|
||
#: lazarusidestrconsts:dlgdoesnotexist
|
||
msgid "\" does not exist."
|
||
msgstr "\" n'existe pas."
|
||
|
||
#: lazarusidestrconsts:uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" est protégé en écriture."
|
||
|
||
#: lazarusidestrconsts:lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr "\"%s\" terminé"
|
||
|
||
#: lazarusidestrconsts:srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "Interrompre la construction"
|
||
|
||
#: lazarusidestrconsts:srkmecaddbreakpoint
|
||
msgid "add break point"
|
||
msgstr "Ajouter un point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "Ajouter un suivi"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "Installation auto dynamique"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "Installation auto statique"
|
||
|
||
#: lazarusidestrconsts:lisbegins
|
||
msgid "begins"
|
||
msgstr "begins"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr "Construire tous les fichiers du programme"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "Construire le fichier"
|
||
|
||
#: lazarusidestrconsts:srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "Construire le programme/projet"
|
||
|
||
#: lazarusidestrconsts:dlglefttopclr
|
||
msgid "color for left, top"
|
||
msgstr "Couleur haut, gauche"
|
||
|
||
#: lazarusidestrconsts:dlgrightbottomclr
|
||
msgid "color for right, bottom"
|
||
msgstr "Couleur bas, droit"
|
||
|
||
#: lazarusidestrconsts:lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr "Unité FPC compilé introuvable : %s.ppu"
|
||
|
||
#: lazarusidestrconsts:srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "Options du compilateur"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr "Chemin du compilateur"
|
||
|
||
#: lazarusidestrconsts:srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "Fichier de configuration de la construction"
|
||
|
||
#: lazarusidestrconsts:liscontains
|
||
msgid "contains"
|
||
msgstr "contient "
|
||
|
||
#: lazarusidestrconsts:lisccocontains
|
||
msgid "contains "
|
||
msgstr "contient "
|
||
|
||
#: lazarusidestrconsts:liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "Options personalisées"
|
||
|
||
#: lazarusidestrconsts:liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "défaut (%s)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr "N'ajoutez pas de caractère"
|
||
|
||
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr "Fichier de message Anglais fpc est manquant : composants/codetools/fpc.errore.msg"
|
||
|
||
#: lazarusidestrconsts:srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "Evaluer/Modifier"
|
||
|
||
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "Où est écrit le fichier de déboguage. Si on ne l'indique pas, la sortie de déboguage est écrit sur la console. "
|
||
|
||
#: lazarusidestrconsts:lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr "Fpcmake échoué"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgstr "Programme freepascal employant TCustomApplication pour vérifier facilement les options en ligne de commande, manipulation des exceptions, etc. Le fichier de programme est automatiquement maintenu par Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/fr"
|
||
|
||
#: lazarusidestrconsts:dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr "i18n"
|
||
|
||
#: lazarusidestrconsts:rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr "Options i18n"
|
||
|
||
#: lazarusidestrconsts:lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "dans projet:"
|
||
|
||
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "dans tous les paquets et projets ouverts"
|
||
|
||
#: lazarusidestrconsts:lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "dans l'unité courante"
|
||
|
||
#: lazarusidestrconsts:lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "dans le projet principal"
|
||
|
||
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "dans le projet/paquet possédant l'unité courante"
|
||
|
||
#: lazarusidestrconsts:lisincludepath
|
||
msgid "include path"
|
||
msgstr "chemin 'include'"
|
||
|
||
#: lazarusidestrconsts:srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "inspecter"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "installé dynamiquement"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "installé statiquement"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "Nom de fichier de compilateur non valide"
|
||
|
||
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [options] <ficher-projet>"
|
||
|
||
#: lazarusidestrconsts:lislibrarypath
|
||
msgid "library path"
|
||
msgstr "Chemin des librairies"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr "Saut de ligne"
|
||
|
||
#: lazarusidestrconsts:lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "options de l'éditeur de liens"
|
||
|
||
#: lazarusidestrconsts:dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "minuscules"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr "macro ProjectUnitPath"
|
||
|
||
#: lazarusidestrconsts:lisoipmissing
|
||
msgid "missing"
|
||
msgstr "manquant"
|
||
|
||
#: lazarusidestrconsts:lisoipmodified
|
||
msgid "modified"
|
||
msgstr "modifié"
|
||
|
||
#: lazarusidestrconsts:lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr "Multiples configurations pour le compilateur trouvé :"
|
||
|
||
#: lazarusidestrconsts:lisnew
|
||
msgid "new"
|
||
msgstr "Nouveau"
|
||
|
||
#: lazarusidestrconsts:lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr "Symboles de nouvelle ligne"
|
||
|
||
#: lazarusidestrconsts:lisuidno
|
||
msgid "no"
|
||
