mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-02-25 05:08:23 +01:00
11316 lines
334 KiB
Plaintext
11316 lines
334 KiB
Plaintext
msgid ""
|
||
msgstr ""
|
||
"Last-Translator: Dean Zobec <dezobec@tin.it>\n"
|
||
"PO-Revision-Date: 2006-02-25 21:31+0100\n"
|
||
"Project-Id-Version: lazaruside\n"
|
||
"Language-Team: Italian\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"MIME-Version: 1.0\n"
|
||
"X-Generator: KBabel 1.10.2\n"
|
||
|
||
#: lazarusidestrconsts:srkmcommand1
|
||
msgid " command1 \""
|
||
msgstr " comando1 \""
|
||
|
||
#: lazarusidestrconsts:srkmcommand2
|
||
msgid " command2 \""
|
||
msgstr " comando2 \""
|
||
|
||
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
||
msgid " A token %s%s%s already exists! "
|
||
msgstr "Esiste già un token %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:srkmalreadyconnected
|
||
msgid " The key \"%s\" is already connected to \"%s\"."
|
||
msgstr "Il tasto \"%s\" è già connesso a \"%s\"."
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmconflicw
|
||
msgid " conflicts with "
|
||
msgstr " ha conflitti con "
|
||
|
||
#: lazarusidestrconsts:liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (compilazione ...)"
|
||
|
||
#: lazarusidestrconsts:lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (debug ...)"
|
||
|
||
#: lazarusidestrconsts:liscovarious
|
||
msgid "%s (various)"
|
||
msgstr "%s (vari)"
|
||
|
||
#: lazarusidestrconsts:lisnewproject
|
||
msgid "%s - (new project)"
|
||
msgstr "%s - (nuovo progetto)"
|
||
|
||
#: lazarusidestrconsts:lislazarusversionstring
|
||
msgid "%s beta"
|
||
msgstr "%s beta"
|
||
|
||
#: lazarusidestrconsts:lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s byte"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "directory %s"
|
||
|
||
#: lazarusidestrconsts:lisdoesnotexists
|
||
msgid "%s does not exists: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s fa già parte del progetto."
|
||
|
||
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "directory progetto %s"
|
||
|
||
#: lazarusidestrconsts:lisunitinpackage
|
||
msgid "%s unit %s in package %s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "%s%s%s non è un nome progetto valido.%sScegliere un altro nome (per es. progetto1.lpi)"
|
||
|
||
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
||
msgid "%s%s%s is not a valid identifier."
|
||
msgstr "%s%s%s non è un identificatore valido"
|
||
|
||
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
||
msgid "%s%s%s is not a valid unit name."
|
||
msgstr "%s%s%s non è un nome unit valido."
|
||
|
||
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you are sure to do that."
|
||
msgstr "%s%sClick OK if you are sure to do that."
|
||
|
||
#: lazarusidestrconsts:lispkgsysfilename
|
||
msgid "%s%sFile Name: %s%s%s"
|
||
msgstr "%s%sNome file: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sImpossibile cambiare classe da %s a %s"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitname
|
||
msgid "%s%sUnit Name: %s%s%s"
|
||
msgstr "%s%sNome unit: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Pagina: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, auto generata"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
||
msgid "%s, project specific"
|
||
msgstr "%s, specifica del progetto"
|
||
|
||
#: lazarusidestrconsts:lisuereadonly
|
||
msgid "%s/ReadOnly"
|
||
msgstr "%s/SolaLettura"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s%s"
|
||
msgstr "%sAggiunta nuova dipendenza per il pacchetto %s: pacchetto %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s%s"
|
||
msgstr "%sAggiunta nuova dipendenza per il progetto %s: pacchetto %s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sEntrambi i pacchetti sono connessi. Ciò significa che un pacchetto usa l'altro o che entrambi sono usati da un terzo pacchetto."
|
||
|
||
#: lazarusidestrconsts:lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sDescrizione: %s"
|
||
|
||
#: lazarusidestrconsts:lisa2pexistingfile
|
||
msgid "%sExisting file: %s%s%s"
|
||
msgstr "%sFile esistente: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sVedere progetto -> Analizzatore progetti"
|
||
|
||
#: lazarusidestrconsts:lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sStato: "
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
||
msgstr "%sLe seguenti unit saranno aggiunte alla sezione uses di%s%s:%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sQuesto pacchetto è installato ma il file lpk non è stato trovato"
|
||
|
||
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
||
msgid "%sThis package was automatically created"
|
||
msgstr "%sQuesto pacchetto è stato creato automaticamente"
|
||
|
||
#: lazarusidestrconsts:lisnone
|
||
msgid "%snone"
|
||
msgstr "%snessuno"
|
||
|
||
#: lazarusidestrconsts:liswladd
|
||
msgid "&Add"
|
||
msgstr "&Aggiungi"
|
||
|
||
#: lazarusidestrconsts:uemaddbreakpoint
|
||
msgid "&Add Breakpoint"
|
||
msgstr "&Aggiungi breakpoint"
|
||
|
||
#: lazarusidestrconsts:lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcasesensitive
|
||
msgid "&Case Sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilecasesensitive
|
||
msgid "&Case sensitive"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclose
|
||
msgid "&Close"
|
||
msgstr "&Chiudi"
|
||
|
||
#: lazarusidestrconsts:uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Chiudi pagina"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Componenti"
|
||
|
||
#: lazarusidestrconsts:liswldelete
|
||
msgid "&Delete"
|
||
msgstr "&Cancella"
|
||
|
||
#: lazarusidestrconsts:lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Modifica"
|
||
|
||
#: lazarusidestrconsts:lisenableall
|
||
msgid "&Enable All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlenabled
|
||
msgid "&Enabled"
|
||
msgstr "&Abilitato"
|
||
|
||
#: lazarusidestrconsts:dlgentirescope
|
||
msgid "&Entire Scope"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufile
|
||
msgid "&File"
|
||
msgstr "&File"
|
||
|
||
#: lazarusidestrconsts:lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "Trova dichiarazione"
|
||
|
||
#: lazarusidestrconsts:dlgfromcursor
|
||
msgid "&From Cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgglobal
|
||
msgid "&Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "Vai al segnalibro"
|
||
|
||
#: lazarusidestrconsts:lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Aiuto"
|
||
|
||
#: lazarusidestrconsts:lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Oggetti"
|
||
|
||
#: lazarusidestrconsts:lisok
|
||
msgid "&Ok"
|
||
msgstr "&Ok"
|
||
|
||
#: lazarusidestrconsts:uemopenfileatcursor
|
||
msgid "&Open file at cursor"
|
||
msgstr "Apri il file al cursore"
|
||
|
||
#: lazarusidestrconsts:lismenupackage
|
||
msgid "&Package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Progetto"
|
||
|
||
#: lazarusidestrconsts:dlgpromptonreplace
|
||
msgid "&Prompt On Replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Propriet<65>"
|
||
|
||
#: lazarusidestrconsts:dlgregularexpressions
|
||
msgid "&Regular Expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfileregularexpressions
|
||
msgid "&Regular expressions"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsremove
|
||
msgid "&Remove"
|
||
msgstr "&Rimuovi"
|
||
|
||
#: lazarusidestrconsts:lismenureplace2
|
||
msgid "&Replace ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgreplacewith
|
||
msgid "&Replace With"
|
||
msgstr "&Rimpiazza con"
|
||
|
||
#: lazarusidestrconsts:lismenurun
|
||
msgid "&Run"
|
||
msgstr "&Esegui"
|
||
|
||
#: lazarusidestrconsts:uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "Esegui fino al cu&rsore"
|
||
|
||
#: lazarusidestrconsts:lismenusearch
|
||
msgid "&Search"
|
||
msgstr "&Cerca"
|
||
|
||
#: lazarusidestrconsts:dlgselectedtext
|
||
msgid "&Selected Text"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemsetbookmark
|
||
msgid "&Set Bookmark"
|
||
msgstr "Imposta segnalibro"
|
||
|
||
#: lazarusidestrconsts:lissourcebreakpoint
|
||
msgid "&Source breakpoint"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtexttofing
|
||
msgid "&Text to Find"
|
||
msgstr "&Testo da trovare"
|
||
|
||
#: lazarusidestrconsts:lismenutools
|
||
msgid "&Tools"
|
||
msgstr "S&trumenti"
|
||
|
||
#: lazarusidestrconsts:lismenuview
|
||
msgid "&View"
|
||
msgstr "&Visualizza"
|
||
|
||
#: lazarusidestrconsts:lismenuviewsource
|
||
msgid "&View Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwholewordsonly
|
||
msgid "&Whole Words Only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuwindow
|
||
msgid "&Window"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscefilter
|
||
msgid "(Filter)"
|
||
msgstr "(Filtro)"
|
||
|
||
#: lazarusidestrconsts:lisfilter2
|
||
msgid "(filter)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(nessuna subdirectory)"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnodocumentation
|
||
msgid "(none)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(macro sconosciuta: %s)"
|
||
|
||
#: lazarusidestrconsts:lisplistall
|
||
msgid "<All>"
|
||
msgstr "<TUTTI>"
|
||
|
||
#: lazarusidestrconsts:liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<NESSUNO>"
|
||
|
||
#: lazarusidestrconsts:lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<Nessuno>"
|
||
|
||
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
||
msgid "<choose an existing file>"
|
||
msgstr "<scegliere un file esistente>"
|
||
|
||
#: lazarusidestrconsts:lismodifiedlgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisgplnotice
|
||
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<nessuna variabile selezionata>"
|
||
|
||
#: lazarusidestrconsts:lisoff
|
||
msgid "? (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lison
|
||
msgid "? (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "Un %s non può controllare TControls.$sÈ possibile mettervi sopra solo componenti non visuali."
|
||
|
||
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
||
msgid "A file %s%s%s already exists.%sReplace it?"
|
||
msgstr "Un file %s%s%s esiste gia.%sLo rimpiazzo?"
|
||
|
||
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
||
msgid "A pascal unit must have the extension .pp or .pas"
|
||
msgstr "Una unit pascal deve avere un'estensione .pp o .pas"
|
||
|
||
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
||
msgid "A required packages was not found. See package graph."
|
||
msgstr "Un pacchetto richiesto non è stato trovato. Vedere grafico del pacchetto."
|
||
|
||
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
||
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
||
msgstr "Un semplice file di programma Pascal.%sPuò essere utilizzato per semplici e rapidi test.%sÈ meglio creare un nuovo progetto."
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Per uno strumento valido è necessario almeno un titolo e un nome file."
|
||
|
||
#: lazarusidestrconsts:lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinfobuildmakeabort
|
||
msgid "Abort"
|
||
msgstr "Interrompi"
|
||
|
||
#: lazarusidestrconsts:lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Interrompi l'operazione di build"
|
||
|
||
#: lazarusidestrconsts:lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Interrompi tutto"
|
||
|
||
#: lazarusidestrconsts:lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Interrompi tutto il caricamento"
|
||
|
||
#: lazarusidestrconsts:liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Interrompi building"
|
||
|
||
#: lazarusidestrconsts:lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Interrompi il caricamento del progetto"
|
||
|
||
#: lazarusidestrconsts:lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Interrompi l'intero caricamento"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildabort
|
||
msgid "Aborted..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplateabout
|
||
msgid "About"
|
||
msgstr "Informazioni"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Informazioni su Lazarus"
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract methods - not yet overridden"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Accetta"
|
||
|
||
#: lazarusidestrconsts:lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Riconoscimenti"
|
||
|
||
#: lazarusidestrconsts:lislazbuildaboaction
|
||
msgid "Action"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Azione: %s"
|
||
|
||
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Attiva la sintassi delle espressioni regolari per il testo e per la sostituzione (quasi come in perl)"
|
||
|
||
#: lazarusidestrconsts:liscodetempladd
|
||
msgid "Add"
|
||
msgstr "Aggiungi"
|
||
|
||
#: lazarusidestrconsts:lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Aggiungere %s al progetto?"
|
||
|
||
#: lazarusidestrconsts:uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Aggiungi &watch al cursore"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfile
|
||
msgid "Add File"
|
||
msgstr "Aggiungi file"
|
||
|
||
#: lazarusidestrconsts:lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Aggiungi file"
|
||
|
||
#: lazarusidestrconsts:rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Aggiungi inverso"
|
||
|
||
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
||
msgid "Add LFM, LRS files, if they exist"
|
||
msgstr "aggiungere file LFM, LRS se esistono"
|
||
|
||
#: lazarusidestrconsts:lisa2paddunit
|
||
msgid "Add Unit"
|
||
msgstr "Aggiungi unit"
|
||
|
||
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
||
msgid "Add active unit to a package"
|
||
msgstr "Aggiungi unit ad un pacchetto"
|
||
|
||
#: lazarusidestrconsts:liskmaddactiveunittoproject
|
||
msgid "Add active unit to project"
|
||
msgstr "Aggiungi la unit attiva al progetto"
|
||
|
||
#: lazarusidestrconsts:lispckeditaddanitem
|
||
msgid "Add an item"
|
||
msgstr "Aggiungi una voce"
|
||
|
||
#: lazarusidestrconsts:dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmaddbreakpoint
|
||
msgid "Add break point"
|
||
msgstr "Aggiungi un breakpoint"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbreakpoint
|
||
msgid "Add breakpoint"
|
||
msgstr "Aggiungi breakpoint"
|
||
|
||
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Aggiungi modello di codice"
|
||
|
||
#: lazarusidestrconsts:lisadddirectory
|
||
msgid "Add directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuaddtoproject
|
||
msgid "Add editor file to Project"
|
||
msgstr "Aggiungi un file dell'editor al progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojaddeditorfile
|
||
msgid "Add editor files"
|
||
msgstr "Aggiungi file editor"
|
||
|
||
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
||
msgid "Add file to a package"
|
||
msgstr "Aggiungi un file ad un pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
||
msgid "Add file to project:"
|
||
msgstr "Aggiungi file al progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojaddfiles
|
||
msgid "Add files"
|
||
msgstr "Aggiungi file"
|
||
|
||
#: lazarusidestrconsts:lisaddfilesofdirectory
|
||
msgid "Add files of directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2paddfilestopackage
|
||
msgid "Add files to package"
|
||
msgstr "Aggiungi file al pacchetto"
|
||
|
||
#: lazarusidestrconsts:srkmecaddjumppoint
|
||
msgid "Add jump point"
|
||
msgstr "Aggiungi un punto di salto"
|
||
|
||
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
||
msgid "Add jump point to history"
|
||
msgstr "Aggiungi punto di salto nello storico"
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddlinkbutton
|
||
msgid "Add link"
|
||
msgstr "Aggiungi collegamento"
|
||
|
||
#: lazarusidestrconsts:lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Aggiungi opzioni ai pacchetti e progetti dipendenti"
|
||
|
||
#: lazarusidestrconsts:podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Aggiungi percorso"
|
||
|
||
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Aggiungi percorsi ai pacchetti/progetti dipendenti"
|
||
|
||
#: lazarusidestrconsts:dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Aggiungi punto e virgola"
|
||
|
||
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
||
msgid "Add to favourite properties"
|
||
msgstr "Aggiungi alle proprietà preferite"
|
||
|
||
#: lazarusidestrconsts:lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Aggiungi al pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtoproject
|
||
msgid "Add to project"
|
||
msgstr "Aggiungi al progetto"
|
||
|
||
#: lazarusidestrconsts:lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Aggiunta unit al comando uses del pacchetto. Disabilitarlo solo per le unit che non debbano essere sempre compilate."
|
||
|
||
#: lazarusidestrconsts:liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Aggiungi watch"
|
||
|
||
#: lazarusidestrconsts:lismenuaddwatch
|
||
msgid "Add watch ..."
|
||
msgstr "Aggiungi watch ..."
|
||
|
||
#: lazarusidestrconsts:dlgedadd
|
||
msgid "Add..."
|
||
msgstr "Aggiungi..."
|
||
|
||
#: lazarusidestrconsts:dlgadditionalsrcpath
|
||
msgid "Additional Source search path for all projects (.pp;.pas)"
|
||
msgstr "Percorso di ricerca aggiuntivo codice sorgente per tutti i progetti (.pp;.pas)"
|
||
|
||
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
||
msgid "Additional compiler options inherited from packages"
|
||
msgstr "Opzioni aggiuntive del compilatore ereditate dai pacchetti"
|
||
|
||
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "File aggiuntivi da cercare (cioè /percorso/*.pas;/percorso2/*.pp)"
|
||
|
||
#: lazarusidestrconsts:rsadditionalinfo
|
||
msgid "Additional info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Percorso di ricerca opzionale"
|
||
|
||
#: lazarusidestrconsts:dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Aggiusta linea in testa a causa del commento nel frontespizio"
|
||
|
||
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
|
||
msgid "Advanced Build Options"
|
||
msgstr "Opzioni di Build avanzate"
|
||
|
||
#: lazarusidestrconsts:rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Africani"
|
||
|
||
#: lazarusidestrconsts:fdmalignword
|
||
msgid "Align"
|
||
msgstr "Allinea"
|
||
|
||
#: lazarusidestrconsts:lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Allineamento"
|
||
|
||
#: lazarusidestrconsts:lisemdall
|
||
msgid "All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallfiles
|
||
msgid "All Files"
|
||
msgstr "Tutti i files"
|
||
|
||
#: lazarusidestrconsts:lisallblockslooksok
|
||
msgid "All blocks looks ok."
|
||
msgstr "Tutti i blocchi sembrano Ok"
|
||
|
||
#: lazarusidestrconsts:dlgallfiles
|
||
msgid "All files"
|
||
msgstr "Tutti i file"
|
||
|
||
#: lazarusidestrconsts:lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Tutti i pacchetti"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Tutti i progetti"
|
||
|
||
#: lazarusidestrconsts:lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Consenti LABEL e GOTO"
|
||
|
||
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Permetti la ricerca per righe multiple"
|
||
|
||
#: lazarusidestrconsts:dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "Alfabeticamente"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolalt
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts:dlgaltsetclmode
|
||
msgid "Alt-Key sets column mode"
|
||
msgstr "Alt-tasto imposta la modalità colonna"
|
||
|
||
#: lazarusidestrconsts:lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmalternkey
|
||
msgid "Alternative key (or 2 keys combination)"
|
||
msgstr "Chiave alternativa (o seconda combinazione chiave)"
|
||
|
||
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
|
||
msgid "Always Build before Run"
|
||
msgstr "Fai sempre la build prima di eseguire"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Esegui sempre il build (anche se non è cambiato nulla)"
|
||
|
||
#: lazarusidestrconsts:dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Tipo antenato ambiguo"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Nome classe ambiguo"
|
||
|
||
#: lazarusidestrconsts:lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Nome unit ambiguo"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound
|
||
msgid "Ambiguous Unit found"
|
||
msgstr "Trovata unit ambigua"
|
||
|
||
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "File di configurazione del compilatore aggiuntivo ambiguo"
|
||
|
||
#: lazarusidestrconsts:lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Azione sui file ambigua:"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Trovato file ambiguo"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
||
msgstr "Trovato file ambiguo: %s%s%s%sQuesto file può essere confuso con %s%s%s%s%sCancellare il file ambiguo?"
|
||
|
||
#: lazarusidestrconsts:lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Trovati file ambigui"
|
||
|
||
#: lazarusidestrconsts:lisambiguousunitfound2
|
||
msgid "Ambiguous unit found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Trovata unit ambigua"
|
||
|
||
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
||
msgstr "L'ultimo startup è incorso in un errore mentre veniva caricato %s!%s%sCaricare di nuovo questo progetto?"
|
||
|
||
#: lazarusidestrconsts:lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Tipo antenato"
|
||
|
||
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Anchor Editor - nessun controllo selezionato"
|
||
|
||
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
||
msgid "Anchor to bottom side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
||
msgid "Anchor to left side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
||
msgid "Anchor to right side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
||
msgid "Anchor to top side of sibling, keep border space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Aggiungi in fondo alla sezione"
|
||
|
||
#: lazarusidestrconsts:dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Applicazione"
|
||
|
||
#: lazarusidestrconsts:dlgapplicationsettings
|
||
msgid "Application Settings"
|
||
msgstr "Impostazioni dell'applicazione"
|
||
|
||
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
||
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Applicazione%sUn programma grafico lcl/Freepascal. Il file del programma viene gestito automaticamente da Lazarus."
|
||
|
||
#: lazarusidestrconsts:dlgbutapply
|
||
msgid "Apply"
|
||
msgstr "Applica"
|
||
|
||
#: lazarusidestrconsts:lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Applica i cambiamenti"
|
||
|
||
#: lazarusidestrconsts:rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Arabo"
|
||
|
||
#: lazarusidestrconsts:dlgcoasis
|
||
msgid "As-Is"
|
||
msgstr "Così com'è"
|
||
|
||
#: lazarusidestrconsts:lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "Ascendente"
|
||
|
||
#: lazarusidestrconsts:dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Chiede"
|
||
|
||
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Chiedi prima di sostituire ogni testo trovato"
|
||
|
||
#: lazarusidestrconsts:dlgcoasmstyle
|
||
msgid "Assembler style:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "Chiocciola"
|
||
|
||
#: lazarusidestrconsts:lispckoptsauthor
|
||
msgid "Author:"
|
||
msgstr "Autore:"
|
||
|
||
#: lazarusidestrconsts:liscodetemplautocompleteon
|
||
msgid "Auto complete on ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgautoform
|
||
msgid "Auto create form when opening unit"
|
||
msgstr "Auto crea form durante l'apertura della unit"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
||
msgstr "I nodi auto creati non possono essere modificati, %sné possono esserlo i nodi figlio auto creati."
|
||
|
||
#: lazarusidestrconsts:dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Auto cancellazione file"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes can not be edited."
|
||
msgstr "I nodi autogenerati non possono essere modificati"
|
||
|
||
#: lazarusidestrconsts:dlgautoident
|
||
msgid "Auto indent"
|
||
msgstr "Indentazione automatica"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "Quando esegui il rebuild di tutto, auto rebuild"
|
||
|
||
#: lazarusidestrconsts:dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Rinomina automatica del file in minuscolo"
|
||
|
||
#: lazarusidestrconsts:dlgautosave
|
||
msgid "Auto save"
|
||
msgstr "Salvataggio automatico"
|
||
|
||
#: lazarusidestrconsts:lisautoshowobjectinspector
|
||
msgid "Auto show Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Creazione automatica form:"
|
||
|
||
#: lazarusidestrconsts:lispckexplautocreated
|
||
msgid "AutoCreated"
|
||
msgstr "Autocreato"
|
||
|
||
#: lazarusidestrconsts:rslanguageautomatic
|
||
msgid "Automatic (or english)"
|
||
msgstr "Automatico (o inglese)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticfeatures
|
||
msgid "Automatic features"
|
||
msgstr "Features automatiche"
|
||
|
||
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
||
msgid "Automatically increment version on build"
|
||
msgstr "Con l'operazione di build incrementa automaticamnente la versione"
|
||
|
||
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Pacchetti installati automaticamente"
|
||
|
||
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Esegui automaticamente il build se necessario"
|
||
|
||
#: lazarusidestrconsts:dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Form disponibili:"
|
||
|
||
#: lazarusidestrconsts:lisavailablepackages
|
||
msgid "Available packages"
|
||
msgstr "Pacchetti disponibili"
|
||
|
||
#: lazarusidestrconsts:dlgedback
|
||
msgid "Back"
|
||
msgstr "Indietro"
|
||
|
||
#: lazarusidestrconsts:fdmorderbackone
|
||
msgid "Back one"
|
||
msgstr "Indietro di uno"
|
||
|
||
#: lazarusidestrconsts:dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Sfondo"
|
||
|
||
#: lazarusidestrconsts:dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Backup"
|
||
|
||
#: lazarusidestrconsts:lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Backup file fallito"
|
||
|
||
#: lazarusidestrconsts:dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Dietro ai metodi"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypebinary
|
||
msgid "Binary"
|
||
msgstr "Binario"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Blocco"
|
||
|
||
#: lazarusidestrconsts:dlgblockindent
|
||
msgid "Block indent"
|
||
msgstr "Intentazione di blocco"
|
||
|
||
#: lazarusidestrconsts:dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Grassetto"
|
||
|
||
#: lazarusidestrconsts:uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Segnalibro"
|
||
|
||
#: lazarusidestrconsts:lisborderspace
|
||
msgid "BorderSpace"
|
||
msgstr "Bordi"
|
||
|
||
#: lazarusidestrconsts:lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottom
|
||
msgid "Bottom"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Spazia in fondo equidistante"
|
||
|
||
#: lazarusidestrconsts:lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Code"
|
||
|
||
#: lazarusidestrconsts:dlgbrachighlight
|
||
msgid "Bracket highlighting"
|
||
msgstr "Evidenziazione parentesi"
|
||
|
||
#: lazarusidestrconsts:lisbreak
|
||
msgid "Break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubeaklinesinselection
|
||
msgid "Break Lines in selection"
|
||
msgstr "Linee spezzate nella selezione"
|
||
|
||
#: lazarusidestrconsts:srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Spezza la riga e sposta il cursore"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Spezza la riga e lascia il cursore dov'è"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
||
msgid "Break on Lazarus Exceptions"
|
||
msgstr "Interrompi in caso di Eccezione di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "BreakPoint"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Punto di interruzione"
|
||
|
||
#: lazarusidestrconsts:lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Dipendenza errata"
|
||
|
||
#: lazarusidestrconsts:lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Dipendenza errata"
|
||
|
||
#: lazarusidestrconsts:lispatheditbrowse
|
||
msgid "Browse"
|
||
msgstr "Esplora"
|
||
|
||
#: lazarusidestrconsts:lisbrowseforcompiler
|
||
msgid "Browse for Compiler (%s)"
|
||
msgstr "Sfoglia per il compilatore (%s)"
|
||
|
||
#: lazarusidestrconsts:lismenubuild
|
||
msgid "Build"
|
||
msgstr "Esegui build"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildall
|
||
msgid "Build All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcodetools
|
||
msgid "Build CodeTools"
|
||
msgstr "Esegui build dei CodeTools"
|
||
|
||
#: lazarusidestrconsts:lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Comando per la Build"
|
||
|
||
#: lazarusidestrconsts:lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Esegui build del file"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Esegui build dell'IDE"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
|
||
msgid "Build IDE with Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
|
||
msgid "Build IDE without Packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildjitform
|
||
msgid "Build JITForm"
|
||
msgstr "Esegui build della form JIT"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbobuildlcl
|
||
msgid "Build LCL"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenubuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Build Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnumber
|
||
msgid "Build Number"
|
||
msgstr "Numero di build"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildoptions
|
||
msgid "Build Options"
|
||
msgstr "Opzioni di Build"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildsynedit
|
||
msgid "Build SynEdit"
|
||
msgstr "Esegui build del SynEdit"
|
||
|
||
#: lazarusidestrconsts:lismenubuildall
|
||
msgid "Build all"
|
||
msgstr "Esegui build di tutto"
|
||
|
||
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
|
||
msgid "Build all files of project/program"
|
||
msgstr "Build si tutti i files del progetto/programma"
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
||
msgid "Build components (SynEdit, CodeTools)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildbuildexamples
|
||
msgid "Build examples"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecbuildlazarus
|
||
msgid "Build lazarus"
|
||
msgstr "Build Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Esegui build di un nuovo progetto"
|
||
|
||
#: lazarusidestrconsts:liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Build del progetto/programma"
|
||
|
||
#: lazarusidestrconsts:rsbuild
|
||
msgid "Build:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcmacro
|
||
msgid "C Style Macros (global)"
|
||
msgstr "Macro in stile C (globale)"
|
||
|
||
#: lazarusidestrconsts:dlgcocops
|
||
msgid "C Style Operators (*=, +=, /= and -=)"
|
||
msgstr "Operatori in stile C (*=, +=, /= e -=)"
|
||
|
||
#: lazarusidestrconsts:dlgcppinline
|
||
msgid "C++ Styled INLINE"
|
||
msgstr "INLINE in stile C++"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
||
msgid "CVS keyword"
|
||
msgstr "Comando CVS"
|
||
|
||
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Chiama %sregistra%s la procedura della unit selezionata"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Stack chiamate"
|
||
|
||
#: lazarusidestrconsts:liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Chiamata su:"
|
||
|
||
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
||
msgid "Can not copy top level component."
|
||
msgstr "Impossibile copiare componente di primo livello."
|
||
|
||
#: lazarusidestrconsts:liscannotcreatefile
|
||
msgid "Can not create file %s%s%s"
|
||
msgstr "Impossibile creare il file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Can not register components without unit"
|
||
msgstr "Impossibile registrare componenti senza una unit"
|
||
|
||
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "È possibile solo cambiare la classe dei TComponents."
|
||
|
||
#: lazarusidestrconsts:dlgcancel
|
||
msgid "Cancel"
|
||
msgstr "Annulla"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Annulla il caricamento di questo componente"
|
||
|
||
#: lazarusidestrconsts:liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Annulla il caricamento della unit"
|
||
|
||
#: lazarusidestrconsts:liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Annulla rinomina"
|
||
|
||
#: lazarusidestrconsts:lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Lista dei contributors non trovata"
|
||
|
||
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
||
msgid "Cannot find lazarus starter:%s%s"
|
||
msgstr "Impossibile trovare esecutore di Lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Indifferente alle maiuscole/minuscole"
|
||
|
||
#: lazarusidestrconsts:rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Catalano"
|
||
|
||
#: lazarusidestrconsts:liscecategories
|
||
msgid "Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listtodolcategory
|
||
msgid "Category"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcentercursorline
|
||
msgid "Center Cursor Line"
|
||
msgstr "Centra riga cursore"
|
||
|
||
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Centra nella finestra"
|
||
|
||
#: lazarusidestrconsts:liscenters
|
||
msgid "Centers"
|
||
msgstr "Centra"
|
||
|
||
#: lazarusidestrconsts:liscodetemplchange
|
||
msgid "Change"
|
||
msgstr "Cambia"
|
||
|
||
#: lazarusidestrconsts:lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Cambia classe"
|
||
|
||
#: lazarusidestrconsts:lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Cambia Carattere"
|
||
|
||
#: lazarusidestrconsts:lischangefile
|
||
msgid "Change file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischangeparent
|
||
msgid "Change parent ..."
|
||
msgstr "Cambia padre ..."
|
||
|
||
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
||
msgid "ChangeLog entry"
|
||
msgstr "Voce Changelog"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
||
msgid "Changed files:"
|
||
msgstr "File cambiati:"
|
||
|
||
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Cambiando il nome pacchetto o la versione, interrompe le dipendenze. Si desidera cambiare anche le dipendenze?%sBattete Sì se volete cambiare tutte le dipendenze elencate%so Ignora per interrompere le dipendenze e continuare."
|
||
|
||
#: lazarusidestrconsts:srkmecchar
|
||
msgid "Char"
|
||
msgstr "Char"
|
||
|
||
#: lazarusidestrconsts:lischaracter
|
||
msgid "Character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Mappa caratteri"
|
||
|
||
#: lazarusidestrconsts:rscharacterset
|
||
msgid "Character set:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuchecklfm
|
||
msgid "Check LFM file in editor"
|
||
msgstr "Controlla file LFM nell'editor"
|
||
|
||
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
||
msgid "Check changes on disk with loading"
|
||
msgstr "Verifica i cambiamenti su disco durante il caricamento"
|
||
|
||
#: lazarusidestrconsts:dlgcheckconsistency
|
||
msgid "Check consistency"
|
||
msgstr "Controlla consistenza"
|
||
|
||
#: lazarusidestrconsts:dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcochecks
|
||
msgid "Checks:"
|
||
msgstr "Controlli:"
|
||
|
||
#: lazarusidestrconsts:rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Cinese"
|
||
|
||
#: lazarusidestrconsts:lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Scegli la directory contenente i files .po"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Scegli il pacchetto Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Scegli il progetto Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Scegli la unit Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts:lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Scegli la directory"
|
||
|
||
#: lazarusidestrconsts:lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Scegliere la directory sorgente FPC"
|
||
|
||
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Scegliere lo schema della tastiera"
|
||
|
||
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Scegliere la directory Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisedoptschoosescheme
|
||
msgid "Choose Scheme"
|
||
msgstr "Scegliere schema"
|
||
|
||
#: lazarusidestrconsts:lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
||
msgid "Choose a base class for the favourite property %s%s%s."
|
||
msgstr "Scegli una classe base per le proprietà favorite %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Scegliere un nome differente"
|
||
|
||
#: lazarusidestrconsts:lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Scegliere il file modello di codice (*.dci)"
|
||
|
||
#: lazarusidestrconsts:lischoosecompilerpath
|
||
msgid "Choose compiler filename (%s)"
|
||
msgstr "Scegli in nome del file del compilatore (%s)"
|
||
|
||
#: lazarusidestrconsts:lischoosedebuggerpath
|
||
msgid "Choose debugger filename"
|
||
msgstr "Scegliere il nome file del debugger"
|
||
|
||
#: lazarusidestrconsts:lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Scegliere la directory"
|
||
|
||
#: lazarusidestrconsts:lischoosemakepath
|
||
msgid "Choose make path"
|
||
msgstr "Scegli il percorso make"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Scegli una di queste voci per creare un nuovo File"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Scegli uno di queste voci per creare un nuovo Package"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Scegli una di queste voci per creare un nuovo Progetto"
|
||
|
||
#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Scegliere sorgente programma (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Scegli la struttura per racchiudere la selezione"
|
||
|
||
#: lazarusidestrconsts:lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Scegliere la directory per il test"
|
||
|
||
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
||
msgid "Circle in package dependencies"
|
||
msgstr "Dipendenze pacchetto circolari"
|
||
|
||
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
||
msgstr "La classe %s%s%s non è una class componente registrata.%sImpossibile incollare."
|
||
|
||
#: lazarusidestrconsts:lisoifclassnotfound
|
||
msgid "Class %s%s%s not found."
|
||
msgstr "Classe %s%s%s non trovata."
|
||
|
||
#: lazarusidestrconsts:lisclassofmethodnotfound
|
||
msgid "Class %s%s%s of method %s%s%s not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Il nome della classe esiste già"
|
||
|
||
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
|
||
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Classe non trovata"
|
||
|
||
#: lazarusidestrconsts:dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Ordine delle classi"
|
||
|
||
#: lazarusidestrconsts:dlgclassinsertpolicy
|
||
msgid "Class part insert policy"
|
||
msgstr "Criterio di inserimento classi"
|
||
|
||
#: lazarusidestrconsts:liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Classico"
|
||
|
||
#: lazarusidestrconsts:liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Pulisci la cartella"
|
||
|
||
#: lazarusidestrconsts:liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Pulisci sorgenti Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
|
||
msgid "Clean Up + Build all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanall
|
||
msgid "Clean all"
|
||
msgstr "Pulisci tutto"
|
||
|
||
#: lazarusidestrconsts:lismenucleandirectory
|
||
msgid "Clean directory ..."
|
||
msgstr "Pulisci directory ..."
|
||
|
||
#: lazarusidestrconsts:liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Pulisci le sottodirectory"
|
||
|
||
#: lazarusidestrconsts:liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "Pulisco il percorso dei moduli?"
|
||
|
||
#: lazarusidestrconsts:lislazbuildcleanbuild
|
||
msgid "Clean+Build"
|
||
msgstr "Pulisci+build"
|
||
|
||
#: lazarusidestrconsts:lisuidclear
|
||
msgid "Clear"
|
||
msgstr "Clear"
|
||
|
||
#: lazarusidestrconsts:liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
||
msgid "Clear dependency filename"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Pulisci il log durante l'esecuzione"
|
||
|
||
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Fai clic su di una delle voci sopra per vedere il risultato di un diff"
|
||
|
||
#: lazarusidestrconsts:lismenuclose
|
||
msgid "Close"
|
||
msgstr "Chiudi"
|
||
|
||
#: lazarusidestrconsts:liskmcloseall
|
||
msgid "Close All"
|
||
msgstr "Chiudi tutto"
|
||
|
||
#: lazarusidestrconsts:lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Chiudi il progetto"
|
||
|
||
#: lazarusidestrconsts:lismenucloseall
|
||
msgid "Close all editor files"
|
||
msgstr "Chiudi tutti i file dell'editor"
|
||
|
||
#: lazarusidestrconsts:lissrclosepage
|
||
msgid "Close page"
|
||
msgstr "Chiudi la pagina"
|
||
|
||
#: lazarusidestrconsts:liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Chiudi il progetto"
|
||
|
||
#: lazarusidestrconsts:dlgcodegeneration
|
||
msgid "Code"
|
||
msgstr "Codice"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodebrowser
|
||
msgid "Code Browser"
|
||
msgstr "Navigatore del codice"
|
||
|
||
#: lazarusidestrconsts:dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Creazione codice"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
||
msgid "Code Explorer"
|
||
msgstr "Esploratore di codice"
|
||
|
||
#: lazarusidestrconsts:lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Templates di codice ..."
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolstab
|
||
msgid "Code Tools"
|
||
msgstr "Strumenti del codice"
|
||
|
||
#: lazarusidestrconsts:liscodebrowser
|
||
msgid "Code browser"
|
||
msgstr "Navigatore del codice"
|
||
|
||
#: lazarusidestrconsts:dlgusecodefolding
|
||
msgid "Code folding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedcodeparams
|
||
msgid "Code parameters"
|
||
msgstr "Parametri del codice"
|
||
|
||
#: lazarusidestrconsts:srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Completamento modello di codice"
|
||
|
||
#: lazarusidestrconsts:dlgedcodetempl
|
||
msgid "Code templates"
|
||
msgstr "Modelli di codice"
|
||
|
||
#: lazarusidestrconsts:lisceocodeexplorer
|
||
msgid "CodeExplorer Options"
|
||
msgstr "Opzioni dell'esploratore di codice"
|
||
|
||
#: lazarusidestrconsts:liscodetools
|
||
msgid "CodeTools"
|
||
msgstr "CodeTools"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
||
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Editor dei define dei CodeTool"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
||
msgid "CodeTools Defines Preview"
|
||
msgstr "Anteprima dei define dei CodeTool"
|
||
|
||
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Valori cartella CodeTool"
|
||
|
||
#: lazarusidestrconsts:dlgcodetoolsopts
|
||
msgid "CodeTools Options"
|
||
msgstr "Opzioni CodeTool"
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsoptions
|
||
msgid "CodeTools Options ..."
|
||
msgstr "Opzioni CodeTool ..."
|
||
|
||
#: lazarusidestrconsts:srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Comandi per i CodeTool"
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
||
msgid "CodeTools defines editor ..."
|
||
msgstr "Editor dei define dei CodeTool ..."
|
||
|
||
#: lazarusidestrconsts:liskmcodetoolsoptions
|
||
msgid "CodeTools options"
|
||
msgstr "Opzioni CodeTools"
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
||
msgid "Codetools defines editor"
|
||
msgstr "Editor dei define dei CodeTool"
|
||
|
||
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
||
msgid "Codetools options"
|
||
msgstr "Opzioni dei CodeTool"
|
||
|
||
#: lazarusidestrconsts:liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Comprimi tutte le classi"
|
||
|
||
#: lazarusidestrconsts:liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Comprimi tutti i pacchetti"
|
||
|
||
#: lazarusidestrconsts:liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Comprimi tutte le unit"
|
||
|
||
#: lazarusidestrconsts:lismenucollectpofil
|
||
msgid "Collect .po files"
|
||
msgstr "Raccogli i file .po"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Duepunti"
|
||
|
||
#: lazarusidestrconsts:dlgedcolor
|
||
msgid "Color"
|
||
msgstr "Colore"
|
||
|
||
#: lazarusidestrconsts:dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Schema colori"
|
||
|
||
#: lazarusidestrconsts:dlgenvcolors
|
||
msgid "Colors"
|
||
msgstr "Colori"
|
||
|
||
#: lazarusidestrconsts:srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Modalità selezione a colonne"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Virgola"
|
||
|
||
#: lazarusidestrconsts:liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Comando dopo"
|
||
|
||
#: lazarusidestrconsts:liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Comando dopo non valido"
|
||
|
||
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Comando dopo la pubblicazione di un modulo"
|
||
|
||
#: lazarusidestrconsts:srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Comandi di comandi"
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparameters
|
||
msgid "Command line parameters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Parametri della riga di comando (senza il nome dell'applicazione)"
|
||
|
||
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Parametri della riga di comando del programma"
|
||
|
||
#: lazarusidestrconsts:liscocommand
|
||
msgid "Command:"
|
||
msgstr "Comando:"
|
||
|
||
#: lazarusidestrconsts:lismenucommentselection
|
||
msgid "Comment selection"
|
||
msgstr "Commenta la selezione"
|
||
|
||
#: lazarusidestrconsts:liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Commento:"
|
||
|
||
#: lazarusidestrconsts:dlgcocompilation
|
||
msgid "Compilation"
|
||
msgstr "Compilazione"
|
||
|
||
#: lazarusidestrconsts:liscocalloncompile
|
||
msgid "Compile"
|
||
msgstr "Compila"
|
||
|
||
#: lazarusidestrconsts:liscompileidewithoutlinking
|
||
msgid "Compile IDE (without linking)"
|
||
msgstr "Compilare l'IDE (senza linking)"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildcaption
|
||
msgid "Compile Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Compilare tutto?"
|
||
|
||
#: lazarusidestrconsts:lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Compila il pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Aggiunta percorso sorgenti compilatore"
|
||
|
||
#: lazarusidestrconsts:liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Compilatore"
|
||
|
||
#: lazarusidestrconsts:dlgcompileroptions
|
||
msgid "Compiler Options"
|
||
msgstr "Opzioni compilatore"
|
||
|
||
#: lazarusidestrconsts:lismenucompileroptions
|
||
msgid "Compiler Options ..."
|
||
msgstr "Opzioni compilatore ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Opzioni del compilatore per il pacchetto %s"
|
||
|
||
#: lazarusidestrconsts:liscompileroptionsforproject
|
||
msgid "Compiler Options for Project: %s"
|
||
msgstr "Opzioni compilatore per il progetto: %s"
|
||
|
||
#: lazarusidestrconsts:liscompilererror
|
||
msgid "Compiler error"
|
||
msgstr "Errore del compilatore"
|
||
|
||
#: lazarusidestrconsts:liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Nome file compilatore"
|
||
|
||
#: lazarusidestrconsts:liskmcompileroptions
|
||
msgid "Compiler options"
|
||
msgstr "Opzioni del compolatore"
|
||
|
||
#: lazarusidestrconsts:dlgfpcpath
|
||
msgid "Compiler path (e.g. %s)"
|
||
msgstr "Percorso del compilatore (%s)"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildcomplile
|
||
msgid "Compiling..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenucompletecode
|
||
msgid "Complete Code"
|
||
msgstr "Completa codice"
|
||
|
||
#: lazarusidestrconsts:srkmeccompletecode
|
||
msgid "Complete code"
|
||
msgstr "Completa il codice"
|
||
|
||
#: lazarusidestrconsts:dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Completa le proprietà"
|
||
|
||
#: lazarusidestrconsts:liscomponent
|
||
msgid "Component"
|
||
msgstr "Componenti"
|
||
|
||
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class %s%s%s already defined"
|
||
msgstr "Classe componenti %s%s%s già definita"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameiskeyword
|
||
msgid "Component name %s%s%s is keyword"
|
||
msgstr "Il nome del componente %s%s%s è una parola chiave"
|
||
|
||
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
||
msgid "Component name %s%s%s is not a valid identifier"
|
||
msgstr "Il nome del componente %s%s%s non è un identificatore valido"
|
||
|
||
#: lazarusidestrconsts:lisfpcomponents
|
||
msgid "Components"
|
||
msgstr "Componenti"
|
||
|
||
#: lazarusidestrconsts:liscondition
|
||
msgid "Condition"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmconfigbuildfile
|
||
msgid "Config %sBuild File%s"
|
||
msgstr "Configura %sBuild File%s"
|
||
|
||
#: lazarusidestrconsts:dlgconfigfiles
|
||
msgid "Config Files:"
|
||
msgstr "File di configurazione:"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
||
msgid "Configure %sBuild Lazarus%s"
|
||
msgstr "Configura %sEsegui un build di Lazarus%s"
|
||
|
||
#: lazarusidestrconsts:lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Configura Build %s"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmconfigurehelp
|
||
msgid "Configure Help"
|
||
msgstr "Configura il manuale"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurehelp
|
||
msgid "Configure Help ..."
|
||
msgstr "Configura l'aiuto ..."
|
||
|
||
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Configura \"Build Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigurecustomcomponents
|
||
msgid "Configure custom components"
|
||
msgstr "Configura componenti personali"
|
||
|
||
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
||
msgid "Configure custom components ..."
|
||
msgstr "Configura componenti personalizzati ..."
|
||
|
||
#: lazarusidestrconsts:lismenusettings
|
||
msgid "Configure custom tools ..."
|
||
msgstr "Configura strumenti personalizzati ..."
|
||
|
||
#: lazarusidestrconsts:liskmconfigureinstalledpackages
|
||
msgid "Configure installed packages"
|
||
msgstr "Configura i packages installati"
|
||
|
||
#: lazarusidestrconsts:lismenueditinstallpkgs
|
||
msgid "Configure installed packages ..."
|
||
msgstr "Configura i pacchetti installati ..."
|
||
|
||
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
||
msgid "Confirm before rebuilding Lazarus"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Conferma i cambiamenti"
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Conferma la cancellazione della dipendenza"
|
||
|
||
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Conferma la rimozione del file"
|
||
|
||
#: lazarusidestrconsts:liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Conflitto"
|
||
|
||
#: lazarusidestrconsts:lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Trovato un conflitto"
|
||
|
||
#: lazarusidestrconsts:lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceconstants
|
||
msgid "Constants"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Il nome del costruttore deve essere 'init' (e del distruttore deve essere 'done')"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Contenuti"
|
||
|
||
#: lazarusidestrconsts:lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Aiuto sensibile al contesto"
|
||
|
||
#: lazarusidestrconsts:liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Aiuto relativo al contesto"
|
||
|
||
#: lazarusidestrconsts:liscontinue
|
||
msgid "Continue"
|
||
msgstr "Continua"
|
||
|
||
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Continua senza caricare la form"
|
||
|
||
#: lazarusidestrconsts:liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Contributors"
|
||
|
||
#: lazarusidestrconsts:liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Il controllo necessita del genitore"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Opzioni di conversione"
|
||
|
||
#: lazarusidestrconsts:lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Errore di conversione"
|
||
|
||
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM file to LFM"
|
||
msgstr "Converti file DFM in LFM"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
||
msgid "Convert DFM file to LFM ..."
|
||
msgstr "Converti file DFM in LFM ..."
|
||
|
||
#: lazarusidestrconsts:lispwconvertproject
|
||
msgid "Convert Delphi Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
||
msgid "Convert Delphi package to Lazarus package ..."
|
||
msgstr "Converti un pacchetto Delphi in pacchetto Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi project to Lazarus project"
|
||
msgstr "Converti un progetto Delphi in progetto Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
||
msgid "Convert Delphi project to Lazarus project ..."
|
||
msgstr "Converti un progetto Delphi in progetto Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi unit to Lazarus unit"
|
||
msgstr "Converti unit Delphi in unit Lazarus"
|
||
|
||
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
||
msgid "Convert Delphi unit to Lazarus unit ..."
|
||
msgstr "Converti unit Delphi in unit Lazarus ..."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Converti nodo"
|
||
|
||
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Converte i tab in spazi nella selezione"
|
||
|
||
#: lazarusidestrconsts:lismenucopy
|
||
msgid "Copy"
|
||
msgstr "Copia"
|
||
|
||
#: lazarusidestrconsts:liscopyall
|
||
msgid "Copy All"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Errore di copia"
|
||
|
||
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
||
msgid "Copy all and hidden messages to clipboard"
|
||
msgstr "Copia tutto e i messaggi nascosti negli appunti"
|
||
|
||
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
||
msgid "Copy all messages to clipboard"
|
||
msgstr "Copia tutti i messaggi negli appunti"
|
||
|
||
#: lazarusidestrconsts:liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Errore di copia"
|
||
|
||
#: lazarusidestrconsts:uemcopyfilename
|
||
msgid "Copy filename"
|
||
msgstr "Copia il nome del file"
|
||
|
||
#: lazarusidestrconsts:lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Copia dall'ereditato"
|
||
|
||
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Copia il nome del metodo negli Appunti"
|
||
|
||
#: lazarusidestrconsts:lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
|
||
msgid "Copy selected Components to clipboard"
|
||
msgstr "Copia il Componente selezionato negli Appunti"
|
||
|
||
#: lazarusidestrconsts:lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Copia i componenti selezionati negli appunti"
|
||
|
||
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
||
msgid "Copy selected messages to clipboard"
|
||
msgstr "Copia i messaggi selezionati negli appunti"
|
||
|
||
#: lazarusidestrconsts:srkmeccopy
|
||
msgid "Copy selection to clipboard"
|
||
msgstr "Copia la selezione negli appunti"
|
||
|
||
#: lazarusidestrconsts:lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Copia la parola sulla copia nulla"
|
||
|
||
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "La copia di una form intera non è stata implementata."
|
||
|
||
#: lazarusidestrconsts:rscopyright
|
||
msgid "Copyright:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Contatore (.pp;1)"
|
||
|
||
#: lazarusidestrconsts:lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Crea"
|
||
|
||
#: lazarusidestrconsts:lismenucreatepofile
|
||
msgid "Create .po files"
|
||
msgstr "Crea i file .po"
|
||
|
||
#: lazarusidestrconsts:dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Crea i define per la directory %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Crea i define per il progetto %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Crea i define per il compilatore Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Crea i Define per il codice sorgente SVN di Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
||
msgid "Create Defines for Lazarus Directory"
|
||
msgstr "Crea i define per la directory Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Crea Macro FPC e percorsi per una directory progetto fpc"
|
||
|
||
#: lazarusidestrconsts:lismenucreatefpdocfiles
|
||
msgid "Create FPDoc files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcocreatemakefile
|
||
msgid "Create Makefile"
|
||
msgstr "Crea il Makefile"
|
||
|
||
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
||
msgid "Create Submenu"
|
||
msgstr "Crea submenu"
|
||
|
||
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
||
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Crea una nuova applicazione cgi.%sIl file del programma viene mantenuto da Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Crea un nuovo file.%sScegliere il tipo."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Crea un file di testo vuoto."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
||
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
||
msgstr "Crea una nuova applicazione grafica.%sIl file programma viene gestito da Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
||
msgid "Create a new pascal unit."
|
||
msgstr "Crea una nuova unit pascal."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
||
msgid "Create a new program."
|
||
msgstr "Crea un nuovo programma."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
||
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
||
msgstr "Crea un nuovo programma.%sIl file programma viene gestito da Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Crea un nuovo progetto"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Crea un nuovo progetto.%sScegliere il tipo."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Crea un nuovo packege standard.%sUn package è un insieme di unit e componenti."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Crea una nuova unit con una form LCL."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Crea una nuova unit con un modulo dati."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Crea prima un progetto!"
|
||
|
||
#: lazarusidestrconsts:liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscreateit
|
||
msgid "Create it"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pcreatenewfile
|
||
msgid "Create new file"
|
||
msgstr "Crea un nuovo file"
|
||
|
||
#: lazarusidestrconsts:liscreatenewproject
|
||
msgid "Create new project"
|
||
msgstr "Crea un nuovo progetto"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
||
msgid "Creation"
|
||
msgstr "Creazione"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolctrl
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts:liscurrent
|
||
msgid "Current"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Progetto corrente"
|
||
|
||
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
||
msgid "Current Project Directory"
|
||
msgstr "Directory progetto corrente"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertdatetime
|
||
msgid "Current date and time"
|
||
msgstr "Data e ora correnti"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertusername
|
||
msgid "Current username"
|
||
msgstr "Nome utente corrente"
|
||
|
||
#: lazarusidestrconsts:dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Cursore oltre EOL"
|
||
|
||
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Colonna cursore nell'editor corrente"
|
||
|
||
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Comandi movimento cursore"
|
||
|
||
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Riga cursore nell'editor corrente"
|
||
|
||
#: lazarusidestrconsts:dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Personalizzato"
|
||
|
||
#: lazarusidestrconsts:liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Programma personalizzato"
|
||
|
||
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
||
msgid "Custom Program%sA freepascal program."