msgstr "non"
|
||
|
||
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
||
msgid "no automatic renaming"
|
||
msgstr "Ne pas renommer automatiquement"
|
||
|
||
#: lazarusidestrconsts:lisccdnoclass
|
||
msgid "no class"
|
||
msgstr "Aucune classe"
|
||
|
||
#: lazarusidestrconsts:liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr "Aucun fpc.cfg trouvé"
|
||
|
||
#: lazarusidestrconsts:lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr "Sans ASCII"
|
||
|
||
#: lazarusidestrconsts:lisnoname
|
||
msgid "noname"
|
||
msgstr "sans_nom"
|
||
|
||
#: lazarusidestrconsts:lisnone2
|
||
msgid "none"
|
||
msgstr "Aucun"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "Aucun sélectionné"
|
||
|
||
#: lazarusidestrconsts:lisobjectpath
|
||
msgid "object path"
|
||
msgstr "Chemin du code objet"
|
||
|
||
#: lazarusidestrconsts:lisold
|
||
msgid "old"
|
||
msgstr "Ancien"
|
||
|
||
#: lazarusidestrconsts:lisor
|
||
msgid "or"
|
||
msgstr "ou"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "paquet %s non enregistré"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "fichier source principal du paquet"
|
||
|
||
#: lazarusidestrconsts:srkmecpause
|
||
msgid "pause program"
|
||
msgstr "suspendre le programme"
|
||
|
||
#: lazarusidestrconsts:lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "veuillez choisir une macro"
|
||
|
||
#: lazarusidestrconsts:lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr "PPU existe deux fois: %s, %s"
|
||
|
||
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "Premier répertoire de configuration, là où Lazarrus stocke ses dossiers de configuration. Par défaut c'est"
|
||
|
||
#: lazarusidestrconsts:srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "compiler vite, aucun lien"
|
||
|
||
#: lazarusidestrconsts:lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "Lecture seule"
|
||
|
||
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr "Chemin relatif de l'unité trouvé dans fpc cfg:%s"
|
||
|
||
#: lazarusidestrconsts:lisremove
|
||
msgid "remove"
|
||
msgstr "Supprimer"
|
||
|
||
#: lazarusidestrconsts:srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "Enlever le point d'arrêt"
|
||
|
||
#: lazarusidestrconsts:srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "Réinitialiser le débogueur"
|
||
|
||
#: lazarusidestrconsts:srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "Exécuter le fichier"
|
||
|
||
#: lazarusidestrconsts:srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "Paramètres d'exécution"
|
||
|
||
#: lazarusidestrconsts:srkmecrun
|
||
msgid "run program"
|
||
msgstr "Exécuter le programme"
|
||
|
||
#: lazarusidestrconsts:lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr "Enregistrer tous les fichiers modifiés"
|
||
|
||
#: lazarusidestrconsts:lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr "Enregistrer le fichier courant"
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr "Rechercher dans tous les fichiers &ouverts"
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr "Rechercher dans tous les fichiers du &projet"
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr "Rechercher dans les &répertoires"
|
||
|
||
#: lazarusidestrconsts:dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "Sec"
|
||
|
||
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "Deuxième répertoire de configuration, là où Lazarre recherche ses fichiers template. Par défaut c'est"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "Mettre FPC en mode DELPHI"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr "Mettre FPC en mode FPC"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "Mettre FPC en mode GPC"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr "Mettre FPC en mode MacPas"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "Mettre FPC en mode TP"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "Activer IOCHECKS"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "Activer OVERFLOWCHECKS"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "Activer RANGECHECKS"
|
||
|
||
#: lazarusidestrconsts:lissmallerratherthanfaster
|
||
msgid "smaller rather than faster"
|
||
msgstr "Petit plutôt que rapide"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr "Espace"
|
||
|
||
#: lazarusidestrconsts:lisccospaces
|
||
msgid "spaces"
|
||
msgstr "Espaces"
|
||
|
||
#: lazarusidestrconsts:lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr "Caractères spéciaux"
|
||
|
||
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "Fichier de configuration des paquets statiques"
|
||
|
||
#: lazarusidestrconsts:srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "Arrêter le programme"
|
||
|
||
#: lazarusidestrconsts:listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "ce message d'aide"
|
||
|
||
#: lazarusidestrconsts:lisunitpath
|
||
msgid "unit path"
|
||
msgstr "Chemin des unités"
|
||
|
||
#: lazarusidestrconsts:srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "Commande d'édition inconnue"
|
||
|
||
#: lazarusidestrconsts:lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr "Caractères insolites"
|
||
|
||
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "utiliser l'unité HeapTrc"
|
||
|
||
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "utiliser l'unité LineInfo"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr "Fin de mot"
|
||
|
||
#: lazarusidestrconsts:lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr "Mauvais chemin du délimiteur"
|
||
|
||
#: lazarusidestrconsts:lisuidyes
|
||
msgid "yes"
|
||
msgstr "Oui"
|
||
|