|
||
msgstr "Programma personalizzato%sUn programma freepascal."
|
||
|
||
#: lazarusidestrconsts:liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Comandi personalizzati"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Identificatore personalizzato"
|
||
|
||
#: lazarusidestrconsts:liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Opzioni personalizzate"
|
||
|
||
#: lazarusidestrconsts:rsiwpcustomposition
|
||
msgid "Custom position"
|
||
msgstr "Posizione personalizzata"
|
||
|
||
#: lazarusidestrconsts:srkmeccustomtool
|
||
msgid "Custom tool %d"
|
||
msgstr "Strumento personalizzato %d"
|
||
|
||
#: lazarusidestrconsts:lismenucut
|
||
msgid "Cut"
|
||
msgstr "Taglia"
|
||
|
||
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
|
||
msgid "Cut selected Components to clipboard"
|
||
msgstr "Taglia i Componebti selezionati negli Appunti"
|
||
|
||
#: lazarusidestrconsts:lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Taglia i componenti selezionati negli appunti"
|
||
|
||
#: lazarusidestrconsts:srkmeccut
|
||
msgid "Cut selection to clipboard"
|
||
msgstr "Taglia la selezione negli appunti"
|
||
|
||
#: lazarusidestrconsts:liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "D&isabilita Tutto"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Database"
|
||
|
||
#: lazarusidestrconsts:lisdate
|
||
msgid "Date"
|
||
msgstr "Data"
|
||
|
||
#: lazarusidestrconsts:liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "Cance&lla Tutto"
|
||
|
||
#: lazarusidestrconsts:uemdebugword
|
||
msgid "Debug"
|
||
msgstr "Debug"
|
||
|
||
#: lazarusidestrconsts:lismenuviewdebugoutput
|
||
msgid "Debug output"
|
||
msgstr "Segnalazioni di debug"
|
||
|
||
#: lazarusidestrconsts:lismenudebugwindows
|
||
msgid "Debug windows"
|
||
msgstr "Finestre di debug"
|
||
|
||
#: lazarusidestrconsts:lismendebuggeroptions
|
||
msgid "Debugger Options ..."
|
||
msgstr "Opzioni del debugger ..."
|
||
|
||
#: lazarusidestrconsts:lisdebuggererror
|
||
msgid "Debugger error"
|
||
msgstr "Errore del debugger"
|
||
|
||
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Errore del debugger%sOoops, il debugger è entrato in stato di errore%sSalvate subito il vostro lavoro!%sPremere stop e sperare..."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Opzioni generali del debugger"
|
||
|
||
#: lazarusidestrconsts:lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Debugger non valido"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Aggiunta percorso debugger (nessuno):"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Opzioni specifiche del debugger (dipendono dal tipo di debugger)"
|
||
|
||
#: lazarusidestrconsts:dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Tipo di debugger e percorso"
|
||
|
||
#: lazarusidestrconsts:dlgcodebugging
|
||
msgid "Debugging:"
|
||
msgstr "Debugging:"
|
||
|
||
#: lazarusidestrconsts:lisdecimal
|
||
msgid "Decimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgassemblerdefault
|
||
msgid "Default"
|
||
msgstr "Predefinito"
|
||
|
||
#: lazarusidestrconsts:dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Carattere dell'editor predefinito"
|
||
|
||
#: lazarusidestrconsts:dlgpasext
|
||
msgid "Default pascal extension"
|
||
msgstr "Estensione Pascal predefinita"
|
||
|
||
#: lazarusidestrconsts:dlgdefvaluecolor
|
||
msgid "Default value"
|
||
msgstr "Valore predefinito"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Define"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Define ricorsivamente"
|
||
|
||
#: lazarusidestrconsts:lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeddelay
|
||
msgid "Delay"
|
||
msgstr "Ritardo"
|
||
|
||
#: lazarusidestrconsts:dlgeddelete
|
||
msgid "Delete"
|
||
msgstr "Cancella"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
||
msgid "Delete From Template..."
|
||
msgstr "Cancella dai modelli..."
|
||
|
||
#: lazarusidestrconsts:lismenueditordeleteitem
|
||
msgid "Delete Item"
|
||
msgstr "Cancella voce"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Cancella l'ultimo carattere"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Cancellare il vecchio file pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Cancellare tutti questi files?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Cancellare file ambiguo?"
|
||
|
||
#: lazarusidestrconsts:lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Cancella il carettere al cursore"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Cancella la riga corrente"
|
||
|
||
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Cancella la dipendenza di %s?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Cancellazione non riuscita"
|
||
|
||
#: lazarusidestrconsts:lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Cancellazione del file fallita"
|
||
|
||
#: lazarusidestrconsts:liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Cancella l'ultimo carattere"
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
|
||
msgid "Delete link"
|
||
msgstr "Cancella collegamento"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Cancella nodo"
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile
|
||
msgid "Delete old file %s%s%s?"
|
||
msgstr "Cancellare il vecchio file %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file %s%s%s?"
|
||
msgstr "Cancellare il vecchio file pacchetto %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmdeleteselection
|
||
msgid "Delete selection"
|
||
msgstr "Cancella la selezione"
|
||
|
||
#: lazarusidestrconsts:dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Cancella il modello "
|
||
|
||
#: lazarusidestrconsts:srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Cancella fino all'inizio della riga"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Cancella fino alla fine della riga"
|
||
|
||
#: lazarusidestrconsts:srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Cancella fino alla fine della parola"
|
||
|
||
#: lazarusidestrconsts:srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Cancella fino all'inizio della parola"
|
||
|
||
#: lazarusidestrconsts:srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Cancella tutto il testo"
|
||
|
||
#: lazarusidestrconsts:lisdeletingoffilefailed
|
||
msgid "Deleting of file %s%s%s failed."
|
||
msgstr "Cancellazione del file %s%s%s fallita."
|
||
|
||
#: lazarusidestrconsts:lisdelphi
|
||
msgid "Delphi"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdelphi2ext
|
||
msgid "Delphi 2 Extensions"
|
||
msgstr "Estensione Delphi 2"
|
||
|
||
#: lazarusidestrconsts:dlgdeplhicomp
|
||
msgid "Delphi Compatible"
|
||
msgstr "Compatibile Delphi"
|
||
|
||
#: lazarusidestrconsts:lisdelphiproject
|
||
msgid "Delphi project"
|
||
msgstr "Progetto Delphi"
|
||
|
||
#: lazarusidestrconsts:lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Dipendenza"
|
||
|
||
#: lazarusidestrconsts:lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Proprietà dipendenze"
|
||
|
||
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "La dipendenza esiste già"
|
||
|
||
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Dipendenza senza proprietario: %s"
|
||
|
||
#: lazarusidestrconsts:lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Discendente"
|
||
|
||
#: lazarusidestrconsts:listodoldescription
|
||
msgid "Description"
|
||
msgstr "Descrizione"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
||
msgid "Description/Abstract"
|
||
msgstr "Descrizione/Sommario"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Descrizione:"
|
||
|
||
#: lazarusidestrconsts:lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Descrizione: "
|
||
|
||
#: lazarusidestrconsts:liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Comandi di progettazione"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and Runtime"
|
||
msgstr "Progettazione e esecuzione"
|
||
|
||
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
||
msgid "Designtime only"
|
||
msgstr "Solo progettazione"
|
||
|
||
#: lazarusidestrconsts:dlgdesktop
|
||
msgid "Desktop"
|
||
msgstr "Desktop"
|
||
|
||
#: lazarusidestrconsts:dlgdesktopfiles
|
||
msgid "Desktop files"
|
||
msgstr "File del desktop"
|
||
|
||
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
||
msgid "Destination Package"
|
||
msgstr "Pacchetto di destinazione"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Directory di destinazione"
|
||
|
||
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
||
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
||
msgstr "La directory di destinazione %s%s%s non è valida.%sScegliere un percorso completo."
|
||
|
||
#: lazarusidestrconsts:lismenudiff
|
||
msgid "Diff"
|
||
msgstr "Diff"
|
||
|
||
#: lazarusidestrconsts:liskmdiffeditorfiles
|
||
msgid "Diff editor files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdigits
|
||
msgid "Digits:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Direzione"
|
||
|
||
#: lazarusidestrconsts:lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Direttive"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Directory"
|
||
|
||
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
||
msgid "Directory does not exist"
|
||
msgstr "La directory non esiste"
|
||
|
||
#: lazarusidestrconsts:dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Directory per il build dei progetti di test"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Directory non trovata"
|
||
|
||
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
||
msgid "Directory options"
|
||
msgstr "Opzioni directory"
|
||
|
||
#: lazarusidestrconsts:lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdisablegroup
|
||
msgid "Disable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdisabled
|
||
msgid "Disabled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Annulla modifiche"
|
||
|
||
#: lazarusidestrconsts:dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Visualizza"
|
||
|
||
#: lazarusidestrconsts:dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Display (non per win32, per esempio 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts:dlglnumsbct
|
||
msgid "Display Line Numbers in Run-time Error Backtraces"
|
||
msgstr "Mostra i numeri di linea nelle backtrace degli errori di esecuzione"
|
||
|
||
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Distingui tra lettere maiuscole e minuscole per es. tra A e a"
|
||
|
||
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
||
msgid "Divider Draw Level"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheide
|
||
msgid "Do not close the IDE"
|
||
msgstr "Non chiudere l'IDE"
|
||
|
||
#: lazarusidestrconsts:lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Non chiudere il progetto"
|
||
|
||
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Non salvare alcuna informazione di sessione"
|
||
|
||
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Non mostrare lo splash screen"
|
||
|
||
#: lazarusidestrconsts:lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Non mostrare pi<70> questo messaggio"
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlinefront
|
||
msgid "Do not split line In front of:"
|
||
msgstr "Nno spezzare le righe davanti a:"
|
||
|
||
#: lazarusidestrconsts:dlgnotsplitlineafter
|
||
msgid "Do not split line after:"
|
||
msgstr "Non spezzare le righe dietro a:"
|
||
|
||
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Vuoi veramente eliminare tutti i cambiamenti al pacchetto %s e ricaricarlo dal file?"
|
||
|
||
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus?"
|
||
msgstr "Vuoi fare il rebuild di Lazarus?"
|
||
|
||
#: lazarusidestrconsts:rsiwpdocked
|
||
msgid "Docked"
|
||
msgstr "Ridotti a icona"
|
||
|
||
#: lazarusidestrconsts:lismvdocking
|
||
msgid "Docking"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdocumentationeditor
|
||
msgid "Documentation Editor"
|
||
msgstr "Editor della documentazione"
|
||
|
||
#: lazarusidestrconsts:lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Dominio"
|
||
|
||
#: lazarusidestrconsts:listodoldone
|
||
msgid "Done"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgdoubleclickline
|
||
msgid "Double click line"
|
||
msgstr "Riga a doppio click"
|
||
|
||
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
||
msgid "Double click on messages jumps (otherwise: single click)"
|
||
msgstr "Doppio clic sul messaggio salta (altrimenti: clic singolo)"
|
||
|
||
#: lazarusidestrconsts:dlgdownword
|
||
msgid "Down"
|
||
msgstr "Giù"
|
||
|
||
#: lazarusidestrconsts:dlgdragdroped
|
||
msgid "Drag Drop editing"
|
||
msgstr "Modifica a \"trascina e rilascia\""
|
||
|
||
#: lazarusidestrconsts:dlgdropfiles
|
||
msgid "Drop files"
|
||
msgstr "Rilascia file"
|
||
|
||
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
||
msgstr "Nome duplicato: Esiste gi<67> un componente chiamato %s%s%s nel componente ereditato %s"
|
||
|
||
#: lazarusidestrconsts:rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Olandese"
|
||
|
||
#: lazarusidestrconsts:liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "A&bilita tutto"
|
||
|
||
#: lazarusidestrconsts:lismenuenvironent
|
||
msgid "E&nvironment"
|
||
msgstr "Ambie&nte"
|
||
|
||
#: lazarusidestrconsts:lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsedit
|
||
msgid "Edit"
|
||
msgstr "Modifica"
|
||
|
||
#: lazarusidestrconsts:liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
||
msgid "Edit General Options"
|
||
msgstr "Modifica opzioni generali"
|
||
|
||
#: lazarusidestrconsts:srkmeditkeys
|
||
msgid "Edit Keys"
|
||
msgstr "Modifica tasti"
|
||
|
||
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
||
msgid "Edit Options to compile package"
|
||
msgstr "Modifica le opzioni per compilare il pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Modifica strumenti"
|
||
|
||
#: lazarusidestrconsts:lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Modifica il modello di codice"
|
||
|
||
#: lazarusidestrconsts:lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liseteditcustomscanners
|
||
msgid "Edit custom scanners (%s)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgededit
|
||
msgid "Edit..."
|
||
msgstr "Modifica..."
|
||
|
||
#: lazarusidestrconsts:dlgedfiles
|
||
msgid "Editor files"
|
||
msgstr "File dell'editor"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfont
|
||
msgid "Editor font"
|
||
msgstr "Carattere dell'editor"
|
||
|
||
#: lazarusidestrconsts:dlgeditorfontheight
|
||
msgid "Editor font height"
|
||
msgstr "Altezza del carattere dell'editor"
|
||
|
||
#: lazarusidestrconsts:liskmeditoroptions
|
||
msgid "Editor options"
|
||
msgstr "Opzioni dell'editor"
|
||
|
||
#: lazarusidestrconsts:lismenueditoroptions
|
||
msgid "Editor options ..."
|
||
msgstr "Opzioni dell'editor ..."
|
||
|
||
#: lazarusidestrconsts:uemeditorproperties
|
||
msgid "Editor properties"
|
||
msgstr "Proprietà dell'editor"
|
||
|
||
#: lazarusidestrconsts:dlgedelement
|
||
msgid "Element"
|
||
msgstr "Elemento"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Else"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts:lisemdemtpymethods
|
||
msgid "Emtpy Methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenablegroup
|
||
msgid "Enable Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Abilita le macro"
|
||
|
||
#: lazarusidestrconsts:rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenabled
|
||
msgid "Enabled"
|
||
msgstr "Abilitato"
|
||
|
||
#: lazarusidestrconsts:lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Chiusura"
|
||
|
||
#: lazarusidestrconsts:uemencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr "Chiusura selezione"
|
||
|
||
#: lazarusidestrconsts:liskmencloseselection
|
||
msgid "Enclose selection"
|
||
msgstr "Includi la selezione"
|
||
|
||
#: lazarusidestrconsts:lismenuencloseselection
|
||
msgid "Enclose selection ..."
|
||
msgstr "Chiusura selezione ..."
|
||
|
||
#: lazarusidestrconsts:uemencoding
|
||
msgid "Encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
|
||
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Inglese"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Inserire i dati"
|
||
|
||
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Inserire i parametri di esecuzione"
|
||
|
||
#: lazarusidestrconsts:lisentertransla
|
||
msgid "Enter translation language"
|
||
msgstr "Inserire la lingua"
|
||
|
||
#: lazarusidestrconsts:dlgrunoenvironment
|
||
msgid "Environment"
|
||
msgstr "Ambiente"
|
||
|
||
#: lazarusidestrconsts:srkmcatenvmenu
|
||
msgid "Environment menu commands"
|
||
msgstr "Comandi menu ambiente"
|
||
|
||
#: lazarusidestrconsts:lismenugeneraloptions
|
||
msgid "Environment options ..."
|
||
msgstr "Opzioni di ambiente ..."
|
||
|
||
#: lazarusidestrconsts:lisccoerrorcaption
|
||
msgid "Error"
|
||
msgstr "Errore"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Errore durante la lettura del pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Errore nella scrittura del pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
||
msgid "Error accessing xml"
|
||
msgstr "Errore accedendo all'xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
||
msgid "Error accessing xml file %s%s%s:%s%s"
|
||
msgstr "Errore accedendo al file xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Errore nella creazione del file"
|
||
|
||
#: lazarusidestrconsts:liserrorcreatinglrs
|
||
msgid "Error creating lrs"
|
||
msgstr "Errore durante la creazione dell'lrs"
|
||
|
||
#: lazarusidestrconsts:liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Errore durante la cancellazione del file"
|
||
|
||
#: lazarusidestrconsts:liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Errore in %s"
|
||
|
||
#: lazarusidestrconsts:lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Errore nell'espressione regolare"
|
||
|
||
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
||
msgid "Error initializing program%s%s%s%s%sError: %s"
|
||
msgstr "Errore nell'inizializzazione del programma%s%s%s%s%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
||
msgid "Error loading xml"
|
||
msgstr "Errore caricando l'xml"
|
||
|
||
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
||
msgid "Error loading xml file %s%s%s:%s%s"
|
||
msgstr "Errore caricando il file xml %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Errore nello spostamento del componente"
|
||
|
||
#: lazarusidestrconsts:liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Errore nello spostamento del componente %s:%s"
|
||
|
||
#: lazarusidestrconsts:lisabcreationfailed
|
||
msgid "Error occured during Application Bundle creation: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Errore nell'elaborazione dello stream componente lfm."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
||
msgid "Error reading %s%s%s%s%s"
|
||
msgstr "Errore durante la lettura %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Errore nella lettura del file"
|
||
|
||
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Errore nella lettura file: %s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Errore nella lettura dell'elenco pacchetti dal file%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
||
msgid "Error reading project info file %s%s%s%s%s"
|
||
msgstr "Errore durante la lettura del file delle informazioni sul progetto %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liserrorreadingxmlfile
|
||
msgid "Error reading xml file %s%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Errore durante la rinomina file"
|
||
|
||
#: lazarusidestrconsts:liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
||
msgid "Error while writing %s%s%s%s%s"
|
||
msgstr "Errore durante la scrittura %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
||
msgid "Error while writing project info file %s%s%s%s%s"
|
||
msgstr "Errore durante la scrittura del file delle informazioni sul progetto %s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lislazbuilderrorwritingfile
|
||
msgid "Error writing file"
|
||
msgstr "Errore nella scrittura del file"
|
||
|
||
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Errore durante la scrittura dell'elenco pacchetti sul file%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisinfobuilderror
|
||
msgid "Error..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserror
|
||
msgid "Error: "
|
||
msgstr "Errore: "
|
||
|
||
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Errore: compilatore non valido: %s"
|
||
|
||
#: lazarusidestrconsts:liserrors
|
||
msgid "Errors"
|
||
msgstr "Errori"
|
||
|
||
#: lazarusidestrconsts:lisinfobuilderrors
|
||
msgid "Errors:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Valuta/Modifica"
|
||
|
||
#: lazarusidestrconsts:lismenuevaluate
|
||
msgid "Evaluate/Modify ..."
|
||
msgstr "Valuta/modifica..."
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
||
msgid "Event Log"
|
||
msgstr "Log degli eventi"
|
||
|
||
#: lazarusidestrconsts:liseverynthlinenumber
|
||
msgid "Every n-th line number:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Esempio"
|
||
|
||
#: lazarusidestrconsts:lisexamples
|
||
msgid "Examples"
|
||
msgstr "Esempi"
|
||
|
||
#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter
|
||
msgid "Exclude Filter"
|
||
msgstr "Escludi Filtro"
|
||
|
||
#: lazarusidestrconsts:lisexcludefilter2
|
||
msgid "Exclude filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Esegui dopo"
|
||
|
||
#: lazarusidestrconsts:liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Esegui prima"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Esecuzione comando dopo"
|
||
|
||
#: lazarusidestrconsts:lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Esecuzione comando prima"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpaused
|
||
msgid "Execution paused"
|
||
msgstr "Esecuzione in pausa"
|
||
|
||
#: lazarusidestrconsts:lisexecutionpausedadress
|
||
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
||
msgstr "Esecuzione in pausa%s Indirizzo: $%s%s Procedura: %s%s File: %s%s(un giorno, quì potrebbe comparire una finestra assembler :)%s"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Esecuzione bloccata"
|
||
|
||
#: lazarusidestrconsts:lisexecutionstoppedon
|
||
msgid "Execution stopped%s"
|
||
msgstr "Esecuzione bloccata%s"
|
||
|
||
#: lazarusidestrconsts:lispldexists
|
||
msgid "Exists"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexit
|
||
msgid "Exit"
|
||
msgstr "Esci"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Esci senza salvare"
|
||
|
||
#: lazarusidestrconsts:lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Espandi tutte le classi"
|
||
|
||
#: lazarusidestrconsts:lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Espandi tutti i pacchetti"
|
||
|
||
#: lazarusidestrconsts:lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Espandi tutte le unit"
|
||
|
||
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Nome file espanso del file dell'editor corrente"
|
||
|
||
#: lazarusidestrconsts:lisexport
|
||
msgid "Export ..."
|
||
msgstr "Esporta ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Il file di esportazione %s%s%s esiste gi<67>.%sAprire il file e sostituire solo le opzioni del compilatore?%s(Le altre impostazioni saranno mantenute.)"
|
||
|
||
#: lazarusidestrconsts:lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Il file di esportazione gi<67> esiste"
|
||
|
||
#: lazarusidestrconsts:lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Esporta elenco"
|
||
|
||
#: lazarusidestrconsts:liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Espressione"
|
||
|
||
#: lazarusidestrconsts:lisexpression
|
||
msgid "Expression:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Estendere il percorso delle unit?"
|
||
|
||
#: lazarusidestrconsts:liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Impostazioni Strumenti sterni"
|
||
|
||
#: lazarusidestrconsts:srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Strumento esterno %d"
|
||
|
||
#: lazarusidestrconsts:lisexttoolexternaltools
|
||
msgid "External tools"
|
||
msgstr "Tool esterni"
|
||
|
||
#: lazarusidestrconsts:srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Impostazioni degli strumenti esterni"
|
||
|
||
#: lazarusidestrconsts:dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Spaziatura della extra della linea"
|
||
|
||
#: lazarusidestrconsts:lisextract
|
||
msgid "Extract"
|
||
msgstr "Estrai"
|
||
|
||
#: lazarusidestrconsts:uemextractproc
|
||
msgid "Extract Procedure"
|
||
msgstr "Estrai procedura"
|
||
|
||
#: lazarusidestrconsts:srkmecextractproc
|
||
msgid "Extract procedure"
|
||
msgstr "Estrai procedura"
|
||
|
||
#: lazarusidestrconsts:lismenuextractproc
|
||
msgid "Extract procedure ..."
|
||
msgstr "Estrai procedura ..."
|
||
|
||
#: lazarusidestrconsts:lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "Percorso di FPC Doc HTML"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Directory dei sorgenti SVN di FPC"
|
||
|
||
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
||
msgid "FPC Source Directory error"
|
||
msgstr "Errata directory sorgente FPC"
|
||
|
||
#: lazarusidestrconsts:lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Directory sorgente del FPC"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
||
msgid "FPC source directory \"%s\" not found."
|
||
msgstr "Directory sorgenti FPC \"%s\" non trovata."
|
||
|
||
#: lazarusidestrconsts:lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenufpdoceditor
|
||
msgid "FPDoc Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfpdoceditor
|
||
msgid "FPDoc editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
|
||
msgid "FPDoc files path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
||
msgid "Failed to run tool"
|
||
msgstr "Fallita l'esecuzione d'uno strumento"
|
||
|
||
#: lazarusidestrconsts:dlgcofast
|
||
msgid "Faster Code"
|
||
msgstr "Codice più veloce"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefile
|
||
msgid "File"
|
||
msgstr "File"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
||
msgid "File %s%s%s already exists in the project."
|
||
msgstr "Il file %s%s%s esiste già nel progetto."
|
||
|
||
#: lazarusidestrconsts:lisfilehaschangedsave
|
||
msgid "File %s%s%s has changed. Save?"
|
||
msgstr "Il file %s%s%s è cambiato. Salvarlo?"
|
||
|
||
#: lazarusidestrconsts:lisfileisvirtual
|
||
msgid "File %s%s%s is virtual."
|
||
msgstr "Il file %s%s%s è virtuale."
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotfound
|
||
msgid "File %s%s%s not found."
|
||
msgstr "File %s%s%s non trovato."
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound2
|
||
msgid "File %s%s%s not found.%s"
|
||
msgstr "File %s%s%s non trovato.%s"
|
||
|
||
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
||
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
||
msgstr "File %s%s%s non trovato.%sVuoi crearlo?%s"
|
||
|
||
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Il file %s%s%s%snon sembra un file di testo.%sAprirlo ugualmente?"
|
||
|
||
#: lazarusidestrconsts:lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Proprietà del file"
|
||
|
||
#: lazarusidestrconsts:lisfilesettings
|
||
msgid "File Settings ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pfiletype
|
||
msgid "File Type"
|
||
msgstr "Tipo file"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Il file esiste già"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
||
msgid "File already in package"
|
||
msgstr "Il file è già nel pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Estensione del file"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Il file è già nel pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Il file è nel progetto"
|
||
|
||
#: lazarusidestrconsts:lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "Il file non è scrivibile"
|
||
|
||
#: lazarusidestrconsts:uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Il file è a sola lettura"
|
||
|
||
#: lazarusidestrconsts:lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Il file è in uso"
|
||
|
||
#: lazarusidestrconsts:lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
||
msgid "File mask (*;*.*;*.bak?)"
|
||
msgstr "Maschera dei file (*;*.*;*.bak?)"
|
||
|
||
#: lazarusidestrconsts:srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Comandi per il menu file"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename
|
||
msgid "File name:"
|
||
msgstr "Nome file:"
|
||
|
||
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "File non eseguibile"
|
||
|
||
#: lazarusidestrconsts:lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "File non trovato"
|
||
|
||
#: lazarusidestrconsts:lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "File non minuscolo"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "File non salvato"
|
||
|
||
#: lazarusidestrconsts:lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "File non di testo"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Il file non è una unit"
|
||
|
||
#: lazarusidestrconsts:lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Nome file"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Il nome del file differisce dal nome del pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Il nome del file è in uso da un altro pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Il nome del file è in uso dal progetto"
|
||
|
||
#: lazarusidestrconsts:lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Nome del file:"
|
||
|
||
#: lazarusidestrconsts:lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Nome file: %s"
|
||
|
||
#: lazarusidestrconsts:dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "File"
|
||
|
||
#: lazarusidestrconsts:lisfilter
|
||
msgid "Filter"
|
||
msgstr "Filtro"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Filtra facendo corrispondere ogni parte del metodo"
|
||
|
||
#: lazarusidestrconsts:lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Filtra facendo corrispondere l'inizio del metodo"
|
||
|
||
#: lazarusidestrconsts:lismenufind
|
||
msgid "Find"
|
||
msgstr "Trova"
|
||
|
||
#: lazarusidestrconsts:lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Trova &successivo"
|
||
|
||
#: lazarusidestrconsts:lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Trova &precedente"
|
||
|
||
#: lazarusidestrconsts:lismenufindinfiles
|
||
msgid "Find &in files ..."
|
||
msgstr "Trova &nei file ..."
|
||
|
||
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at cursor"
|
||
msgstr "Trova dichiarazione al cursore"
|
||
|
||
#: lazarusidestrconsts:uemfindidentifierreferences
|
||
msgid "Find Identifier References"
|
||
msgstr "Trova identificatore riferimenti"
|
||
|
||
#: lazarusidestrconsts:lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Trova identificatore riferimenti ..."
|
||
|
||
#: lazarusidestrconsts:lismenutemplatefindnext
|
||
msgid "Find Next"
|
||
msgstr "Trova il prossimo"
|
||
|
||
#: lazarusidestrconsts:lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Trova i riferimenti"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Trova la fine del blocco"
|
||
|
||
#: lazarusidestrconsts:srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Trova l'inizio del blocco"
|
||
|
||
#: lazarusidestrconsts:lismenufindcodeblockstart
|
||
msgid "Find code block start"
|
||
msgstr "Trova l'inizio del blocco di codice"
|
||
|
||
#: lazarusidestrconsts:liscomppalfindcomponent
|
||
msgid "Find component"
|
||
msgstr "Trova componente"
|
||
|
||
#: lazarusidestrconsts:srkmecfinddeclaration
|
||
msgid "Find declaration"
|
||
msgstr "Trova dichiarazione"
|
||
|
||
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
||
msgid "Find identifier references"
|
||
msgstr "Trova i riferimenti dell'identificatore"
|
||
|
||
#: lazarusidestrconsts:srkmecfindinfiles
|
||
msgid "Find in files"
|
||
msgstr "Trova nei file"
|
||
|
||
#: lazarusidestrconsts:liskmfindincremental
|
||
msgid "Find incremental"
|
||
msgstr "Trova incrementale"
|
||
|
||
#: lazarusidestrconsts:lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindnext
|
||
msgid "Find next"
|
||
msgstr "Trova prossima occorrenza"
|
||
|
||
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
||
msgid "Find next word occurrence"
|
||
msgstr "Trova la prossima occorrenza della parola"
|
||
|
||
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Trova o rinomina identificatore"
|
||
|
||
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
||
msgid "Find other end of code block"
|
||
msgstr "Trova l'altro capo del blocco di codice"
|
||
|
||
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
||
msgid "Find palette component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevious
|
||
msgid "Find previous"
|
||
msgstr "Trova occorrenza precedente"
|
||
|
||
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
||
msgid "Find previous word occurrence"
|
||
msgstr "Trova la precedente occorrenza della parola"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
||
msgid "Find procedure definiton"
|
||
msgstr "Trova definizione di procedura"
|
||
|
||
#: lazarusidestrconsts:srkmecfindproceduremethod
|
||
msgid "Find procedure method"
|
||
msgstr "Trova metodo di procedura"
|
||
|
||
#: lazarusidestrconsts:srkmecfind
|
||
msgid "Find text"
|
||
msgstr "Trova testo"
|
||
|
||
#: lazarusidestrconsts:dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Trova il testo al cursore"
|
||
|
||
#: lazarusidestrconsts:rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Finnico"
|
||
|
||
#: lazarusidestrconsts:lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Ripara file LFM"
|
||
|
||
#: lazarusidestrconsts:lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
|
||
msgid "Focus messages after compilation"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecjumptoeditor
|
||
msgid "Focus to source editor"
|
||
msgstr "Imposta il focus sull'editor sorgente"
|
||
|
||
#: lazarusidestrconsts:liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Segui il cursore"
|
||
|
||
#: lazarusidestrconsts:lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Carattere senza UTF-8"
|
||
|
||
#: lazarusidestrconsts:lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Forza rinomina"
|
||
|
||
#: lazarusidestrconsts:dlgforecolor
|
||
msgid "Foreground color"
|
||
msgstr "Colore primo piano"
|
||
|
||
#: lazarusidestrconsts:dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Editor form"
|
||
|
||
#: lazarusidestrconsts:rsformdatafiledfm
|
||
msgid "Form data file (*.dfm)|*.dfm"
|
||
msgstr "Sorgente del form (*.dfm)|*.dfm"
|
||
|
||
#: lazarusidestrconsts:lisformloaderror
|
||
msgid "Form load error"
|
||
msgstr "Errore di caricamento form"
|
||
|
||
#: lazarusidestrconsts:lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Errore di formato"
|
||
|
||
#: lazarusidestrconsts:dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Form"
|
||
|
||
#: lazarusidestrconsts:lismenuviewforms
|
||
msgid "Forms..."
|
||
msgstr "Form..."
|
||
|
||
#: lazarusidestrconsts:lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvsrforwardsearch
|
||
msgid "Forward Search"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmorderforwardone
|
||
msgid "Forward one"
|
||
msgstr "Avanti di uno"
|
||
|
||
#: lazarusidestrconsts:lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascal
|
||
msgid "Free Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
||
msgid "Free Pascal Compiler not found"
|
||
msgstr "Compilatore Free Pascal non trovato"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
||
msgid "Free Pascal Sources not found"
|
||
msgstr "Sorgenti Free Pascal non trovati"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcefile
|
||
msgid "FreePascal source file"
|
||
msgstr "File sorgente di Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
||
msgid "Freepascal source directory"
|
||
msgstr "Directory sorgente del Freepascal"
|
||
|
||
#: lazarusidestrconsts:rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Francese"
|
||
|
||
#: lazarusidestrconsts:lisfunction
|
||
msgid "Function"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Funzione: aggiunge in fondo il delimitatore di percorso"
|
||
|
||
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
||
msgid "Function: chomp path delimiter"
|
||
msgstr "Funzione: elimina i delimitatori del percorso"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Funzione: estrae estensione file"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Funzione: estrae solo il nome file"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Funzione: estrae nome+estensione"
|
||
|
||
#: lazarusidestrconsts:listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Funzione: estrae percorso file"
|
||
|
||
#: lazarusidestrconsts:dlggpccomp
|
||
msgid "GPC (GNU Pascal Compiler) Compatible"
|
||
msgstr "Compatibile GPC (il compilatore Pascal della GNU)"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgplnotice
|
||
msgid "GPL notice"
|
||
msgstr "Nota GPL"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertgeneral
|
||
msgid "General"
|
||
msgstr "Generale"
|
||
|
||
#: lazarusidestrconsts:lispckeditgeneraloptions
|
||
msgid "General Options"
|
||
msgstr "Opzioni generali"
|
||
|
||
#: lazarusidestrconsts:srkmecenvironmentoptions
|
||
msgid "General environment options"
|
||
msgstr "Opzioni di ambiente generali"
|
||
|
||
#: lazarusidestrconsts:dlgcodbx
|
||
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
||
msgstr "Genera informazioni di debugging per DBX (rallenta la compilazione)"
|
||
|
||
#: lazarusidestrconsts:dlgcogdb
|
||
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
||
msgstr "Genera informazioni di debugging per GDB (rallenta la compilazione)"
|
||
|
||
#: lazarusidestrconsts:dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Genera codice per gprof"
|
||
|
||
#: lazarusidestrconsts:dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Genera codice per valgrind"
|
||
|
||
#: lazarusidestrconsts:dlgcogenerate
|
||
msgid "Generate:"
|
||
msgstr "Genera:"
|
||
|
||
#: lazarusidestrconsts:rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Tedesco"
|
||
|
||
#: lazarusidestrconsts:dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Ottieni la posizione"
|
||
|
||
#: lazarusidestrconsts:lispldglobal
|
||
msgid "Global"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
||
msgid "Global Source Path addition"
|
||
msgstr "Aggiunta percorso globale sorgenti"
|
||
|
||
#: lazarusidestrconsts:srkmecgotomarker
|
||
msgid "Go to Marker %d"
|
||
msgstr "Vai al marcatore %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Vai all'editor %d"
|
||
|
||
#: lazarusidestrconsts:srkmecgotolinenumber
|
||
msgid "Go to line number"
|
||
msgstr "Vai alla riga numero"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker0
|
||
msgid "Go to marker 0"
|
||
msgstr "Vai al segnalibro 0"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker1
|
||
msgid "Go to marker 1"
|
||
msgstr "Vai al segnalibro 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker2
|
||
msgid "Go to marker 2"
|
||
msgstr "Vai al segnalibro 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker3
|
||
msgid "Go to marker 3"
|
||
msgstr "Vai al segnalibro 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker4
|
||
msgid "Go to marker 4"
|
||
msgstr "Vai al segnalibro 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker5
|
||
msgid "Go to marker 5"
|
||
msgstr "Vai al segnalibro 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker6
|
||
msgid "Go to marker 6"
|
||
msgstr "Vai al segnalibro 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker7
|
||
msgid "Go to marker 7"
|
||
msgstr "Vai al segnalibro 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker8
|
||
msgid "Go to marker 8"
|
||
msgstr "Vai al segnalibro 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotomarker9
|
||
msgid "Go to marker 9"
|
||
msgstr "Vai al segnalibro 9"
|
||
|
||
#: lazarusidestrconsts:srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Vai alla parentesi corrispondente"
|
||
|
||
#: lazarusidestrconsts:srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Vai all'editor successivo"
|
||
|
||
#: lazarusidestrconsts:srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Vai all'editor precedente"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Vai all'editor sorgenti 1"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Vai all'editor sorgenti 10"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Vai all'editor sorgenti 2"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Vai all'editor sorgenti 3"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Vai all'editor sorgenti 4"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Vai all'editor sorgenti 5"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Vai all'editor sorgenti 6"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Vai all'editor sorgenti 7"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Vai all'editor sorgenti 8"
|
||
|
||
#: lazarusidestrconsts:liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Vai all'editor sorgenti 9"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoincludedirective
|
||
msgid "Go to to include directive of current include file"
|
||
msgstr "Vai alla direttiva include del file include corrente"
|
||
|
||
#: lazarusidestrconsts:listodogoto
|
||
msgid "Goto"
|
||
msgstr "Vai a"
|
||
|
||
#: lazarusidestrconsts:srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Vai a XY"
|
||
|
||
#: lazarusidestrconsts:lismenugotoincludedirective
|
||
msgid "Goto include directive"
|
||
msgstr "Vai alla direttiva di include"
|
||
|
||
#: lazarusidestrconsts:lismenugotoline
|
||
msgid "Goto line ..."
|
||
msgstr "Vai alla linea ..."
|
||
|
||
#: lazarusidestrconsts:lisuegotoline
|
||
msgid "Goto line :"
|
||
msgstr "Vai alla riga:"
|
||
|
||
#: lazarusidestrconsts:uemnextbookmark
|
||
msgid "Goto next Bookmark"
|
||
msgstr "Vai al prossimo segnalibro"
|
||
|
||
#: lazarusidestrconsts:uemprevbookmark
|
||
msgid "Goto previous Bookmark"
|
||
msgstr "Vai al segnalibro precedente"
|
||
|
||
#: lazarusidestrconsts:listodolistgotoline
|
||
msgid "Goto selected source line"
|
||
msgstr "Vai alla riga di sorgente selezionata"
|
||
|
||
#: lazarusidestrconsts:srkmgrabkey
|
||
msgid "Grab key"
|
||
msgstr "Cattura tasto"
|
||
|
||
#: lazarusidestrconsts:srkmgrabsecondkey
|
||
msgid "Grab second key"
|
||
msgstr "Cattura il secondo tasto"
|
||
|
||
#: lazarusidestrconsts:dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Reperisci il colore"
|
||
|
||
#: lazarusidestrconsts:dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Griglia"
|
||
|
||
#: lazarusidestrconsts:dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Colore della griglia"
|
||
|
||
#: lazarusidestrconsts:dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Ampiezza X griglia"
|
||
|
||
#: lazarusidestrconsts:dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Ampiezza Y griglia"
|
||
|
||
#: lazarusidestrconsts:lisgroup
|
||
msgid "Group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Annulla di Gruppo"
|
||
|
||
#: lazarusidestrconsts:lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
||
msgid "Guess misplaced $IFDEF"
|
||
msgstr "Indovina $IFDEF malposizionati"
|
||
|
||
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
||
msgid "Guess misplaced IFDEF/ENDIF"
|
||
msgstr "Indovina IFDEF/ENDIF malposizionati"
|
||
|
||
#: lazarusidestrconsts:lismenuguessunclosedblock
|
||
msgid "Guess unclosed block"
|
||
msgstr "Indovina blocco aperto"
|
||
|
||
#: lazarusidestrconsts:dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Linee guida"
|
||
|
||
#: lazarusidestrconsts:dlgguttercolor
|
||
msgid "Gutter color"
|
||
msgstr "Colore spaziatura laterale"
|
||
|
||
#: lazarusidestrconsts:dlggutterwidth
|
||
msgid "Gutter width"
|
||
msgstr "Ampiezza spaziatura laterale"
|
||
|
||
#: lazarusidestrconsts:lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Scorrimento di mezza pagina"
|
||
|
||
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
||
msgid "Handle OnClick Event"
|
||
msgstr "Handle evento OnClick"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Modificato da"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Modificato dal Debugger"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Modificato dal Programma"
|
||
|
||
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
||
msgid "Has Register procedure"
|
||
msgstr "Possiede una procedura di registrazione"
|
||
|
||
#: lazarusidestrconsts:lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Intestazione commento per classe"
|
||
|
||
#: lazarusidestrconsts:dlgheapsize
|
||
msgid "Heap Size"
|
||
msgstr "Ampiezza dell'Heap"
|
||
|
||
#: lazarusidestrconsts:rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Ebraico"
|
||
|
||
#: lazarusidestrconsts:dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Altezza:"
|
||
|
||
#: lazarusidestrconsts:lispckedithelp
|
||
msgid "Help"
|
||
msgstr "Aiuto"
|
||
|
||
#: lazarusidestrconsts:lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Opzioni aiuto"
|
||
|
||
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for FreePascal Compiler message"
|
||
msgstr "Aiuto su un messaggio del Compilatore FreePascal"
|
||
|
||
#: lazarusidestrconsts:srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Comandi per il menu aiuto"
|
||
|
||
#: lazarusidestrconsts:lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Selettore di aiuto"
|
||
|
||
#: lazarusidestrconsts:lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Nascondi le finestre dell'IDE durante l'esecuzione"
|
||
|
||
#: lazarusidestrconsts:uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
||
msgstr "Suggerimento: la funzione Make Resourcestring si aspetta una stringa costante.%sSelezionare solo un'espressione stringa e riprovare."
|
||
|
||
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Suggerimento: Make Resourcestring Function si aspetta una stringa costante.%sSelezionare l'espressione e riprovare."
|
||
|
||
#: lazarusidestrconsts:dlgedhintcommand
|
||
msgid "Hint: click on the command you want to edit"
|
||
msgstr "Suggerimento: clicca sul comando che vuoi modificare"
|
||
|
||
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
||
msgstr "Dritta: imposta il percorso del compilatore in Ambiente->Opzioni di ambiente->File->Percorso compilatore"
|
||
|
||
#: lazarusidestrconsts:dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Dritte per il componenti delle palette"
|
||
|
||
#: lazarusidestrconsts:dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Dritte per i principali bottoni veloci (apri, salva, ...)"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildhint
|
||
msgid "Hints:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "Il tasto home salta all'inizio più vicino"
|
||
|
||
#: lazarusidestrconsts:lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Orizzontale"
|
||
|
||
#: lazarusidestrconsts:dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Ampiezza passo orizzontale della griglia"
|
||
|
||
#: lazarusidestrconsts:dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Applicazione host"
|
||
|
||
#: lazarusidestrconsts:uenotimplcapagain
|
||
msgid "I told You: Not implemented yet"
|
||
msgstr "Ripeto: non ancora implementato!"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts:liside
|
||
msgid "IDE"
|
||
msgstr "IDE"
|
||
|
||
#: lazarusidestrconsts:lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Integrazione IDE"
|
||
|
||
#: lazarusidestrconsts:lisideintf
|
||
msgid "IDE Interface"
|
||
msgstr "Interfaccia IDE"
|
||
|
||
#: lazarusidestrconsts:lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Opzioni IDE:"
|
||
|
||
#: lazarusidestrconsts:lismenuideinternals
|
||
msgid "IDE internals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uepins
|
||
msgid "INS"
|
||
msgstr "Ins"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
||
msgid "Identifier"
|
||
msgstr "Identificatore"
|
||
|
||
#: lazarusidestrconsts:lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "L'identificatore comincia con ..."
|
||
|
||
#: lazarusidestrconsts:dlgedidcomlet
|
||
msgid "Identifier completion"
|
||
msgstr "Completamento dell'identificatore"
|
||
|
||
#: lazarusidestrconsts:lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "L'identificatore contiene ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Lunghezza identificatore:"
|
||
|
||
#: lazarusidestrconsts:dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Criterio degli identificatori"
|
||
|
||
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Prefisso identificatore:"
|
||
|
||
#: lazarusidestrconsts:lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Identificatore: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts:uenotimpltext
|
||
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
||
msgstr "Se puoi aiutarci a implementare questa funzionalità, scrivi a lazarus@miraclec.com"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts:dlgignoreverb
|
||
msgid "Ignore"
|
||
msgstr "Ignora"
|
||
|
||
#: lazarusidestrconsts:lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ignora gli spazi"
|
||
|
||
#: lazarusidestrconsts:lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ignora il numero dei caratteri spazio"
|
||
|
||
#: lazarusidestrconsts:lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
||
msgid "Ignore and save package now"
|
||
msgstr "Ignora e salva il pacchetto adesso"
|
||
|
||
#: lazarusidestrconsts:lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ignora i file binari"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ignora differenze nei fineriga (cioè #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
||
msgid "Ignore disk changes"
|
||
msgstr "Ignora i cambiamenti su disco"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ignore se vengono aggiunte o rimosse righe vuote"
|
||
|
||
#: lazarusidestrconsts:lisignoremissingfile
|
||
msgid "Ignore missing file"
|
||
msgstr "Ignora i file mancanti"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ignora gli spazi (caratteri di avanzamento riga non inclusi)"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ignora spazi alla fine delle righe"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ignora spazi all'inizio delle righe"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ignora questa eccezione"
|
||
|
||
#: lazarusidestrconsts:lisignoreusetformasancestor
|
||
msgid "Ignore, use TForm as ancestor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Str Ime"
|
||
|
||
#: lazarusidestrconsts:lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Importa elenco"
|
||
|
||
#: lazarusidestrconsts:dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Davanti ai metodi"
|
||
|
||
#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Include"
|
||
|
||
#: lazarusidestrconsts:dlgassertcode
|
||
msgid "Include Assertion Code"
|
||
msgstr "Includi codice assertion"
|
||
|
||
#: lazarusidestrconsts:dlgcoincfiles
|
||
msgid "Include Files (-Fi):"
|
||
msgstr "Includi i file (-Fi):"
|
||
|
||
#: lazarusidestrconsts:lisincludefilter
|
||
msgid "Include Filter"
|
||
msgstr "Includi Filtro"
|
||
|
||
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
|
||
msgid "Include Version Info in executable"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "File include"
|
||
|
||
#: lazarusidestrconsts:lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Includi i percorsi"
|
||
|
||
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
||
msgid "Include sub directories"
|
||
msgstr "Includi subdirectory"
|
||
|
||
#: lazarusidestrconsts:dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Includere le variabili di sistema"
|
||
|
||
#: lazarusidestrconsts:lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Incluso da:"
|
||
|
||
#: lazarusidestrconsts:lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Trova incrementale"
|
||
|
||
#: lazarusidestrconsts:srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Indenta blocco"
|
||
|
||
#: lazarusidestrconsts:dlgindentcodeto
|
||
msgid "Indent code to"
|
||
msgstr "Indenta codice a"
|
||
|
||
#: lazarusidestrconsts:lismenuindentselection
|
||
msgid "Indent selection"
|
||
msgstr "Indenta selezione"
|
||
|
||
#: lazarusidestrconsts:lisindex
|
||
msgid "Index"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Indonesiano"
|
||
|
||
#: lazarusidestrconsts:lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Informazioni su %s"
|
||
|
||
#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
|
||
msgid "Inherit from an existing component."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcoinherited
|
||
msgid "Inherited"
|
||
msgstr "Ereditati"
|
||
|
||
#: lazarusidestrconsts:lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolinsert
|
||
msgid "Insert"
|
||
msgstr "Inserisci"
|
||
|
||
#: lazarusidestrconsts:liskminsertifdef
|
||
msgid "Insert $IFDEF"
|
||
msgstr "Inserisci $IFDEF"
|
||
|
||
#: lazarusidestrconsts:lismenuconditionalselection
|
||
msgid "Insert $IFDEF..."
|
||
msgstr "Inserisci $IFDEF..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Inserisci autore chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Inserisci data chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Inserisci intestazione chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Inserisci ID chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Inserisci log chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Inserisci nome chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Inserisci revisione chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Inseriche sorgente chiave CVS"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Inserisci voce Changelog"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Inserisci il modello di compilatore Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Inserisci modello di directory Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Inserisci modello di progetto Delphi 5"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Inserisci modello di directory Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Inserisci modello di directory Delphy 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Inserisci modello di progetto Delphi 6"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Inserisci modello di compilatore Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Inserisci modello di directory Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Inserisci modello di progetto Delphi 7"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Inserisci modello di compilatore Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Inserisci modello di progetto Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Inserisci il modello del sorgente SVN di Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
||
msgid "Insert From Template..."
|
||
msgstr "Inserisci dai modelli..."
|
||
|
||
#: lazarusidestrconsts:srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Inserisci nota GPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Inserisci modello di compilatore Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Inserisci modello di directory Kylix 3"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Inserisci modello di progetto Kylix 3"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Inserisci nota LGPL"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
||
msgid "Insert Lazarus Directory Template"
|
||
msgstr "Inserisci modello di directory Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisctinsertmacro
|
||
msgid "Insert Macro"
|
||
msgstr "Inserisci Macro"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Modalità inserimento"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
||
msgid "Insert New Item (after)"
|
||
msgstr "Inserisci nuova voce (dopo)"
|
||
|
||
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
||
msgid "Insert New Item (before)"
|
||
msgstr "Inserisci nuova voce (prima)"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Inserisci modello"
|
||
|
||
#: lazarusidestrconsts:listddinserttodo
|
||
msgid "Insert ToDo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:ueminserttodo
|
||
msgid "Insert Todo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Inserisci in ordine alfabetico"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Inserisci il tag di formattazione grassetto"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Inserisci il tag di formattazione codice"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Inserisci in ordine di contesto"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Inserisci data e ora correnti"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Inserisci in nome corrente"
|
||
|
||
#: lazarusidestrconsts:liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Inserisci data e ora"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertcharacter
|
||
msgid "Insert from Character Map"
|
||
msgstr "Inserire dalla mappa caratteri"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Inserire dalla mappa caratteri"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Inserisci it tag di formattazione corsivo"
|
||
|
||
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Inserisci licenza LGPL modificata"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Inserisci nodo figlio"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Inserisci nodo quì sotto"
|
||
|
||
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Inserisci il tag di formattazione evidenziato"
|
||
|
||
#: lazarusidestrconsts:dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Inserisci spazio dopo di"
|
||
|
||
#: lazarusidestrconsts:dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Inserisci spazio prima di"
|
||
|
||
#: lazarusidestrconsts:lismenuinserttext
|
||
msgid "Insert text"
|
||
msgstr "Inserisci testo"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Inserisci il tag di formattazione sottolineato"
|
||
|
||
#: lazarusidestrconsts:liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Inserisci il nome utente"
|
||
|
||
#: lazarusidestrconsts:liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Inserisci il tag di formattazione Var"
|
||
|
||
#: lazarusidestrconsts:liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Analizza"
|
||
|
||
#: lazarusidestrconsts:lismenuinspect
|
||
msgid "Inspect ..."
|
||
msgstr "Analizza ..."
|
||
|
||
#: lazarusidestrconsts:lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Installa"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Installa alla prossima partenza"
|
||
|
||
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
||
msgid "Install package in the IDE"
|
||
msgstr "Installa pacchetto nell'IDE"
|
||
|
||
#: lazarusidestrconsts:lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Installa selezione"
|
||
|
||
#: lazarusidestrconsts:lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Installazione fallita"
|
||
|
||
#: lazarusidestrconsts:lispckexplinstalled
|
||
msgid "Installed"
|
||
msgstr "Installato"
|
||
|
||
#: lazarusidestrconsts:lisinstalledpackages
|
||
msgid "Installed Packages"
|
||
msgstr "Pacchetti installati"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "L'installazione del pacchetto %s installerà automaticamente il pacchetto:"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "L'installazione del pacchetto %s installera automaticamente i seguenti pacchetti:"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
||
msgid "Interface"
|
||
msgstr "Interfaccia"
|
||
|
||
#: lazarusidestrconsts:listcompilerinternalerror
|
||
msgid "Internal compiler error! (%d)"
|
||
msgstr "Errore del compilatore ! (%d)"
|
||
|
||
#: lazarusidestrconsts:dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Intervallo in secondi"
|
||
|
||
#: lazarusidestrconsts:lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Tipo antenato non valido"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidcircle
|
||
msgid "Invalid Circle"
|
||
msgstr "Circolo non valido"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Nome classe non valida"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
||
msgid "Invalid Compiler Filename"
|
||
msgstr "Nome file compilatore non valido"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
||
msgid "Invalid Exclude filter"
|
||
msgstr "Filtro exclude non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
||
msgid "Invalid Free Pascal source directory"
|
||
msgstr "Cartella sorgenti compilatore Free Pascal non valida"
|
||
|
||
#: lazarusidestrconsts:lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Identificatore non valido"
|
||
|
||
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
||
msgid "Invalid Include filter"
|
||
msgstr "Filtro include non valido"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Versione Min-Max non valida"
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Nome pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Identificatore Pascal non valido"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Sezione Resourcestring non valida"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Nome unit non valida"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Nome unit non valido: %s"
|
||
|
||
#: lazarusidestrconsts:lisinvalidcircle
|
||
msgid "Invalid circle"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Comando non valido"
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
||
msgid "Invalid compiler filename"
|
||
msgstr "Nome file compilatore non valido"
|
||
|
||
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Classe componenti non valida"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Nome file del debugger non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Cancellazione non valida"
|
||
|
||
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
||
msgid "Invalid destination directory"
|
||
msgstr "Directory di destinazione non valida"
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Espressione non valida.%sSuggerimento: la funzione Make Resourcestring si aspetta una stringa costante in un file singolo. Selezionare l'espressione e riprovare."
|
||
|
||
#: lazarusidestrconsts:lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "File non valido"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Estensione del file non valida"
|
||
|
||
#: lazarusidestrconsts:lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Nome file non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
||
msgid "Invalid make filename"
|
||
msgstr "Nome file make non valido"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Versione massima non valida"
|
||
|
||
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Versione minima non valida"
|
||
|
||
#: lazarusidestrconsts:lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Multiselezione non valida"
|
||
|
||
#: lazarusidestrconsts:liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Opzione non valida a posizione %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: %s%s%s"
|
||
msgstr "ID pacchetto non valido: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Estensione file pacchetto non valida"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Nome file pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Nome pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Tipo pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
||
msgid "Invalid packagename"
|
||
msgstr "Nome pacchetto non valido"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Genitore non valido"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Nodo genitore non valido"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
||
msgid "Invalid pascal unit name"
|
||
msgstr "Nome unit pascal non valida"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Nodo precedente non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Nome proc non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Nome file progetto non valido"
|
||
|
||
#: lazarusidestrconsts:lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Selezione non valida"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Nome del file della unit non valido"
|
||
|
||
#: lazarusidestrconsts:lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Nome della unit non valido"
|
||
|
||
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Nome variabile non valido"
|
||
|
||
#: lazarusidestrconsts:lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Versione non valida"
|
||
|
||
#: lazarusidestrconsts:dlgedinvert
|
||
msgid "Invert"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:ueminvertassignment
|
||
msgid "Invert Assignment"
|
||
msgstr "Inverti assegnamento"
|
||
|
||
#: lazarusidestrconsts:srkmecinvertassignment
|
||
msgid "Invert assignment"
|
||
msgstr "Inverti assegnamento"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Italiano"
|
||
|
||
#: lazarusidestrconsts:dlgedital
|
||
msgid "Italic"
|
||
msgstr "Corsivo"
|
||
|
||
#: lazarusidestrconsts:dlgoiitemheight
|
||
msgid "Item height"
|
||
msgstr "Altezza dell'oggetto"
|
||
|
||
#: lazarusidestrconsts:lisjitform
|
||
msgid "JIT Form"
|
||
msgstr "Form JIT"
|
||
|
||
#: lazarusidestrconsts:rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Giapponese"
|
||
|
||
#: lazarusidestrconsts:lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Salta alla Selezione"
|
||
|
||
#: lazarusidestrconsts:lismenujumpback
|
||
msgid "Jump back"
|
||
msgstr "Salta indietro"
|
||
|
||
#: lazarusidestrconsts:lismenujumpforward
|
||
msgid "Jump forward"
|
||
msgstr "Salta avanti"
|
||
|
||
#: lazarusidestrconsts:lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Salta a"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonextbookmark
|
||
msgid "Jump to next bookmark"
|
||
msgstr "Salta al prossimo segnalibro"
|
||
|
||
#: lazarusidestrconsts:lismenujumptonexterror
|
||
msgid "Jump to next error"
|
||
msgstr "Salta al prossimo errore"
|
||
|
||
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
||
msgid "Jump to previous bookmark"
|
||
msgstr "Salta al precedente segnalibro"
|
||
|
||
#: lazarusidestrconsts:lismenujumptopreverror
|
||
msgid "Jump to previous error"
|
||
msgstr "Salta all'errore precedente"
|
||
|
||
#: lazarusidestrconsts:dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Salti (per es. metodi di salto)"
|
||
|
||
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Mantieni tutti i file di testo"
|
||
|
||
#: lazarusidestrconsts:dlgcokeepvarsreg
|
||
msgid "Keep certain variables in registers"
|
||
msgstr "Mantieni certi valori nei registri"
|
||
|
||
#: lazarusidestrconsts:dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Mantieni tutti i file che corrispondono al filtro"
|
||
|
||
#: lazarusidestrconsts:liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Mantieni il nome"
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Mantieni l'ordine delle procedure"
|
||
|
||
#: lazarusidestrconsts:liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Ignora e continua"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolkey
|
||
msgid "Key"
|
||
msgstr "Tasto"
|
||
|
||
#: lazarusidestrconsts:liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmkey
|
||
msgid "Key (or 2 keys combination)"
|
||
msgstr "Tasto (o combinazione di 2 tasti)"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingscheme
|
||
msgid "Key Mapping Scheme"
|
||
msgstr "Schema mappatura tasti"
|
||
|
||
#: lazarusidestrconsts:dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Mappatura tasti"
|
||
|
||
#: lazarusidestrconsts:dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Errori di mappatura tasti"
|
||
|
||
#: lazarusidestrconsts:liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Schema della tastiera"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Parola chiave"
|
||
|
||
#: lazarusidestrconsts:dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Criterio delle parolechiave"
|
||
|
||
#: lazarusidestrconsts:lislcl
|
||
msgid "LCL"
|
||
msgstr "LCL"
|
||
|
||
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Opzioni specifiche interfaccia LCL:"
|
||
|
||
#: lazarusidestrconsts:lislclwidgettype
|
||
msgid "LCL Widget Type"
|
||
msgstr "Tipo di widget LCL"
|
||
|
||
#: lazarusidestrconsts:lislazbuildlclinterface
|
||
msgid "LCL interface"
|
||
msgstr "Interfaccia LCL"
|
||
|
||
#: lazarusidestrconsts:lislclunitpathmissing
|
||
msgid "LCL unit path missing"
|
||
msgstr "Manca il percorso della unit LCL"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "LFM - form di testo Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "File LFM"
|
||
|
||
#: lazarusidestrconsts:lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "File LFM danneggiato"
|
||
|
||
#: lazarusidestrconsts:lislfmfilenotfound
|
||
msgid "LFM file not found"
|
||
msgstr "File LFM non trovato"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
||
msgid "LGPL notice"
|
||
msgstr "Nota LGPL"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "LRS - risorsa Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlgenvlanguage
|
||
msgid "Language"
|
||
msgstr "Lingua"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Eccezioni del linguaggio"
|
||
|
||
#: lazarusidestrconsts:rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Ultima"
|
||
|
||
#: lazarusidestrconsts:dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Ultima (cioè alla fine del sorgente)"
|
||
|
||
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Sto lanciando l'applicazione"
|
||
|
||
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Esecuzione applicazione non valida"
|
||
|
||
#: lazarusidestrconsts:lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Esecuzione riga di comando di destinazione"
|
||
|
||
#: lazarusidestrconsts:lispkgmanglazarus
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdesktopsettings
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Settaggi Desktop di Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
||
msgid "Lazarus Directory"
|
||
msgstr "Cartella Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusfile
|
||
msgid "Lazarus File"
|
||
msgstr "File di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "IDE Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectinfofile
|
||
msgid "Lazarus Project Info file"
|
||
msgstr "File di informazione di progetto Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Directory della configurazione di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Directory di Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Directory di Lazarus (predefinita per tutti i progetti)"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
||
msgid "Lazarus directory \"%s\" not found."
|
||
msgstr "Directory di Lazarus \"%s\" non trovata."
|
||
|
||
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
||
msgid "Lazarus directory not found"
|
||
msgstr "Cartella Lazarus non trovata"
|
||
|
||
#: lazarusidestrconsts:lislazarusform
|
||
msgid "Lazarus form"
|
||
msgstr "form di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusinclude
|
||
msgid "Lazarus include file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Lingua usata da Lazarus (Per ex.: en, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts:lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Nome lingua Lazarus (e.g. english, deutsch)"
|
||
|
||
#: lazarusidestrconsts:lislazaruspackage
|
||
msgid "Lazarus package"
|
||
msgstr "Pacchetto di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusproject
|
||
msgid "Lazarus project"
|
||
msgstr "Progetto Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusprojectsource
|
||
msgid "Lazarus project source"
|
||
msgstr "Sorgente del progetto Lazarus"
|
||
|
||
#: lazarusidestrconsts:lislazarusunit
|
||
msgid "Lazarus unit"
|
||
msgstr "Unit di Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisleaveemptyfo
|
||
msgid "Leave empty for default .po file"
|
||
msgstr "Lasciare vuota per file .po predefinito"
|
||
|
||
#: lazarusidestrconsts:lisleft
|
||
msgid "Left"
|
||
msgstr "Sinistra"
|
||
|
||
#: lazarusidestrconsts:lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Ancoraggio a sinistra"
|
||
|
||
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Lato sinistro"
|
||
|
||
#: lazarusidestrconsts:lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Spazia a sinistra equidistante"
|
||
|
||
#: lazarusidestrconsts:dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Sinistra:"
|
||
|
||
#: lazarusidestrconsts:dlglevelnoneopt
|
||
msgid "Level 0 (no extra Optimizations)"
|
||
msgstr "Livello 0 (nessuna ottimizzazione)"
|
||
|
||
#: lazarusidestrconsts:dlglevel1opt
|
||
msgid "Level 1 (quick and debugger friendly)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel2opt
|
||
msgid "Level 2 (Level 1 + quick optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlglevel3opt
|
||
msgid "Level 3 (Level 2 + slow optimizations)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislevels
|
||
msgid "Levels"
|
||
msgstr "Livelli"
|
||
|
||
#: lazarusidestrconsts:dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Librerie (-Fl):"
|
||
|
||
#: lazarusidestrconsts:lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Libreria"
|
||
|
||
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
||
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
||
msgstr "Libreria%sUna libreria FreePascal (.dll sotto windows, .so sotto linux, .dylib sotto macosx). Il file sorgente della libreria viene gestito automaticamente da Lazarus."
|
||
|
||
#: lazarusidestrconsts:lispckoptslicense
|
||
msgid "License:"
|
||
msgstr "Licenza:"
|
||
|
||
#: lazarusidestrconsts:lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit linecount to"
|
||
msgstr "Limita il conteggio righe a"
|
||
|
||
#: lazarusidestrconsts:listodolline
|
||
msgid "Line"
|
||
msgstr "Riga"
|
||
|
||
#: lazarusidestrconsts:dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Separazione righe"
|
||
|
||
#: lazarusidestrconsts:srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Modalità selezione a righe"
|
||
|
||
#: lazarusidestrconsts:lislinelength
|
||
msgid "Line/Length"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Righe"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildlines
|
||
msgid "Lines:"
|
||
msgstr "Righe:"
|
||
|
||
#: lazarusidestrconsts:dlglinksmart
|
||
msgid "Link Smart"
|
||
msgstr "Link intelligente"
|
||
|
||
#: lazarusidestrconsts:dlglinklibraries
|
||
msgid "Link Style:"
|
||
msgstr "Stile link:"
|
||
|
||
#: lazarusidestrconsts:lislinktarget
|
||
msgid "Link target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislink
|
||
msgid "Link:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Linker"
|
||
|
||
#: lazarusidestrconsts:dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Linking"
|
||
|
||
#: lazarusidestrconsts:liscmplstlist
|
||
msgid "List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Lituano"
|
||
|
||
#: lazarusidestrconsts:dlgloaddfile
|
||
msgid "Load desktop settings from file"
|
||
msgstr "Carica impostazioni del desktop dal file"
|
||
|
||
#: lazarusidestrconsts:lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Carica dal file"
|
||
|
||
#: lazarusidestrconsts:dlgcoloadsave
|
||
msgid "Load/Save"
|
||
msgstr "Carica/Salva"
|
||
|
||
#: lazarusidestrconsts:lispckexplloadedpackages
|
||
msgid "Loaded Packages:"
|
||
msgstr "Pacchetti caricati:"
|
||
|
||
#: lazarusidestrconsts:lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
||
msgstr "Caricando il pacchetto %s si rimpiazzerà il pacchetto %s%sdal file %s.%sIl vecchio pacchetto è stato modificato.%s%sSalvare il vecchio pacchetto %s?"
|
||
|
||
#: lazarusidestrconsts:dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Locale"
|
||
|
||
#: lazarusidestrconsts:lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Variabili locali"
|
||
|
||
#: lazarusidestrconsts:lislocals
|
||
msgid "Locals"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislogo
|
||
msgid "Logo"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenulowercaseselection
|
||
msgid "Lowercase selection"
|
||
msgstr "Selezione in minuscolo"
|
||
|
||
#: lazarusidestrconsts:dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Minuscolo, prima lettera maiuscola"
|
||
|
||
#: lazarusidestrconsts:liskmmacosx
|
||
msgid "Mac OS X"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismacpascal
|
||
msgid "Mac Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolmacros
|
||
msgid "Macros"
|
||
msgstr "Macro"
|
||
|
||
#: lazarusidestrconsts:dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Menu principale"
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
||
msgid "Main Unit has Application.CreateForm statements"
|
||
msgstr "La unit principale usa comandi Application.CreateForm"
|
||
|
||
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
||
msgid "Main Unit has Application.Title statements"
|
||
msgstr "La unit principale usa comandi Application.Title"
|
||
|
||
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main Unit has Uses Section containing all Units of project"
|
||
msgstr "La unit principale usa 'Usa sezioni contenenti tutte le unità del progetto'"
|
||
|
||
#: lazarusidestrconsts:lismainunitispascalsource
|
||
msgid "Main Unit is Pascal Source"
|
||
msgstr "La unit principale è 'Sorgente Pascal'"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Maggiore"
|
||
|
||
#: lazarusidestrconsts:rsmajorrevision
|
||
msgid "Major revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Crea l'eseguibile"
|
||
|
||
#: lazarusidestrconsts:lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Crea stringa risorse ..."
|
||
|
||
#: lazarusidestrconsts:lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Crea ResourceString"
|
||
|
||
#: lazarusidestrconsts:lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "Make non trovato"
|
||
|
||
#: lazarusidestrconsts:dlgmakepath
|
||
msgid "Make path"
|
||
msgstr "Percorso make"
|
||
|
||
#: lazarusidestrconsts:srkmecmakeresourcestring
|
||
msgid "Make resource string"
|
||
msgstr "Stringa risorsa make"
|
||
|
||
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Compilazione manuale (mai automaticamente)"
|
||
|
||
#: lazarusidestrconsts:dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Margini e spaziatura laterale"
|
||
|
||
#: lazarusidestrconsts:dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Colore marker"
|
||
|
||
#: lazarusidestrconsts:lissmatches
|
||
msgid "Matches"
|
||
msgstr "Corrispondenze"
|
||
|
||
#: lazarusidestrconsts:lismaxs
|
||
msgid "Max %d"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Lunghezza riga massima:"
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "File recenti massimi"
|
||
|
||
#: lazarusidestrconsts:dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "File di progetto recenti massimi"
|
||
|
||
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Raggiunto la massimo degli strumenti"
|
||
|
||
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Versione massima (opzionale):"
|
||
|
||
#: lazarusidestrconsts:lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Versione massima:"
|
||
|
||
#: lazarusidestrconsts:dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Contatore massimo"
|
||
|
||
#: lazarusidestrconsts:lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Editor menu"
|
||
|
||
#: lazarusidestrconsts:lismenuviewmessages
|
||
msgid "Messages"
|
||
msgstr "Messaggi"
|
||
|
||
#: lazarusidestrconsts:lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmethodinspolicy
|
||
msgid "Method insert policy"
|
||
msgstr "Criterio di inserimento metodi"
|
||
|
||
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
||
msgid "Minimize all on minimize main"
|
||
msgstr "Minimizza tutto quando minimizza la principale"
|
||
|
||
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Versione minima (opzionale):"
|
||
|
||
#: lazarusidestrconsts:lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Versione minima:"
|
||
|
||
#: lazarusidestrconsts:lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Minore"
|
||
|
||
#: lazarusidestrconsts:rsminorrevision
|
||
msgid "Minor revision:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmmirrorhorizontal
|
||
msgid "Mirror horizontal"
|
||
msgstr "Speculare orizzontale"
|
||
|
||
#: lazarusidestrconsts:fdmmirrorvertical
|
||
msgid "Mirror vertical"
|
||
msgstr "Speculare verticale"
|
||
|
||
#: lazarusidestrconsts:dlgenvmisc
|
||
msgid "Miscellaneous"
|
||
msgstr "Varie"
|
||
|
||
#: lazarusidestrconsts:lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Eventi non trovati"
|
||
|
||
#: lazarusidestrconsts:lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Mancano pacchetti"
|
||
|
||
#: lazarusidestrconsts:lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Mescola metodi e proprietà"
|
||
|
||
#: lazarusidestrconsts:uemodified
|
||
msgid "Modified"
|
||
msgstr "Modificato"
|
||
|
||
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL notice"
|
||
msgstr "Licenza LGPL modificata"
|
||
|
||
#: lazarusidestrconsts:lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Modificato: %s"
|
||
|
||
#: lazarusidestrconsts:listodolfile
|
||
msgid "Module"
|
||
msgstr "Modulo"
|
||
|
||
#: lazarusidestrconsts:lismore
|
||
msgid "More"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditmore
|
||
msgid "More ..."
|
||
msgstr "Ancora ..."
|
||
|
||
#: lazarusidestrconsts:dlgmouselinks
|
||
msgid "Mouse links"
|
||
msgstr "Collegamenti al mouse"
|
||
|
||
#: lazarusidestrconsts:lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Sposta in giù (o a destra)"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleft
|
||
msgid "Move Editor Left"
|
||
msgstr "Sposta l'editor a sinistra"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorleftmost
|
||
msgid "Move Editor Leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorright
|
||
msgid "Move Editor Right"
|
||
msgstr "Sposta l'editor a destra"
|
||
|
||
#: lazarusidestrconsts:uemmoveeditorrightmost
|
||
msgid "Move Editor Rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismovepage
|
||
msgid "Move Page ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Sposta in su (o a sinstra)"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Sposta il componente indietro di uno"
|
||
|
||
#: lazarusidestrconsts:lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Sposta il componente avanti di uno"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Sposta indietro il componente"
|
||
|
||
#: lazarusidestrconsts:lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Sposta il componente in primo piano"
|
||
|
||
#: lazarusidestrconsts:srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Sposta il cursore in basso di una pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Sposta il cursore a sinistra di una pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Sposta il cursore a destra di una pagina"
|
||
|
||
#: lazarusidestrconsts:srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Sposta il cursore all'inizio"
|
||
|
||
#: lazarusidestrconsts:srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Sposta il cursore alla fine"
|
||
|
||
#: lazarusidestrconsts:srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Sposta il cursore alla fine della pagina"
|
||
|
||
#: lazarusidestrconsts:srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Sposta il cursore fino alla fine della riga"
|
||
|
||
#: lazarusidestrconsts:srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Sposta il cursore alla linea di partenza"
|
||
|
||
#: lazarusidestrconsts:srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Sposta il cursore in cima alla pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Sposta il cursore in alto di una pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Sposta il cursore di una parola a sinistra"
|
||
|
||
#: lazarusidestrconsts:srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Sposta il cursore di una parola a destra"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Sposta dipendenza in giù"
|
||
|
||
#: lazarusidestrconsts:lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Sposta dipendenza in su"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Sposta l'editor a sinistra"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Sposta l'editor a destra"
|
||
|
||
#: lazarusidestrconsts:srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispemovefiledown
|
||
msgid "Move file down"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispemovefileup
|
||
msgid "Move file up"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Sposta il nodo giù"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Sposta il nodo di un livello giù"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Sposta il nodo di un livello su"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Sposta il nodo su"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathdown
|
||
msgid "Move path down"
|
||
msgstr "Sposta il percorso giù"
|
||
|
||
#: lazarusidestrconsts:lispatheditmovepathup
|
||
msgid "Move path up"
|
||
msgstr "Sposta il percorso sù"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetoback
|
||
msgid "Move to back"
|
||
msgstr "Sposta indietro"
|
||
|
||
#: lazarusidestrconsts:fdmordermovetofront
|
||
msgid "Move to front"
|
||
msgstr "Sposta in primo piano"
|
||
|
||
#: lazarusidestrconsts:dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Multi Selezione"
|
||
|
||
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "I componenti selezionati più volte devono essere di una singola form"
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "Nota: impossibile creare il modello define per i sorgenti del Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "Nota: impossibile creare il modello define per i sorgenti Lazarus"
|
||
|
||
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "Nota: non è stato trovato il file configurazione codetools - uso i valori predefiniti"
|
||
|
||
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "Nota: caricamento vecchio file opzioni codetools: "
|
||
|
||
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
||
msgid "NOTE: only absolute paths are supported now"
|
||
msgstr "Attenzione: ora sono validi solo i percorsi assoluti"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
||
msgid "Name"
|
||
msgstr "Nome"
|
||
|
||
#: lazarusidestrconsts:lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Nome della nuova procedura"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsname
|
||
msgid "Name:"
|
||
msgstr "Nome:"
|
||
|
||
#: lazarusidestrconsts:dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Naming"
|
||
|
||
#: lazarusidestrconsts:lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Mai, solo manualmente"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatenew
|
||
msgid "New"
|
||
msgstr "Nuovo"
|
||
|
||
#: lazarusidestrconsts:lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Nuovo ..."
|
||
|
||
#: lazarusidestrconsts:lisnewancestors
|
||
msgid "New Ancestors"
|
||
msgstr "Nuovi antenati"
|
||
|
||
#: lazarusidestrconsts:lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Nuova classe"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewcomponent
|
||
msgid "New Component"
|
||
msgstr "Nuovo componente"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Nuovo File"
|
||
|
||
#: lazarusidestrconsts:lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Nuova form"
|
||
|
||
#: lazarusidestrconsts:lispwnewproject
|
||
msgid "New Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Nuovo progetto ..."
|
||
|
||
#: lazarusidestrconsts:lismenunewprojectfromfile
|
||
msgid "New Project from file ..."
|
||
msgstr "Nuovo progetto da file ..."
|
||
|
||
#: lazarusidestrconsts:lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Nuovo requisito"
|
||
|
||
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
||
msgid "New Template Description..."
|
||
msgstr "Nuova descrizione modello..."
|
||
|
||
#: lazarusidestrconsts:lismenunewunit
|
||
msgid "New Unit"
|
||
msgstr "Nuova unit"
|
||
|
||
#: lazarusidestrconsts:lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Nome nuova classe:"
|
||
|
||
#: lazarusidestrconsts:liskmnewpackage
|
||
msgid "New package"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenunewpackage
|
||
msgid "New package ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Nuovo progetto"
|
||
|
||
#: lazarusidestrconsts:liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Nuovo progetto da file"
|
||
|
||
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Nuova unit non nel percorso unit"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Nuovo nodo"
|
||
|
||
#: lazarusidestrconsts:lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "Nuovo pacchetto"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "A capo"
|
||
|
||
#: lazarusidestrconsts:srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Segnalibro successivo"
|
||
|
||
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Non è stata trovata nessuna sezione ResourceString"
|
||
|
||
#: lazarusidestrconsts:lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Non fare il backup dei files"
|
||
|
||
#: lazarusidestrconsts:lisnochange
|
||
msgid "No change"
|
||
msgstr "Nessun cambiamento"
|
||
|
||
#: lazarusidestrconsts:lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Nessun codice selezionato"
|
||
|
||
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Nessuna opzione di compilazione ereditata."
|
||
|
||
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Non è stato specificato nessun debugger"
|
||
|
||
#: lazarusidestrconsts:dlgednoerr
|
||
msgid "No errors in key mapping found."
|
||
msgstr "Nessun errore trovato nella mappatura tasti."
|
||
|
||
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Nessuna voce selezionata"
|
||
|
||
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
||
msgstr "Non è stato trovato un pacchetto per la dipendenza %s%s%s.%sScegliere un pacchetto esistente."
|
||
|
||
#: lazarusidestrconsts:lisoipnopackageselected
|
||
msgid "No package selected"
|
||
msgstr "Nessun pacchetto selezionato"
|
||
|
||
#: lazarusidestrconsts:lisnoprogramfilesfound
|
||
msgid "No program file %s%s%s found."
|
||
msgstr "Nessun file di programma %s%s%s trovato."
|
||
|
||
#: lazarusidestrconsts:lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Nessuna stringa costante trovata"
|
||
|
||
#: lazarusidestrconsts:lisldnovalidlazdocpath
|
||
msgid "No valid LazDoc path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
||
msgid "Node and its children are only valid for this project"
|
||
msgstr "Il nodo ed i suoi figli sono validi solo per questo progetto"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Il nodo è in sola lettura"
|
||
|
||
#: lazarusidestrconsts:dlgenvnone
|
||
msgid "None"
|
||
msgstr "Niente"
|
||
|
||
#: lazarusidestrconsts:dlgconormal
|
||
msgid "Normal Code"
|
||
msgstr "Codice normale"
|
||
|
||
#: lazarusidestrconsts:srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Modalità di selezione normale"
|
||
|
||
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Normalmente il filtro è un'espressione regolare. Nella Simple Syntax un . è un normale carattere, un * sta per qualsiasi cosa, un ? sta per qualsiasi carater, e la virgola ed il punto e virgola separano le alternative. Per esempio: Simple Syntax *.pas *pp corrispondono a ^(.*\\pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiproject
|
||
msgid "Not a Delphi project"
|
||
msgstr "Non è un progetto Delphi"
|
||
|
||
#: lazarusidestrconsts:lisnotadelphiunit
|
||
msgid "Not a Delphi unit"
|
||
msgstr "Non è una unit Delphi"
|
||
|
||
#: lazarusidestrconsts:lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Non trovato"
|
||
|
||
#: lazarusidestrconsts:lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Non ancora implementato"
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet2
|
||
msgid "Not implemented yet."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Non ora"
|
||
|
||
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
||
msgid "Note: All keys will be set to the values of the choosen scheme."
|
||
msgstr "Nota: Tutti i tasti saranno impostati con i valori dello schema scelto."
|
||
|
||
#: lazarusidestrconsts:lisinfobuildnote
|
||
msgid "Notes:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Nota: i file progetto sono tutti i file presenti nella directory del progetto"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Numero"
|
||
|
||
#: lazarusidestrconsts:lisifdok
|
||
msgid "OK"
|
||
msgstr "OK"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Eccezione del Sistema Operativo"
|
||
|
||
#: lazarusidestrconsts:uepovr
|
||
msgid "OVR"
|
||
msgstr "Sov"
|
||
|
||
#: lazarusidestrconsts:lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Oggetto"
|
||
|
||
#: lazarusidestrconsts:lismenuviewobjectinspector
|
||
msgid "Object Inspector"
|
||
msgstr "Analizzatore oggetti"
|
||
|
||
#: lazarusidestrconsts:liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Comando dell'Ispettore Oggetti"
|
||
|
||
#: lazarusidestrconsts:lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgedoff
|
||
msgid "Off"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisokbtn
|
||
msgid "Ok"
|
||
msgstr "Ok"
|
||
|
||
#: lazarusidestrconsts:lisoldancestors
|
||
msgid "Old Ancestors"
|
||
msgstr "Vecchi antenati"
|
||
|
||
#: lazarusidestrconsts:lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Vecchia classe"
|
||
|
||
#: lazarusidestrconsts:dlgedon
|
||
msgid "On"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "On idle"
|
||
|
||
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Aiuto in linea"
|
||
|
||
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
||
msgid "Online Help not yet implemented"
|
||
msgstr "Guida in linea non ancora implementata"
|
||
|
||
#: lazarusidestrconsts:lispldonlyexistingfiles
|
||
msgid "Only existing files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Ricerca solo parole intere"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Solo selezione"
|
||
|
||
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Solo file di testo"
|
||
|
||
#: lazarusidestrconsts:lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishintopen
|
||
msgid "Open"
|
||
msgstr "Apri"
|
||
|
||
#: lazarusidestrconsts:lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Apri %s"
|
||
|
||
#: lazarusidestrconsts:lismenuopen
|
||
msgid "Open ..."
|
||
msgstr "Apri ..."
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
||
msgid "Open Diff in editor"
|
||
msgstr "Apri Diff nell'editor"
|
||
|
||
#: lazarusidestrconsts:lisopenfile2
|
||
msgid "Open File ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Apri il pacchetto %s"
|
||
|
||
#: lazarusidestrconsts:lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Apri file pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Aprire il pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Apri anteprima"
|
||
|
||
#: lazarusidestrconsts:lispwopenproject
|
||
msgid "Open Project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Apri progetto ..."
|
||
|
||
#: lazarusidestrconsts:lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Apri file progetto"
|
||
|
||
#: lazarusidestrconsts:lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Aprire il progetto?"
|
||
|
||
#: lazarusidestrconsts:lismenutemplateopenrecent
|
||
msgid "Open Recent"
|
||
msgstr "Apri recenti"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecent
|
||
msgid "Open Recent ..."
|
||
msgstr "Apri recenti ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentproject
|
||
msgid "Open Recent Project ..."
|
||
msgstr "Apri progetto recente ..."
|
||
|
||
#: lazarusidestrconsts:liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Apri la unit %s"
|
||
|
||
#: lazarusidestrconsts:lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Apri come file XML"
|
||
|
||
#: lazarusidestrconsts:lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Apri un file gi<67> esistente"
|
||
|
||
#: lazarusidestrconsts:lisopenfile
|
||
msgid "Open file"
|
||
msgstr "Apri file"
|
||
|
||
#: lazarusidestrconsts:srkmecopenfileatcursor
|
||
msgid "Open file at cursor"
|
||
msgstr "Apri il file al cursore"
|
||
|
||
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
||
msgid "Open filename at cursor"
|
||
msgstr "Apri nomefile al cursore"
|
||
|
||
#: lazarusidestrconsts:dlgqopenlastprj
|
||
msgid "Open last project at start"
|
||
msgstr "Apertura ultimo progetto alla partenza"
|
||
|
||
#: lazarusidestrconsts:lisoipopenloadedpackage
|
||
msgid "Open loaded package"
|
||
msgstr "Apri pacchetto caricato"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackage
|
||
msgid "Open loaded package ..."
|
||
msgstr "Apri pacchetto caricato ..."
|
||
|
||
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
||
msgid "Open or Load Compiler Options"
|
||
msgstr "Apri o carica le opzioni del compilatore"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Apri pachetto"
|
||
|
||
#: lazarusidestrconsts:lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Apri un pacchetto"
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackagefile
|
||
msgid "Open package file (.lpk) ..."
|
||
msgstr "Apri il file del pacchetto (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
||
msgid "Open package of current unit"
|
||
msgstr "Apri pacchetto della unit corrente"
|
||
|
||
#: lazarusidestrconsts:lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Apri progetto"
|
||
|
||
#: lazarusidestrconsts:lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Apri di nuovo il progetto"
|
||
|
||
#: lazarusidestrconsts:lisiecoopenrecent
|
||
msgid "Open recent"
|
||
msgstr "Apri recenti"
|
||
|
||
#: lazarusidestrconsts:lismenuopenrecentpkg
|
||
msgid "Open recent package ..."
|
||
msgstr "Apri pacchetto recente ..."
|
||
|
||
#: lazarusidestrconsts:lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopentarget
|
||
msgid "Open target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Apri il file come sorgente normale"
|
||
|
||
#: lazarusidestrconsts:lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Aprire il pacchetto %s?"
|
||
|
||
#: lazarusidestrconsts:lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Aprire il progetto %s?"
|
||
|
||
#: lazarusidestrconsts:liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Apri unit"
|
||
|
||
#: lazarusidestrconsts:dlgoptimiz
|
||
msgid "Optimizations:"
|
||
msgstr "Ottimizzazioni:"
|
||
|
||
#: lazarusidestrconsts:liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Opzione: griglia magnetica"
|
||
|
||
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Opzione: linee guida magnetiche"
|
||
|
||
#: lazarusidestrconsts:dlgfropts
|
||
msgid "Options"
|
||
msgstr "Opzioni"
|
||
|
||
#: lazarusidestrconsts:lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Opzioni:"
|
||
|
||
#: lazarusidestrconsts:dlgcoopts
|
||
msgid "Options: "
|
||
msgstr "Opzioni: "
|
||
|
||
#: lazarusidestrconsts:fdmorder
|
||
msgid "Order"
|
||
msgstr "Ordina"
|
||
|
||
#: lazarusidestrconsts:dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Origine"
|
||
|
||
#: lazarusidestrconsts:dlgcoother
|
||
msgid "Other"
|
||
msgstr "Varie"
|
||
|
||
#: lazarusidestrconsts:dlgcosources
|
||
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Altre sorgenti (file .pp/.pas, usati sono dall'IDE, non dal compilatore)"
|
||
|
||
#: lazarusidestrconsts:dlgotherunitfiles
|
||
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
||
msgstr "Altri file unit (-Fu) (il delimitatore è puntoevirgola):"
|
||
|
||
#: lazarusidestrconsts:dlgenvotherfiles
|
||
msgid "Other files"
|
||
msgstr "Altri file"
|
||
|
||
#: lazarusidestrconsts:rsotherinfo
|
||
msgid "Other info"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Output"
|
||
|
||
#: lazarusidestrconsts:dlgpooutputsettings
|
||
msgid "Output Settings"
|
||
msgstr "Impostazioni di uscita"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Directory risultati"
|
||
|
||
#: lazarusidestrconsts:dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Overflow"
|
||
|
||
#: lazarusidestrconsts:lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Override del linguaggo. Per esempio --language=de. Per i possibili valori vedi i files nella directory languages."
|
||
|
||
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Sovrascrivi variabile di sistema"
|
||
|
||
#: lazarusidestrconsts:srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Modalità sovrascrittura"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Sovrascrivi il file su disco"
|
||
|
||
#: lazarusidestrconsts:lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Sovrascrivere il file?"
|
||
|
||
#: lazarusidestrconsts:listodolowner
|
||
msgid "Owner"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispackage
|
||
msgid "Package"
|
||
msgstr "Pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Pacchetto %s"
|
||
|
||
#: lazarusidestrconsts:lispckexplpackagenotfound
|
||
msgid "Package %s not found"
|
||
msgstr "Pacchetto %s non trovato"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
||
msgid "Package %s%s%s changed. Save?"
|
||
msgstr "Il pacchetto %s%s%s è cambiato. Salvarlo?"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
||
msgid "Package %s%s%s has changed.%sSave package?"
|
||
msgstr "Il pacchetto %s%s%s è cambiato.%sSalvare il pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
||
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
||
msgstr "Il pacchetto %s%s%s non ha una directory risultato valida:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
||
msgid "Package %s%s%s not found."
|
||
msgstr "Pacchetto %s%s%s non trovato."
|
||
|
||
#: lazarusidestrconsts:lismenupackagegraph
|
||
msgid "Package Graph ..."
|
||
msgstr "Pacchetto grafico ..."
|
||
|
||
#: lazarusidestrconsts:lispackageinfo
|
||
msgid "Package Info"
|
||
msgstr "Informazioni sul pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Nome pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Nome pacchetto:"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Opzioni pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgreg
|
||
msgid "Package Registration"
|
||
msgstr "Registrazione Pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Contrassegno directory sorgenti pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Conflitti di pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
||
msgid "Package file missing"
|
||
msgstr "Manca il file del pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "File pacchetto non trovato"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
||
msgid "Package file not saved"
|
||
msgstr "File del pacchetto non salvato"
|
||
|
||
#: lazarusidestrconsts:liskmpackagegraph
|
||
msgid "Package graph"
|
||
msgstr "Pacchetto grafico"
|
||
|
||
#: lazarusidestrconsts:dlgpldpackagegroup
|
||
msgid "Package group"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is no designtime package"
|
||
msgstr "Il pacchetto non è un pacchetto di progettazione"
|
||
|
||
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Il pacchetto è a sola lettura"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Il pacchetto è richiesto"
|
||
|
||
#: lazarusidestrconsts:lismenupackagelinks
|
||
msgid "Package links ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Il nome del pacchetto esiste già"
|
||
|
||
#: lazarusidestrconsts:lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Il nome del pacchetto inizia con ..."
|
||
|
||
#: lazarusidestrconsts:lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Il nome del Pacchetto contiene ..."
|
||
|
||
#: lazarusidestrconsts:lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Il pacchetto necessita di installazione"
|
||
|
||
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Pacchetto non trovato"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Pacchetto: %s"
|
||
|
||
#: lazarusidestrconsts:lispckoptspackagetype
|
||
msgid "PackageType"
|
||
msgstr "Tipo pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Il pacchetto deve avere l'estensione .lpk"
|
||
|
||
#: lazarusidestrconsts:lispackagestoinstallintheide
|
||
msgid "Packages to install in the IDE"
|
||
msgstr "Pacchetti da installare nell'IDE"
|
||
|
||
#: lazarusidestrconsts:lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Nome pagina troppo lungo"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Voci del designer del disegno solo in pausa (riduce il carico per computer lenti)"
|
||
|
||
#: lazarusidestrconsts:liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Pagina palette:"
|
||
|
||
#: lazarusidestrconsts:lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Paragrafi"
|
||
|
||
#: lazarusidestrconsts:liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Parametro"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Parametri:"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node can not contain child nodes."
|
||
msgstr "Il nodo genitore non può contenere nodi figlio."
|
||
|
||
#: lazarusidestrconsts:dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Analisi"
|
||
|
||
#: lazarusidestrconsts:lislazbuildabopart
|
||
msgid "Part"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispascalsourcefile
|
||
msgid "Pascal source file"
|
||
msgstr "File sorgente Pascal"
|
||
|
||
#: lazarusidestrconsts:lispascalunit
|
||
msgid "Pascal unit"
|
||
msgstr "Unit Pascal"
|
||
|
||
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Le unit pascal devono avere l'estensione .pp o .pas"
|
||
|
||
#: lazarusidestrconsts:lispasscount
|
||
msgid "Pass Count"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpassoptslinker
|
||
msgid "Pass Options To The Linker (Delimiter is space)"
|
||
msgstr "Passa le opzioni al linker (lo spazio è il delimitatore)"
|
||
|
||
#: lazarusidestrconsts:lismenupaste
|
||
msgid "Paste"
|
||
msgstr "Incolla"
|
||
|
||
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
|
||
msgid "Paste Components from clipboard"
|
||
msgstr "Incolla Componente dagli appunti"
|
||
|
||
#: lazarusidestrconsts:srkmecpaste
|
||
msgid "Paste clipboard to current position"
|
||
msgstr "Incolla la selezione nella posizione corrente"
|
||
|
||
#: lazarusidestrconsts:lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Incolla componenti selezionati dagli appunti"
|
||
|
||
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Modelli di percorso"
|
||
|
||
#: lazarusidestrconsts:listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Percorso:"
|
||
|
||
#: lazarusidestrconsts:dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Percorsi"
|
||
|
||
#: lazarusidestrconsts:lisuidpathsreadonly
|
||
msgid "Paths (Read Only)"
|
||
msgstr "Percorsi (sola lettura)"
|
||
|
||
#: lazarusidestrconsts:lismenupause
|
||
msgid "Pause"
|
||
msgstr "Pausa"
|
||
|
||
#: lazarusidestrconsts:liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Metti in pausa il programma"
|
||
|
||
#: lazarusidestrconsts:dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccochecktestdir
|
||
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthecompilername
|
||
msgid "Please check the compiler name"
|
||
msgstr "Controllare il nome del compilatore"
|
||
|
||
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
|
||
msgid "Please check the freepascal source directory"
|
||
msgstr "Controllare la directory sorgente del Freepascal"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Aprire una unit prima di eseguire."
|
||
|
||
#: lazarusidestrconsts:srkmpresskey
|
||
msgid "Please press a key ..."
|
||
msgstr "Premere un tasto..."
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Salvare il file prima di aggiungerlo ad un pacchetto."
|
||
|
||
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
||
msgid "Please save the package first."
|
||
msgstr "Salvare prima il pacchetto."
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Selezionare un pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
||
msgid "Please select a package to open"
|
||
msgstr "Selezionare un pacchetto da aprire"
|
||
|
||
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Selezionare prima una voce."
|
||
|
||
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Selezionare del codice per estrarre una nuova procedura/metodo."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Punto"
|
||
|
||
#: lazarusidestrconsts:lispointer
|
||
msgid "Pointer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Polacco"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishwin
|
||
msgid "Polish(CP1250)"
|
||
msgstr "Polacco(CP1250)"
|
||
|
||
#: lazarusidestrconsts:rslanguagepolishiso
|
||
msgid "Polish(ISO 8859-2)"
|
||
msgstr "Polacco(ISO 8859-2)"
|
||
|
||
#: lazarusidestrconsts:rslanguageportugues
|
||
msgid "Portuguese"
|
||
msgstr "Portoghese"
|
||
|
||
#: lazarusidestrconsts:lisceomode
|
||
msgid "Preferred Exhibition Mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwrdpreview
|
||
msgid "Preview"
|
||
msgstr "Anteprima"
|
||
|
||
#: lazarusidestrconsts:dlgcdtpreview
|
||
msgid "Preview (Max line length = 1)"
|
||
msgstr "Anteprima (Lunghezza massima riga = 1)"
|
||
|
||
#: lazarusidestrconsts:srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Segnalibri precedente"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Il nodo precedente non può contenere nodi figli"
|
||
|
||
#: lazarusidestrconsts:lisprint
|
||
msgid "Print"
|
||
msgstr "Stampa"
|
||
|
||
#: lazarusidestrconsts:listodolistprintlist
|
||
msgid "Print todo items"
|
||
msgstr "Stampa voci todo"
|
||
|
||
#: lazarusidestrconsts:listodolpriority
|
||
msgid "Priority"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprivate
|
||
msgid "Private"
|
||
msgstr "Privato"
|
||
|
||
#: lazarusidestrconsts:lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Metodo privato"
|
||
|
||
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
||
msgstr "Probabilmente devi installare alcuni componenti prima di continuare. %s%sWarning:%sIl progetto presenta una dipendenza da alcuni pacchetti, che contengono moduli con la procedura Register. La procedura Register è normalmente usata per installare componenti nell'IDE. Tuttavia i seguenti moduli appartengono a pacchetti che non sono ancora installati nell'IDE. Se provi ad aprire una form nell'IDE, che utilizza questi componenti, otterrai degli errori riguardo a componenti mancanti e il caricamento della form produrrà risultati poco piacevoli. %s%sCiò non influisce sull'apertura del progetto o di qualsiasi suo sorgente. %s%sSignifica solamente che: Non è una buona idea aprire le form per il design, prima di aver installato i pacchetti mancanti %s%s"
|
||
|
||
#: lazarusidestrconsts:lisprocedure
|
||
msgid "Procedure"
|
||
msgstr "Procedura"
|
||
|
||
#: lazarusidestrconsts:uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Salta alla procedura"
|
||
|
||
#: lazarusidestrconsts:srkmecprocedurelist
|
||
msgid "Procedure List ..."
|
||
msgstr "Elenco procedure ..."
|
||
|
||
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Criterio di inserimento procedure"
|
||
|
||
#: lazarusidestrconsts:lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Procedura con interfaccia"
|
||
|
||
#: lazarusidestrconsts:lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Processo"
|
||
|
||
#: lazarusidestrconsts:lisprogram
|
||
msgid "Program"
|
||
msgstr "Programma"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Nome del programma:"
|
||
|
||
#: lazarusidestrconsts:lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Rilevato programma"
|
||
|
||
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
||
msgstr "I sorgenti del programma devono avere un'estensione tipo pascal come .pas, .pp o .lpr"
|
||
|
||
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
||
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
||
msgstr "Programma%sUn programma Freepascal. Il file del programma viene automaticamente gestito da Lazarus."
|
||
|
||
#: lazarusidestrconsts:lisexeprograms
|
||
msgid "Programs"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Progressione"
|
||
|
||
#: lazarusidestrconsts:dlgenvproject
|
||
msgid "Project"
|
||
msgstr "Progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
||
msgid "Project %s%s%s successfully built. :)"
|
||
msgstr "La build del progetto %s%s%s è stata completata con successo. :)"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectincpath
|
||
msgid "Project IncPath"
|
||
msgstr "Perc. Inc. progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Percorso degli include del progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectinformation
|
||
msgid "Project Information"
|
||
msgstr "Informazione sul progetto"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Analizzatore progetti"
|
||
|
||
#: lazarusidestrconsts:lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Analizzatore progetti - %s"
|
||
|
||
#: lazarusidestrconsts:dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Opzioni progetto"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Opzioni progetto ..."
|
||
|
||
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Segno di directory dei sorgenti di progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Percorso dei sorgenti del progetto"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
||
msgid "Project SrcPath"
|
||
msgstr "PercSorg progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Percorso della unit del progetto"
|
||
|
||
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
||
msgid "Project UnitPath"
|
||
msgstr "PercUnit progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Il progetto è cambiato"
|
||
|
||
#: lazarusidestrconsts:lisprojectdirectory
|
||
msgid "Project directory"
|
||
msgstr "Directory progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Nome file progetto"
|
||
|
||
#: lazarusidestrconsts:dlgprojfiles
|
||
msgid "Project files"
|
||
msgstr "File del progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Rilevato file di informazioni sul progetto"
|
||
|
||
#: lazarusidestrconsts:lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Il progetto è eseguibile"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Propriet<65> delle macro del progetto"
|
||
|
||
#: lazarusidestrconsts:srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Comandi per il menu progetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Progetto: %s"
|
||
|
||
#: lazarusidestrconsts:lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Prompt di richiesta dato"
|
||
|
||
#: lazarusidestrconsts:lisceproperties
|
||
msgid "Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Proprietà:"
|
||
|
||
#: lazarusidestrconsts:dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Completamento della proprietà"
|
||
|
||
#: lazarusidestrconsts:dlgpropnamecolor
|
||
msgid "Property name"
|
||
msgstr "Nome proprietà"
|
||
|
||
#: lazarusidestrconsts:lisprotected
|
||
msgid "Protected"
|
||
msgstr "Protetto"
|
||
|
||
#: lazarusidestrconsts:lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Metodo protetto"
|
||
|
||
#: lazarusidestrconsts:lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisemdpublic
|
||
msgid "Public"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Metodo pubblico"
|
||
|
||
#: lazarusidestrconsts:lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Pubblica package"
|
||
|
||
#: lazarusidestrconsts:lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Pubblica progetto ..."
|
||
|
||
#: lazarusidestrconsts:liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Pubblica il progetto"
|
||
|
||
#: lazarusidestrconsts:lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Pubblica directory progetto"
|
||
|
||
#: lazarusidestrconsts:lisemdpublished
|
||
msgid "Published"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Metodo pubblicato"
|
||
|
||
#: lazarusidestrconsts:lislazbuildquickbuildoptions
|
||
msgid "Quick Build Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuquickcompile
|
||
msgid "Quick compile"
|
||
msgstr "Compilazione veloce"
|
||
|
||
#: lazarusidestrconsts:liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Compilazione veloce, senza linking"
|
||
|
||
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
||
msgid "Quick syntax check"
|
||
msgstr "Controllo della sintassi veloce"
|
||
|
||
#: lazarusidestrconsts:lismenuquit
|
||
msgid "Quit"
|
||
msgstr "Esci"
|
||
|
||
#: lazarusidestrconsts:lisquitlazarus
|
||
msgid "Quit Lazarus"
|
||
msgstr "Esci da Lazarus"
|
||
|
||
#: lazarusidestrconsts:dlgcorange
|
||
msgid "Range"
|
||
msgstr "Range"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Ri-aggiungi dipendenza"
|
||
|
||
#: lazarusidestrconsts:lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Ri-aggiungi file"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Ri-compilare questo e tutti i pacchetti richiesti?"
|
||
|
||
#: lazarusidestrconsts:lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Errore di lettura"
|
||
|
||
#: lazarusidestrconsts:uemreadonly
|
||
msgid "Read Only"
|
||
msgstr "Sola lettura"
|
||
|
||
#: lazarusidestrconsts:lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Sola lettura: %s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Errore di lettura"
|
||
|
||
#: lazarusidestrconsts:dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Leggi il prefisso"
|
||
|
||
#: lazarusidestrconsts:uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Sola lettura"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Eseguire un rebuild di Lazarus?"
|
||
|
||
#: lazarusidestrconsts:lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Files recenti"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
||
msgid "Recompile all required"
|
||
msgstr "Ricompila tutto quello che serve"
|
||
|
||
#: lazarusidestrconsts:lispckeditrecompileclean
|
||
msgid "Recompile clean"
|
||
msgstr "Ricompila dopo un clean"
|
||
|
||
#: lazarusidestrconsts:lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuredo
|
||
msgid "Redo"
|
||
msgstr "Ripristina"
|
||
|
||
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Riduce il disegno del designer"
|
||
|
||
#: lazarusidestrconsts:uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Refactoring"
|
||
|
||
#: lazarusidestrconsts:dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Riferimento"
|
||
|
||
#: lazarusidestrconsts:dlgunitdeprefresh
|
||
msgid "Refresh"
|
||
msgstr "Aggiorna"
|
||
|
||
#: lazarusidestrconsts:lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Aggiorna automaticamente"
|
||
|
||
#: lazarusidestrconsts:listodolistrefresh
|
||
msgid "Refresh todo items"
|
||
msgstr "Agggiorna voci todo"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "La procedura di registrazione è vuota"
|
||
|
||
#: lazarusidestrconsts:lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Registra la unit"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "RegisterUnit è stata chiamata ma nessun pacchetto è in registrazione."
|
||
|
||
#: lazarusidestrconsts:lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Plugin registrati"
|
||
|
||
#: lazarusidestrconsts:lispkgsysregistrationerror
|
||
msgid "Registration Error"
|
||
msgstr "Errore di registrazione"
|
||
|
||
#: lazarusidestrconsts:lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Percorsi relativi"
|
||
|
||
#: lazarusidestrconsts:lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Versione"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffrevertall
|
||
msgid "Reload from disk"
|
||
msgstr "Ricarica da disco"
|
||
|
||
#: lazarusidestrconsts:lisexttoolremove
|
||
msgid "Remove"
|
||
msgstr "Rimuovi"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Rimuovere la dipendenza?"
|
||
|
||
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
|
||
msgid "Remove active unit from project"
|
||
msgstr "Togli la Unit attiva dal progetto"
|
||
|
||
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Elimina tutte le proprietà non valide"
|
||
|
||
#: lazarusidestrconsts:liskmremovebreakpoint
|
||
msgid "Remove break point"
|
||
msgstr "Togli break point"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Rimuovi dipendenza"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Rimuovere le dipendenze %s%s%s%sdal pacchetto %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:srkmecremoveemptymethods
|
||
msgid "Remove empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Rimuovi file"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Rimuove il file %s dal progetto?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
||
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
||
msgstr "Rimuovere il file %s%s%s%sdal pacchetto %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Rimuovere il file?"
|
||
|
||
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Elimina tutti i file che corrispondono al filtro"
|
||
|
||
#: lazarusidestrconsts:lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Togli dal progetto ..."
|
||
|
||
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
||
msgid "Remove from favourite properties"
|
||
msgstr "Rimuovi dalle proprietà favorite"
|
||
|
||
#: lazarusidestrconsts:lisremovefromproject
|
||
msgid "Remove from project"
|
||
msgstr "Rimuovi dal progetto"
|
||
|
||
#: lazarusidestrconsts:lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Rimuovi il percorso"
|
||
|
||
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Rimuovi voce selezionata"
|
||
|
||
#: lazarusidestrconsts:lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Rimuovilo"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
||
msgid "Removed Files (these entries are not saved to the lpk file)"
|
||
msgstr "File rimossi (queste voci non sono state salvate nel file lpk)"
|
||
|
||
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
||
msgid "Removed required packages"
|
||
msgstr "Pacchetti richiesti rimossi"
|
||
|
||
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
||
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
||
msgstr "Pacchetti richiesti rimossi (queste voci non sono stati salvati nel file lpk)"
|
||
|
||
#: lazarusidestrconsts:lisfrirename
|
||
msgid "Rename"
|
||
msgstr "Rinomina"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Rinomina il file in minuscolo?"
|
||
|
||
#: lazarusidestrconsts:uemrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Rinomina identificatore"
|
||
|
||
#: lazarusidestrconsts:lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Rinomina identificatore ..."
|
||
|
||
#: lazarusidestrconsts:lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Rinomina tutti i riferimenti"
|
||
|
||
#: lazarusidestrconsts:lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Rinomina del file fallita"
|
||
|
||
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
||
msgid "Rename file in package?"
|
||
msgstr "Rinomina il file nel pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Rinomina file?"
|
||
|
||
#: lazarusidestrconsts:srkmecrenameidentifier
|
||
msgid "Rename identifier"
|
||
msgstr "Rinomina identificatore"
|
||
|
||
#: lazarusidestrconsts:lisfrirenameto
|
||
msgid "Rename to"
|
||
msgstr "Rinomina a"
|
||
|
||
#: lazarusidestrconsts:lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Rinomina in minuscolo"
|
||
|
||
#: lazarusidestrconsts:lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenureplace
|
||
msgid "Replace"
|
||
msgstr "Rimpiazza"
|
||
|
||
#: lazarusidestrconsts:dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Rimpiazza &Tutto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Rimpiazza file"
|
||
|
||
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file %s%s%s?"
|
||
msgstr "Rimpiazzare il file esistente %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:srkmecreplace
|
||
msgid "Replace text"
|
||
msgstr "Rinpiazza con testo"
|
||
|
||
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
||
msgstr "Sostituisci questa occorrenza di %s%s%s%s con %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Fallito il rimpiazzo della selezione."
|
||
|
||
#: lazarusidestrconsts:dlgreport
|
||
msgid "Report"
|
||
msgstr "Rapporto"
|
||
|
||
#: lazarusidestrconsts:lismenureportingbug
|
||
msgid "Reporting a bug..."
|
||
msgstr "Segnalare un bug..."
|
||
|
||
#: lazarusidestrconsts:lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Pacchetto richiesto"
|
||
|
||
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC source directory"
|
||
msgstr "Rileggi la directory dei sorgenti FPC"
|
||
|
||
#: lazarusidestrconsts:lisvsrresetresultlist
|
||
msgid "Reset Result List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuresetdebugger
|
||
msgid "Reset debugger"
|
||
msgstr "Inizializza debugger"
|
||
|
||
#: lazarusidestrconsts:lisresourceloaderror
|
||
msgid "Resource load error"
|
||
msgstr "Errore di caricamento risorse"
|
||
|
||
#: lazarusidestrconsts:lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Errore di salvataggio risorsa"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "La resourcestring esiste già"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Sezione resourcestring:"
|
||
|
||
#: lazarusidestrconsts:lismenurestart
|
||
msgid "Restart"
|
||
msgstr "Riavvia"
|
||
|
||
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
||
msgid "Restart after successful Build"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Ripristina la geometria della finestra"
|
||
|
||
#: lazarusidestrconsts:rsiwprestorewindowsize
|
||
msgid "Restore window size"
|
||
msgstr "Ripristina l'ampiezza della finestra"
|
||
|
||
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccoresults
|
||
msgid "Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Riprendi"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Ripristina"
|
||
|
||
#: lazarusidestrconsts:lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Ripristino fallito"
|
||
|
||
#: lazarusidestrconsts:lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Ripristina pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lisright
|
||
msgid "Right"
|
||
msgstr "Destra"
|
||
|
||
#: lazarusidestrconsts:dlgrightclickselects
|
||
msgid "Right Click selects"
|
||
msgstr "Tasto destro seleziona"
|
||
|
||
#: lazarusidestrconsts:lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Ancoraggio a destra"
|
||
|
||
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
||
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
||
msgstr "Fai click sul tasto destro del mouse sull'albero degli elementi per ottenere una finestra con tutte le funzioni disponibili nel pacchetto."
|
||
|
||
#: lazarusidestrconsts:dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Margine destro"
|
||
|
||
#: lazarusidestrconsts:dlgrightmargincolor
|
||
msgid "Right margin color"
|
||
msgstr "Colore margine destro"
|
||
|
||
#: lazarusidestrconsts:dlgrightmousemovescursor
|
||
msgid "Right mouse moves cursor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Lato destro"
|
||
|
||
#: lazarusidestrconsts:lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "Spazia a destra equidistante"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandgroup
|
||
msgid "Rubber band"
|
||
msgstr "Elastico"
|
||
|
||
#: lazarusidestrconsts:lismenuprojectrun
|
||
msgid "Run"
|
||
msgstr "Esegui"
|
||
|
||
#: lazarusidestrconsts:lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Esegui comando"
|
||
|
||
#: lazarusidestrconsts:lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Esegui il file"
|
||
|
||
#: lazarusidestrconsts:lismenurunparameters
|
||
msgid "Run Parameters ..."
|
||
msgstr "Parametri di esecuzione..."
|
||
|
||
#: lazarusidestrconsts:srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Comandi per il menu esecuzione"
|
||
|
||
#: lazarusidestrconsts:dlgrunparameters
|
||
msgid "Run parameters"
|
||
msgstr "Parametri di esecuzione"
|
||
|
||
#: lazarusidestrconsts:liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Esegui programma"
|
||
|
||
#: lazarusidestrconsts:lismenuruntocursor
|
||
msgid "Run to cursor"
|
||
msgstr "Esegui fino al cursore"
|
||
|
||
#: lazarusidestrconsts:lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Fallita l'esecuzione fino a"
|
||
|
||
#: lazarusidestrconsts:lispckoptsruntimeonly
|
||
msgid "Runtime only"
|
||
msgstr "Solo esecuzione"
|
||
|
||
#: lazarusidestrconsts:rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Russo"
|
||
|
||
#: lazarusidestrconsts:lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Revisione SVN:"
|
||
|
||
#: lazarusidestrconsts:dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Stesso nome (nella directory)"
|
||
|
||
#: lazarusidestrconsts:lismenusave
|
||
msgid "Save"
|
||
msgstr "Salva"
|
||
|
||
#: lazarusidestrconsts:lissavespace
|
||
msgid "Save "
|
||
msgstr "Salva "
|
||
|
||
#: lazarusidestrconsts:lissave
|
||
msgid "Save ..."
|
||
msgstr "Salva ..."
|
||
|
||
#: lazarusidestrconsts:lismenusaveall
|
||
msgid "Save All"
|
||
msgstr "Salva tutto"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatesaveas
|
||
msgid "Save As"
|
||
msgstr "Salva come"
|
||
|
||
#: lazarusidestrconsts:dlgcharcasefileact
|
||
msgid "Save As - auto rename pascal files lower case"
|
||
msgstr "Salva come - auto rinomina i file pascal in minuscolo"
|
||
|
||
#: lazarusidestrconsts:lismenusaveas
|
||
msgid "Save As ..."
|
||
msgstr "Salva come ..."
|
||
|
||
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
||
msgid "Save As Template..."
|
||
msgstr "Salva come modello..."
|
||
|
||
#: lazarusidestrconsts:lispckeditsavechanges
|
||
msgid "Save Changes?"
|
||
msgstr "Salvare i cambiamenti?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Salva il pacchetto %s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage
|
||
msgid "Save Package?"
|
||
msgstr "Salvare il pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Salva progetto"
|
||
|
||
#: lazarusidestrconsts:lissaveprojectlpi
|
||
msgid "Save Project %s (*.lpi)"
|
||
msgstr "Salva il progetto %s (*.lpi)"
|
||
|
||
#: lazarusidestrconsts:lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Salva progetto come ..."
|
||
|
||
#: lazarusidestrconsts:lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Salva i settaggi"
|
||
|
||
#: lazarusidestrconsts:lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Salva tutto"
|
||
|
||
#: lazarusidestrconsts:lissaveallmessagestofile
|
||
msgid "Save all messages to file"
|
||
msgstr "Salva tutti i messaggi su file"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Salva ed esci"
|
||
|
||
#: lazarusidestrconsts:lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Salva e esci dalla finestra"
|
||
|
||
#: lazarusidestrconsts:lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Salva e fai un rebuild dell'IDE"
|
||
|
||
#: lazarusidestrconsts:lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Salva i cambiamenti al progetto %s?"
|
||
|
||
#: lazarusidestrconsts:lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Salvare i cambiamenti?"
|
||
|
||
#: lazarusidestrconsts:dlgsavedfile
|
||
msgid "Save desktop settings to file"
|
||
msgstr "Salva le impostazioni del desktop su file"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Salva informazioni dell'editor per i file chiusi"
|
||
|
||
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Salva le informazioni dell'editor per i file non di progetto"
|
||
|
||
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Salva informazioni dell'editor solo per i file di progetto"
|
||
|
||
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
||
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
||
msgstr "Salva il file %s%s%s%sprima di chiudere la form %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Salva con nome"
|
||
|
||
#: lazarusidestrconsts:lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Salva file video"
|
||
|
||
#: lazarusidestrconsts:fdmsaveformasxml
|
||
msgid "Save form as xml"
|
||
msgstr "Salva form come xml"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Salva nel file .lpi"
|
||
|
||
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Salva nel file .lps nella directory del progetto"
|
||
|
||
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
||
msgid "Save in IDE config directory"
|
||
msgstr "Salva nella directory IDE config"
|
||
|
||
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Salva l'informazione dei file dell'editor chiusi"
|
||
|
||
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Salva i messaggi in un file (*.txt)"
|
||
|
||
#: lazarusidestrconsts:lispckeditsavepackage
|
||
msgid "Save package"
|
||
msgstr "Salva il pacchetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangsavepackage2
|
||
msgid "Save package?"
|
||
msgstr "Salvare il pacchetto?"
|
||
|
||
#: lazarusidestrconsts:liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Salva progetto"
|
||
|
||
#: lazarusidestrconsts:liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Salva progetto come"
|
||
|
||
#: lazarusidestrconsts:lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Salva l'informazione di sessione in "
|
||
|
||
#: lazarusidestrconsts:lislazbuildsavesettings
|
||
msgid "Save settings"
|
||
msgstr "Salva le impostazioni"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Salva nel file"
|
||
|
||
#: lazarusidestrconsts:lisiecosavetorecent
|
||
msgid "Save to recent"
|
||
msgstr "Salva nei recenti"
|
||
|
||
#: lazarusidestrconsts:liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "SalvaTutto"
|
||
|
||
#: lazarusidestrconsts:liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "SalvaCome"
|
||
|
||
#: lazarusidestrconsts:fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Scala"
|
||
|
||
#: lazarusidestrconsts:lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Fattore di scala:"
|
||
|
||
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
||
msgid "Scan Unit for Unit Name and Register procedure"
|
||
msgstr "Scansiona la unit in cerca del nome e della procedura di registrazione"
|
||
|
||
#: lazarusidestrconsts:liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Scansiona per i messaggi FPC"
|
||
|
||
#: lazarusidestrconsts:liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Scansiona per i messaggi Make"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for Free Pascal Compiler messages"
|
||
msgstr "Ricerca nel risultato di messaggi del compilatore Free Pascal"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for make messages"
|
||
msgstr "Ricerca nel risultato di messaggi di make"
|
||
|
||
#: lazarusidestrconsts:dlgscope
|
||
msgid "Scope"
|
||
msgstr "Campo di validità"
|
||
|
||
#: lazarusidestrconsts:dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Scorrimento per uno di meno"
|
||
|
||
#: lazarusidestrconsts:srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Scorri in basso di una riga"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Scorri a sinistra di un carattere"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Scorrimento fino alla fine del file"
|
||
|
||
#: lazarusidestrconsts:dlgscrollpastendline
|
||
msgid "Scroll past end of line"
|
||
msgstr "Scorrimento fino alla fine della riga"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Scorri a sinistra di un carattere"
|
||
|
||
#: lazarusidestrconsts:srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Scorri in alto di una riga"
|
||
|
||
#: lazarusidestrconsts:lissearchfor
|
||
msgid "Search For "
|
||
msgstr "Cerca "
|
||
|
||
#: lazarusidestrconsts:lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Risultati della ricerca"
|
||
|
||
#: lazarusidestrconsts:lissearchagain
|
||
msgid "Search again"
|
||
msgstr "Cerca ancora"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Cerca anche nei commenti"
|
||
|
||
#: lazarusidestrconsts:lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
|
||
msgid "Search or Filter Phrases In List"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Percorsi di ricerca:"
|
||
|
||
#: lazarusidestrconsts:lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "La stringa '%s' non è stata trovata!"
|
||
|
||
#: lazarusidestrconsts:dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Ricerca interrotta dall'utente."
|
||
|
||
#: lazarusidestrconsts:lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Trova il testo"
|
||
|
||
#: lazarusidestrconsts:lisfrisearchwhere
|
||
msgid "Search where"
|
||
msgstr "Cerca dove"
|
||
|
||
#: lazarusidestrconsts:lisssearching
|
||
msgid "Searching"
|
||
msgstr "Sto cercando"
|
||
|
||
#: lazarusidestrconsts:dlgsearchcaption
|
||
msgid "Searching..."
|
||
msgstr "Ricerca in corso..."
|
||
|
||
#: lazarusidestrconsts:lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "In cerca di: %s"
|
||
|
||
#: lazarusidestrconsts:liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Vedi anche"
|
||
|
||
#: lazarusidestrconsts:lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Vedi messaggi."
|
||
|
||
#: lazarusidestrconsts:srkmecselleft
|
||
msgid "SelLeft"
|
||
msgstr "Seleziona a sinistra"
|
||
|
||
#: lazarusidestrconsts:srkmecselright
|
||
msgid "SelRight"
|
||
msgstr "Seleziona a destra"
|
||
|
||
#: lazarusidestrconsts:lismenuselect
|
||
msgid "Select"
|
||
msgstr "Seleziona"
|
||
|
||
#: lazarusidestrconsts:srkmecselectall
|
||
msgid "Select All"
|
||
msgstr "Seleziona tutto"
|
||
|
||
#: lazarusidestrconsts:lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Seleziona la Code Macro"
|
||
|
||
#: lazarusidestrconsts:lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Seleziona file form Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts:srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Seleziona in basso"
|
||
|
||
#: lazarusidestrconsts:srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Seleziona fino a XY"
|
||
|
||
#: lazarusidestrconsts:srkmecsellineend
|
||
msgid "Select Line End"
|
||
msgstr "Seleziona fino alla fine della riga"
|
||
|
||
#: lazarusidestrconsts:srkmecsellinestart
|
||
msgid "Select Line Start"
|
||
msgstr "Selezione fino all'inizio riga"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselectmenu
|
||
msgid "Select Menu:"
|
||
msgstr "Seleziona menu:"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagebottom
|
||
msgid "Select Page Bottom"
|
||
msgstr "Seleziona fino alla fine della pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Seleziona la pagina in giù"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Seleziona la pagina a sinistra"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Seleziona la pagina a destra"
|
||
|
||
#: lazarusidestrconsts:srkmecselpagetop
|
||
msgid "Select Page Top"
|
||
msgstr "Seleziona fino alla cima della pagina"
|
||
|
||
#: lazarusidestrconsts:srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Seleziona la pagina in su"
|
||
|
||
#: lazarusidestrconsts:lismenueditorselecttemplate
|
||
msgid "Select Template:"
|
||
msgstr "Seleziona modello:"
|
||
|
||
#: lazarusidestrconsts:srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Seleziona in alto"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordleft
|
||
msgid "Select Word Left"
|
||
msgstr "Seleziona la parola a sinistra"
|
||
|
||
#: lazarusidestrconsts:srkmecselwordright
|
||
msgid "Select Word Right"
|
||
msgstr "Seleziona la parola a destra"
|
||
|
||
#: lazarusidestrconsts:lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Seleziona una voce dell'aiuto:"
|
||
|
||
#: lazarusidestrconsts:lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Seleziona un nodo"
|
||
|
||
#: lazarusidestrconsts:lisnpselectaprojecttype
|
||
msgid "Select a project type"
|
||
msgstr "Seleziona un tipo di progetto"
|
||
|
||
#: lazarusidestrconsts:lismenuselectall
|
||
msgid "Select all"
|
||
msgstr "Seleziona tutto"
|
||
|
||
#: lazarusidestrconsts:lismenuselectcodeblock
|
||
msgid "Select code block"
|
||
msgstr "Seleziona in blocco di codice"
|
||
|
||
#: lazarusidestrconsts:lispatheditselectdirectory
|
||
msgid "Select directory"
|
||
msgstr "Seleziona directory"
|
||
|
||
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
||
msgid "Select grand childs"
|
||
msgstr "Selezione nipoti"
|
||
|
||
#: lazarusidestrconsts:lismenuselectline
|
||
msgid "Select line"
|
||
msgstr "Seleziona riga"
|
||
|
||
#: lazarusidestrconsts:liskmselectlineend
|
||
msgid "Select line end"
|
||
msgstr "Seleziona la fine della riga"
|
||
|
||
#: lazarusidestrconsts:liskmselectlinestart
|
||
msgid "Select line start"
|
||
msgstr "Seleziona l'inizio della riga"
|
||
|
||
#: lazarusidestrconsts:lissamselectnone
|
||
msgid "Select none"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmselectpagebottom
|
||
msgid "Select page bottom"
|
||
msgstr "Seleziona la fine della pagina"
|
||
|
||
#: lazarusidestrconsts:liskmselectpagetop
|
||
msgid "Select page top"
|
||
msgstr "Seleziona l'inizio della pagina"
|
||
|
||
#: lazarusidestrconsts:lismenuselectparagraph
|
||
msgid "Select paragraph"
|
||
msgstr "Seleziona paragrafo"
|
||
|
||
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Seleziona componente genitore"
|
||
|
||
#: lazarusidestrconsts:lisselectfile
|
||
msgid "Select the file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Seleziona fino all'inizio"
|
||
|
||
#: lazarusidestrconsts:srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Seleziona fino alla fine"
|
||
|
||
#: lazarusidestrconsts:lismenuselecttobrace
|
||
msgid "Select to brace"
|
||
msgstr "Seleziona in graffe"
|
||
|
||
#: lazarusidestrconsts:lismenuselectword
|
||
msgid "Select word"
|
||
msgstr "Seleziona la parola"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordleft
|
||
msgid "Select word left"
|
||
msgstr "Seleziona la parola a sinistra"
|
||
|
||
#: lazarusidestrconsts:liskmselectwordright
|
||
msgid "Select word right"
|
||
msgstr "Seleziona la parola a destra"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Seleziona nodo"
|
||
|
||
#: lazarusidestrconsts:lispckexplisrequiredby
|
||
msgid "Selected package is required by:"
|
||
msgstr "Il pacchetto selezionato è richiesto da:"
|
||
|
||
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
||
msgid "Selection"
|
||
msgstr "Selezione"
|
||
|
||
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "La selezione eccede la stringa costante"
|
||
|
||
#: lazarusidestrconsts:lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Strumento di selezione"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Puntoevirgola"
|
||
|
||
#: lazarusidestrconsts:dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Sessione"
|
||
|
||
#: lazarusidestrconsts:srkmecsetmarker
|
||
msgid "Set Marker %d"
|
||
msgstr "Imposta il marcatore %d"
|
||
|
||
#: lazarusidestrconsts:uemsetfreebookmark
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Imposta un segnalibro libero"
|
||
|
||
#: lazarusidestrconsts:lismenusetfreebookmark
|
||
msgid "Set a free bookmark"
|
||
msgstr "Imposta un segnalibro libero"
|
||
|
||
#: lazarusidestrconsts:dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Imposta tutti gli elementi come predefiniti"
|
||
|
||
#: lazarusidestrconsts:dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Imposta l'elemento come predefinito"
|
||
|
||
#: lazarusidestrconsts:liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker0
|
||
msgid "Set marker 0"
|
||
msgstr "Imposta segnalibro 0"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker1
|
||
msgid "Set marker 1"
|
||
msgstr "Imposta segnalibro 1"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker2
|
||
msgid "Set marker 2"
|
||
msgstr "Imposta segnalibro 2"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker3
|
||
msgid "Set marker 3"
|
||
msgstr "Imposta segnalibro 3"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker4
|
||
msgid "Set marker 4"
|
||
msgstr "Imposta segnalibro 4"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker5
|
||
msgid "Set marker 5"
|
||
msgstr "Imposta segnalibro 5"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker6
|
||
msgid "Set marker 6"
|
||
msgstr "Imposta segnalibro 6"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker7
|
||
msgid "Set marker 7"
|
||
msgstr "Imposta segnalibro 7"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker8
|
||
msgid "Set marker 8"
|
||
msgstr "Imposta segnalibro 8"
|
||
|
||
#: lazarusidestrconsts:liskmsetmarker9
|
||
msgid "Set marker 9"
|
||
msgstr "Imposta segnalibro 9"
|
||
|
||
#: lazarusidestrconsts:dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Imposta la proprietà variabile"
|
||
|
||
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Imposta un breakpoint in ogni caso"
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolshift
|
||
msgid "Shift"
|
||
msgstr "Maiuscole"
|
||
|
||
#: lazarusidestrconsts:srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Maiusc Tab"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Breve"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisshort
|
||
msgid "Short:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Riduci o espandi il nome del file"
|
||
|
||
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
||
msgstr "Rinomina del pacchetto in minuscolo in%s%s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisshow
|
||
msgid "Show"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisaf2pshowall
|
||
msgid "Show All"
|
||
msgstr "Mostra tutto"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Mostra valori CodeTools"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowerr
|
||
msgid "Show Errors"
|
||
msgstr "Mostra gli errori"
|
||
|
||
#: lazarusidestrconsts:dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Mostra le linee guida"
|
||
|
||
#: lazarusidestrconsts:dlgshowhint
|
||
msgid "Show Hints"
|
||
msgstr "Mostra i suggerimenti"
|
||
|
||
#: lazarusidestrconsts:dlghintsparametersendernotused
|
||
msgid "Show Hints for parameter \"Sender\" not used"
|
||
msgstr "Visualizza Hints per il parametro \"Sender\" non <20> usato"
|
||
|
||
#: lazarusidestrconsts:dlghintsunused
|
||
msgid "Show Hints for unused units in main source"
|
||
msgstr "Mostra suggerimenti per le unit non usate nel sorgente principale"
|
||
|
||
#: lazarusidestrconsts:uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Mostra i numeri di riga"
|
||
|
||
#: lazarusidestrconsts:dlgshownotes
|
||
msgid "Show Notes"
|
||
msgstr "Mostra le note"
|
||
|
||
#: lazarusidestrconsts:dlgcoshowoptions
|
||
msgid "Show Options"
|
||
msgstr "Mostra le opzioni"
|
||
|
||
#: lazarusidestrconsts:fdmshowoptions
|
||
msgid "Show Options for form editing"
|
||
msgstr "Mostra le opzioni per la modifica delle form"
|
||
|
||
#: lazarusidestrconsts:liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowwarnings
|
||
msgid "Show Warnings"
|
||
msgstr "Mostra gli avvertimenti (warning)"
|
||
|
||
#: lazarusidestrconsts:srkmecshowabstractmethods
|
||
msgid "Show abstract methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pshowall
|
||
msgid "Show all"
|
||
msgstr "Mostra tutto"
|
||
|
||
#: lazarusidestrconsts:liscoshowallmessages
|
||
msgid "Show all messages"
|
||
msgstr "Mostra tutti i messaggi"
|
||
|
||
#: lazarusidestrconsts:dlgshowprocserror
|
||
msgid "Show all procs on error"
|
||
msgstr "Mostra tutti i processi in errore"
|
||
|
||
#: lazarusidestrconsts:dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Mostra lo spazio di contorno"
|
||
|
||
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Mostra i tasti di chiusura negli appunti"
|
||
|
||
#: lazarusidestrconsts:srkmecshowcodecontext
|
||
msgid "Show code context"
|
||
msgstr "Mostra il contesto del codice"
|
||
|
||
#: lazarusidestrconsts:dlgqshowcompiledialog
|
||
msgid "Show compile dialog"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Mostra le procedure compilate"
|
||
|
||
#: lazarusidestrconsts:dlgshowcompileroptions
|
||
msgid "Show compiler options"
|
||
msgstr "Mostra le opzioni di compilazione"
|
||
|
||
#: lazarusidestrconsts:dlgshowcaps
|
||
msgid "Show component captions"
|
||
msgstr "Mostra intestazioni componenti"
|
||
|
||
#: lazarusidestrconsts:dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Mostra i condizionali"
|
||
|
||
#: lazarusidestrconsts:dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Mostra le informazioni di debug"
|
||
|
||
#: lazarusidestrconsts:dlgshowdefinedmacros
|
||
msgid "Show defined macros"
|
||
msgstr "Mostra le macro definite"
|
||
|
||
#: lazarusidestrconsts:dlgshowedrhints
|
||
msgid "Show editor hints"
|
||
msgstr "Mostra dritte dell'editor"
|
||
|
||
#: lazarusidestrconsts:liscodehelpshowemptymethods
|
||
msgid "Show empty methods"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Mostra tutto"
|
||
|
||
#: lazarusidestrconsts:dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Mostra le informazioni dell'eseguibile (solo Win32)"
|
||
|
||
#: lazarusidestrconsts:dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Mostra le informazioni generali"
|
||
|
||
#: lazarusidestrconsts:lispldshowgloballinks
|
||
msgid "Show global links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Mostra la griglia"
|
||
|
||
#: lazarusidestrconsts:dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Mostra i suggerimenti"
|
||
|
||
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
||
msgid "Show hints in Object Inspector"
|
||
msgstr "Mostra suggerimenti nell'analizzatore oggetti"
|
||
|
||
#: lazarusidestrconsts:lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Mostra gli identificatori"
|
||
|
||
#: lazarusidestrconsts:dlgshowlinenumbers
|
||
msgid "Show line numbers"
|
||
msgstr "Mostra numeri di riga"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Mostra messaggio alla fine"
|
||
|
||
#: lazarusidestrconsts:dlgshownothing
|
||
msgid "Show nothing (only errors)"
|
||
msgstr "Non mostrare nulla (solo gli errori)"
|
||
|
||
#: lazarusidestrconsts:lisshowoldtaborder
|
||
msgid "Show old tab order"
|
||
msgstr "Mostra il vecchio ordine di tabulazione"
|
||
|
||
#: lazarusidestrconsts:lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Mostra i pacchetti"
|
||
|
||
#: lazarusidestrconsts:dlgshowscrollhint
|
||
msgid "Show scroll hint"
|
||
msgstr "Mostra il suggerimento per lo scorrimento"
|
||
|
||
#: lazarusidestrconsts:lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Mostra il sommario"
|
||
|
||
#: lazarusidestrconsts:dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Mostra i file provati"
|
||
|
||
#: lazarusidestrconsts:lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Mostra le unit"
|
||
|
||
#: lazarusidestrconsts:dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Mostra il file usati"
|
||
|
||
#: lazarusidestrconsts:lispldshowuserlinks
|
||
msgid "Show user links"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissibling
|
||
msgid "Sibling"
|
||
msgstr "Fratello"
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Segno"
|
||
|
||
#: lazarusidestrconsts:lissimplesyntax
|
||
msgid "Simple Syntax"
|
||
msgstr "Sintassi semplice"
|
||
|
||
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Sintassi semplice (cioè * invece di .*)"
|
||
|
||
#: lazarusidestrconsts:fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Ampiezza"
|
||
|
||
#: lazarusidestrconsts:lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Dimensione:"
|
||
|
||
#: lazarusidestrconsts:lisccoskip
|
||
msgid "Skip"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscoskipcallingcompiler
|
||
msgid "Skip calling Compiler"
|
||
msgstr "Salta la chiamata al compilatore"
|
||
|
||
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Salta il file e prosegui nel caricamento"
|
||
|
||
#: lazarusidestrconsts:lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Salta il caricamento dell'ultimo progetto"
|
||
|
||
#: lazarusidestrconsts:lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Salta questo pacchetto"
|
||
|
||
#: lazarusidestrconsts:rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcosmaller
|
||
msgid "Smaller Code"
|
||
msgstr "Codice più compatto"
|
||
|
||
#: lazarusidestrconsts:dlgcosmartlinkable
|
||
msgid "Smart Linkable"
|
||
msgstr "Collegamneti intelligenti"
|
||
|
||
#: lazarusidestrconsts:dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Linguette intelligenti"
|
||
|
||
#: lazarusidestrconsts:dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Linee guida magnetiche"
|
||
|
||
#: lazarusidestrconsts:dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Griglia magnetica"
|
||
|
||
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Alcuni file su disco sono cambiati:"
|
||
|
||
#: lazarusidestrconsts:lissorrynotimplementedyet
|
||
msgid "Sorry, not implemented yet"
|
||
msgstr "Spiacente, non è stata ancora implementata"
|
||
|
||
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Spiacente, questo tipo non è ancora stato implementato"
|
||
|
||
#: lazarusidestrconsts:lispesortfiles
|
||
msgid "Sort files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Ordina selezione"
|
||
|
||
#: lazarusidestrconsts:lismenusortselection
|
||
msgid "Sort selection ..."
|
||
msgstr "Ordina selezione ..."
|
||
|
||
#: lazarusidestrconsts:lisceomodesource
|
||
msgid "Source"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewsourceeditor
|
||
msgid "Source Editor"
|
||
msgstr "Editor sorgente"
|
||
|
||
#: lazarusidestrconsts:srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Comandi sorgenti appunti"
|
||
|
||
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Sorgente e destinazione sono uguali:%s%s"
|
||
|
||
#: lazarusidestrconsts:lismenuaddbpsource
|
||
msgid "Source breakpoint"
|
||
msgstr "Breackpoint sorgente"
|
||
|
||
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
||
msgid "Source directory %s%s%s does not exist."
|
||
msgstr "La cartella sorgente %s%s%s non esiste."
|
||
|
||
#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Sorgente modificato"
|
||
|
||
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
||
msgid "Source of page %s%s%s has changed. Save?"
|
||
msgstr "Il sorgente della pagina %s%s%s è cambiato. Salvarlo?"
|
||
|
||
#: lazarusidestrconsts:lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Percorsi dei sorgenti"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Anteprima del sorgente"
|
||
|
||
#: lazarusidestrconsts:dlgspacenotcosmos
|
||
msgid "Space"
|
||
msgstr "Spazio"
|
||
|
||
#: lazarusidestrconsts:lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Spazia equidistante"
|
||
|
||
#: lazarusidestrconsts:rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Spagnolo"
|
||
|
||
#: lazarusidestrconsts:lisuidsrc
|
||
msgid "Src"
|
||
msgstr "Src"
|
||
|
||
#: lazarusidestrconsts:dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Stack"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Menu modifica standard"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Menu file standard"
|
||
|
||
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Menu aiuto standard"
|
||
|
||
#: lazarusidestrconsts:lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Inizia con un nuovo progetto"
|
||
|
||
#: lazarusidestrconsts:lisoipstate
|
||
msgid "State"
|
||
msgstr "Stato"
|
||
|
||
#: lazarusidestrconsts:dlgstatickeyword
|
||
msgid "Static Keyword in Objects"
|
||
msgstr "Parola chiave static nell'oggetto"
|
||
|
||
#: lazarusidestrconsts:lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "Passo interno"
|
||
|
||
#: lazarusidestrconsts:lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "Passo esterno"
|
||
|
||
#: lazarusidestrconsts:lismenustepinto
|
||
msgid "Step into"
|
||
msgstr "Passo interno"
|
||
|
||
#: lazarusidestrconsts:lismenustepover
|
||
msgid "Step over"
|
||
msgstr "Passo esterno"
|
||
|
||
#: lazarusidestrconsts:lismenustop
|
||
msgid "Stop"
|
||
msgstr "Stop"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Arresto il debug?"
|
||
|
||
#: lazarusidestrconsts:dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Ferma dopo un certo numero di errori:"
|
||
|
||
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Fermo il debugging corrente e faccio il rebuild del progetto?"
|
||
|
||
#: lazarusidestrconsts:lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Fermo il debugging?"
|
||
|
||
#: lazarusidestrconsts:liskmstopprogram
|
||
msgid "Stop program"
|
||
msgstr "Interrompi il programma"
|
||
|
||
#: lazarusidestrconsts:lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Arresto il debug?"
|
||
|
||
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
||
msgid "Store dependency filename"
|
||
msgstr "Salva il nome del file delle dipendenze"
|
||
|
||
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Posfisso memorizzato"
|
||
|
||
#: lazarusidestrconsts:lisstreamerror
|
||
msgid "Stream Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Errore di streaming"
|
||
|
||
#: lazarusidestrconsts:lisstring
|
||
msgid "String"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Costante stringa"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Costante stringa nel sorgente"
|
||
|
||
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Stringhe con lo stesso valore:"
|
||
|
||
#: lazarusidestrconsts:dlgcostrip
|
||
msgid "Strip Symbols From Executable"
|
||
msgstr "Esegue strip sugli eseguibili"
|
||
|
||
#: lazarusidestrconsts:lisstyle
|
||
msgid "Style"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Sub procedura"
|
||
|
||
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Sub procedura sullo stesso livello"
|
||
|
||
#: lazarusidestrconsts:dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Sotto directory"
|
||
|
||
#: lazarusidestrconsts:dlgsubpropkcolor
|
||
msgid "Subpropertes"
|
||
msgstr "Sub proprietà"
|
||
|
||
#: lazarusidestrconsts:lissuccess
|
||
msgid "Success"
|
||
msgstr "Successo"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildsuccess
|
||
msgid "Success..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Scambia percorsi"
|
||
|
||
#: lazarusidestrconsts:srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Passa dalla form alla unit"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Simbolo"
|
||
|
||
#: lazarusidestrconsts:dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Simbolo posposto (.pp~)"
|
||
|
||
#: lazarusidestrconsts:dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Simbolo anteposto (.~pp)"
|
||
|
||
#: lazarusidestrconsts:lissynedit
|
||
msgid "SynEdit"
|
||
msgstr "SynEdit"
|
||
|
||
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
||
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
||
msgstr "SybEdit - l'editor componenti usato da Lazarus. http://sourceforge.net/projects/synedit/"
|
||
|
||
#: lazarusidestrconsts:srkmecsyntaxcheck
|
||
msgid "Syntax check"
|
||
msgstr "Controllo sintassi"
|
||
|
||
#: lazarusidestrconsts:lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Opzioni di sintassi"
|
||
|
||
#: lazarusidestrconsts:dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Variabili di sistema"
|
||
|
||
#: lazarusidestrconsts:dlgbp7cptb
|
||
msgid "TP/BP 7.0 Compatible"
|
||
msgstr "Compatibile TP/BP 7.0"
|
||
|
||
#: lazarusidestrconsts:listab
|
||
msgid "Tab"
|
||
msgstr "Tab"
|
||
|
||
#: lazarusidestrconsts:listaborderof
|
||
msgid "Tab Order of"
|
||
msgstr "Ordine di tabulazione di "
|
||
|
||
#: lazarusidestrconsts:dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "Tab indenta i blocchi"
|
||
|
||
#: lazarusidestrconsts:fdmtaborder
|
||
msgid "Tab order..."
|
||
msgstr "Ordine di tabulazione..."
|
||
|
||
#: lazarusidestrconsts:liseotabwidths
|
||
msgid "Tab widths"
|
||
msgstr "Lunghezze di tabulazione"
|
||
|
||
#: lazarusidestrconsts:dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "Tabulazioni in spazi"
|
||
|
||
#: lazarusidestrconsts:lismenutabstospacesselection
|
||
msgid "Tabs to spaces in selection"
|
||
msgstr "Tabulazioni nella selezione in spazi"
|
||
|
||
#: lazarusidestrconsts:lislazbuildqboapplcltarget
|
||
msgid "Target"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "CPU di destinazione"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "CPU di destinazione:"
|
||
|
||
#: lazarusidestrconsts:listargetos
|
||
msgid "Target OS"
|
||
msgstr "SO di destinazione"
|
||
|
||
#: lazarusidestrconsts:liscotargetosspecificoptions
|
||
msgid "Target OS specific options"
|
||
msgstr "Opzioni specifiche del SO di destinazione"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "SO di destinazione:"
|
||
|
||
#: lazarusidestrconsts:dlgtargetplatform
|
||
msgid "Target Platform:"
|
||
msgstr "Piattaforma obiettivo"
|
||
|
||
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpotargetfilename
|
||
msgid "Target file name:"
|
||
msgstr "Nome file di destinazione:"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Nome file di destinazione + parametri"
|
||
|
||
#: lazarusidestrconsts:listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Nome file di destinazione del progetto"
|
||
|
||
#: lazarusidestrconsts:dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenueditortemplatepreview
|
||
msgid "Template Preview"
|
||
msgstr "Anteprima modello"
|
||
|
||
#: lazarusidestrconsts:dlgtplfname
|
||
msgid "Template file name"
|
||
msgstr "Nome file modello"
|
||
|
||
#: lazarusidestrconsts:lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Modelli"
|
||
|
||
#: lazarusidestrconsts:dlgccotest
|
||
msgid "Test"
|
||
msgstr "Test"
|
||
|
||
#: lazarusidestrconsts:listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Directory di test"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Directory di test \"%s\" non trovata."
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
|
||
msgid "Test: Checking fpc configs ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypetext
|
||
msgid "Text"
|
||
msgstr "Testo"
|
||
|
||
#: lazarusidestrconsts:dlgtextattributes
|
||
msgid "Text attributes"
|
||
msgstr "Attributi del testo"
|
||
|
||
#: lazarusidestrconsts:srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Comandi di modifica testo"
|
||
|
||
#: lazarusidestrconsts:srkmcatmarker
|
||
msgid "Text marker commands"
|
||
msgstr "Comandi per la selezione del testo"
|
||
|
||
#: lazarusidestrconsts:srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Comandi di ricerca e sostituzione testo"
|
||
|
||
#: lazarusidestrconsts:srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Comandi di selezione testo"
|
||
|
||
#: lazarusidestrconsts:lisfindfiletexttofind
|
||
msgid "Text to find:"
|
||
msgstr "Testo da trovare:"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext1
|
||
msgid "Text1"
|
||
msgstr "Testo1"
|
||
|
||
#: lazarusidestrconsts:lisdiffdlgtext2
|
||
msgid "Text2"
|
||
msgstr "Testo2"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "La %s directory principale,%sdove Borland installa tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: /home/utente/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "La %s directory principale,%sdove Borland ha installato tutti i %s sorgenti,%susati da questo %s progetto.%sPer esempio: C:/Programmi/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "La %s directory principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: /home/utente/kylix%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "La %s directory principale,%sdove Borland ha installato tutti i %s sorgenti.%sPer esempio: C:/Programmi/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "La %s directory del progetto,%sche contiene il file .dpr e dpk."
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
||
msgstr "La FCL - la libreria componenti di FreePascal fornisce le classi di base per il pascal ad oggetti."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
||
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "La directory dei sorgenti SVN di Free Pascal"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
||
msgstr "La directory dei sorgenti SVN di Free Pascal. Non richiesto. Questo migliora la ricerca delle dichiarazioni ed il debugging."
|
||
|
||
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
||
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
||
msgstr "Il compilatore Free Pascal (nome file: %s) non è stato trovato.%sSi raccomanda di installare fpc."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Directory del progetto Free Pascal"
|
||
|
||
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
||
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
||
msgstr "La cartella dei sorgenti di Free Pascal non è stata trovata.%sAlcuni comandi non funzioneranno.%sSi raccomanda di installarli e di impostare il percorso in%sAmbiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
||
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
||
msgstr "La LCL - la libreria componenti Lazarus contiene tutti i componenti di base per l'editing."
|
||
|
||
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
||
msgstr "Il file (form Lazarus) LFM contiene delle proprietà non valide. Ciò significa per esempio che contiene alcune proprietà/classi che non esistono nella LCL corrente. Il rimedio classico è di eliminare queste proprietà dall'lfm e aggiustare il codide pascal manualmente."
|
||
|
||
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
||
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "La cartella di Lazarus non è stata trovata.%sNon sarà possibile creare applicazioni LCL.%sControllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
||
msgid "The Lazarus main directory."
|
||
msgstr "La directory principale Lazarus"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
||
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La versione massima %s%s%s non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "La versione massima è più bassa della versione minima."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
||
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
||
msgstr "La versione minima &s%s%s non è valida.%sUsare il formato major.minor.release.build%sPer esempio: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
||
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
||
msgstr "La RTL - La Libreria Run-Time è la base di tutti i programmi Free Pascal."
|
||
|
||
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
||
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
||
msgstr "Impossibile trovare la directory di test:%s%s%s%s%s(vedere le opzioni di ambiente)"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Il tipo di antenato %s%s%s ha lo stesso nome%sdella unit %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
||
msgstr "Il tipo antenato %s%s%s non è un identificatore pascal valido."
|
||
|
||
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
||
msgstr "La classe %s%s%s è un TControl e può essere incollata solo su un controllo.%sImpossibile incollare."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
||
msgstr "In nome della classe %s%s%s e il tipo di antenato %s%s%s sono uguali."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
||
msgstr "In nome classe %s%s%s esiste già nel%sPacchetto %s%sFile: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
||
msgstr "Il nome classe %s%s%s è lo stesso%sdella unit %s%s%s. "
|
||
|
||
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Il nome classe %s%s%s non è un identificatore pascal valido."
|
||
|
||
#: lazarusidestrconsts:listhecodetoolsfoundanerror
|
||
msgid "The codetools found an error:%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
||
msgid "The command after %s%s%s is not executable."
|
||
msgstr "Il comando dopo %s%s%s non è eseguibile."
|
||
|
||
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s%s%s%s"
|
||
msgstr "Il comando dopo la pubblicazione non è valido:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
||
msgid "The compiler file \"%s\" is not an executable."
|
||
msgstr "Il file compilatore \"%s\" non è un eseguibile."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "Il file compilatore per il pacchetto %s non è un eseguibile valido:%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
||
msgstr "L'editor componente della classe %s%s%s%sinvocata con il verbo #%s %s%s%s%sha prodotto l'errore:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "La cartella dei sorgenti Free Pascal corrente %s%s%s%snon sembra corretta.%sControllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
||
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "La cartella sorgenti del Free Pascal corrente %s%s%snon sembra corretta.%sScegliere Ok per impostare la predefinita %s%s%s.%sAltrimenti controllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
||
msgstr "La cartella di Lazarus corrente %s%s%s%snon sembra corretta.%sSenza di essa non si sarà in grado di creare applicazioni LCL.%sControllare Ambiente -> Opzioni di ambiente -> file"
|
||
|
||
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
||
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "La cartella Lazarus corrente %s%s%s%snon sembra corretta.%sSenza di essa non si sarà in grado di creare applicazioni LCL.%sScegliere Ok per impostare la predefinita %s%s%s.%sAltrimenti controllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
||
msgstr "Il nome file del compilatore corrente %s%s%s%snon è un eseguibile valido.%sScegliere Ok per impostare il valore predefinito %s%s%s.%sAltrimenti controllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
|
||
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
||
msgstr "Il nome file del compilatore corrente %s%s%s%snon è un eseguibile valido.%sControllare Ambiente -> Opzioni di ambiente -> File"
|
||
|
||
#: lazarusidestrconsts:lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
||
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
||
msgstr "Il percorso della unit corrente per il file%s%s%s%s è%s%s%s%s.%s%sIl percorso per le unit LCL %s%s%s manca.%s%sSuggerimento per i principianti:%sCreate un'applicazione lazarus e mettete il file nella directory del progetto."
|
||
|
||
#: lazarusidestrconsts:lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
||
msgstr "Il debugger %s%s%s%snon esiste o non è eseguibile.%s%sVedere Ambiente -> Opzioni di debug"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Il file del debugger \"%s\" non è un eseguibile."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
||
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
||
msgstr "La dipendenza %s%s%s non è stata trovata.%sScegliere un pacchetto esistente."
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s%s%s%s does not exist."
|
||
msgstr "La directory di destinazione%s%s%s%s non esiste."
|
||
|
||
#: lazarusidestrconsts:listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "La directory %s%s%s non viene più utilizzata nel percorso delle unit.%s La togliamo?"
|
||
|
||
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
||
msgstr "La directory %s%s%s non è ancora presente nel percorso dei moduli. %La aggiungiamo?"
|
||
|
||
#: lazarusidestrconsts:dlgthedirectory
|
||
msgid "The directory \""
|
||
msgstr "La directory \""
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
||
msgstr "Il file %s sembra essere un programma o un progetto di Lazarus gi<67> esistente."
|
||
|
||
#: lazarusidestrconsts:listhefile
|
||
msgid "The file %s%s%s"
|
||
msgstr "Il file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
|
||
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s is already in the package."
|
||
msgstr "Il file %s%s%s è già nel pacchetto."
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
||
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
||
msgstr "Il file %s%s%s non è un progetto Delphi (.dpr)"
|
||
|
||
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
||
msgid "The file %s%s%s is not a Delphi unit."
|
||
msgstr "Il file %s%s%s non è una unit Delphi."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file %s%s%s is not a lazarus package."
|
||
msgstr "Il file %s%s%s non è un pacchetto lazarus."
|
||
|
||
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Il file %s%s%s è parte del progetto corrente.%sNon è consigliato condividere file tra progetti e pacchetti."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
||
msgid "The file %s%s%s%sis already in the package %s."
|
||
msgstr "Il file %s%s%s%sè già nel pacchetto %s."
|
||
|
||
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
||
msgstr "Il file %s%s%s%snon è attualmente nel percorso unit del pacchetto.%s%sAggiungere %s%s%s al percorso unit?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
||
msgid "The file %s%s%s%sof package %s is missing."
|
||
msgstr "File %s%s%s%sdel pacchetto %s mancante."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
||
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
||
msgstr "Il file %s%s%s%sdel pacchetto %s deve essere salvato prima."
|
||
|
||
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Il file %s%s%s%ssembra essere un programma. Chiudere il progetto corrente e creare un nuovo progetto Lazarus per questo programma?%s\"No\" caricherà il file come sorgente normale."
|
||
|
||
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
||
msgstr "Il file %s%s%s%sè stato trovato in una delle cartelle di sorgenti del pacchetto %s e sembra una unit compilata. Le unit compilate devono stare nella cartella dei risultati del pacchetto altrimenti altri pacchetti potrebbero avere dei problemi ad usare questo pacchetto.%s%sCancellare i file ambigui?"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
||
msgstr "Il file %s%s%s%snon è stato trovato.%sSi vuole cercarlo da soli?%s"
|
||
|
||
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Il file %s%s%s%snon è stato trovato.%sIgnora proseguirà nel caricamento del progetto, %sAnnulla bloccherà il caricamento."
|
||
|
||
#: lazarusidestrconsts:uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Il file \""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Il nome file %s%s%s è parte del progetto corrente.%sProgetti e pacchetti non devono condividere file."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
||
msgstr "Il nome del file %s%s%s è in uso dal%spacchetto %s%s%s%snel file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
||
msgstr "Il nome del file %s%s%s non corrisponde ad un nome pacchetto %s%s%s nel file.%sCambiare il nome del pacchetto in %s%s%s?"
|
||
|
||
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Il nome del file %s%s%s è ambiguo dato che il pacchetto non possiede ancora una cartella predefinita.%sSpecificare un nomefile con un percorso completo."
|
||
|
||
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Il seguente pacchetto non è stato caricato: "
|
||
|
||
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "I seguenti pacchetti non sono stati caricati:"
|
||
|
||
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
||
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application %s%s%s is not executable."
|
||
msgstr "L'applicazione host %s%s%s non è eseguibile"
|
||
|
||
#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
||
msgstr "L'applicazione di partenza %s%s%s%snon esiste o non è eseguibile.%s%sVedere Esegui -> parametri di esecuzione -> Locale"
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
||
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
||
msgstr "La directory di Lazarus \"%s\" non sembra corretta. Normalmente contiene delle directory come lcl,debugger, designer, components, ... ."
|
||
|
||
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
||
msgid "The make file \"%s\" is not an executable."
|
||
msgstr "Il file make \"%s\" non è eseguibile"
|
||
|
||
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La versione massima %s%s%s non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "La versione minima %s%s%s non è una versione di pacchetto valida.%s(un esempio valido è 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
||
msgid "The name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Il nome %s%s%s non è un identificatore pascal valido."
|
||
|
||
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid pascal identifier."
|
||
msgstr "Il nome \"%s\" non è un identificatore Pascal valido."
|
||
|
||
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryismissing
|
||
msgid "The output directory %s%s%s is missing."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
||
msgstr "Il pacchetto %s è un pacchetto di esecuzione solamente"
|
||
|
||
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Il pacchetto %s è a sola lettura."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Il pacchetto %s è richiesto da %s il quale è marcato per l'installazioen.%sVedere il grafico pacchetto."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
||
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
||
msgstr "A questo pacchetto %s appartiene il file%s%s%s%s.%sRinomina del file anche nel pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Il pacchetto %s%s%s non è stato compilato.%sLo rimuovo dalla lista delle installazioni? "
|
||
|
||
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
||
msgstr "Il pacchetto %s%s%s ha la flag di auto installazione.%sCiò significa che sarà installato nell'IDE. I pacchetti di installazione%sdevono essere pacchetti di progettazione."
|
||
|
||
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Il pacchetto %s%s%s è installato, ma non è stato trovato un file di pacchetto (.lpk) valido. %sÈ stato creato un finto pacchetto incompleto. "
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Il pacchetto %s%s%s è marcato per l'installazione ma non riesco a trovarlo.%sRimuovere la dipendenza dall'elenco installazione pacchetti?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Il pacchetto %s%s%s è stato marchiato per l'installazione.%sAttualmente lazarus supporta solo pacchetti con link statico. L'installazione reale ha bisogno di fare un rebuild e un riavvio di Lazarus.%s%sVuoi fare subito il rebuild di Lazarus?"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Il pacchetto %s%s%s è stato marcato.%sAttualmente lazarus supporta solo pacchetti con link statico. La vera disinstallazione necessita dell'operazione di build e della ripartenza di lazarus.%s%sVuoi fare subito un rebuild?"
|
||
|
||
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
||
msgstr "Il nome del pacchetto %s%s%s in%s%s%s%s non è un nome pacchetto lazarus valido."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package has already a dependency for the package %s%s%s."
|
||
msgstr "Il pacchetto possiede già una dipendenza per il pacchetto %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
||
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
||
msgstr "Il nome pacchetto %s%s%s non è valido.%sPrego scegliere un pacchetto esistente."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
||
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
||
msgstr "Il nome del pacchetto %s%s%s non è valido.%sScegliere un pacchetto esistente."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Il nome del pacchetto %s%s%s non è un nome di pacchetto valido%sScegliere un altro nome (per es. pacchetto1.lpk)"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
||
msgstr "Il nome del pacchetto %s%s%s del%sfile %s%s%s%s non è valido."
|
||
|
||
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name %s%s%s is too long (max 100 chars)."
|
||
msgstr "Il nome pagina %s%s%s è troppo lungo (max 100 caratteri)."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Il percorso al compilatore Free Pascal per questo progetto. Richiesto unicamente se è stato settato il sorgente FPC SVN sottostante . Utilizzato per ricreare le macro."
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Il percorso per il compilatore Free Pascal.%s Per esempio %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
||
msgstr "Il programma %smake%s non è stato trovato.%sQuesto strumento è necessario per il build di Lazarus.%s"
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package %s%s%s."
|
||
msgstr "Il progetto ha già una dipendenza per il pacchetto %s%s%s."
|
||
|
||
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
||
msgstr "Il file informazioni di progetto %s%s%s%sè uguale al file sorgente principale del progetto!"
|
||
|
||
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Il progetto deve essere salvato prima della build%sSe si imposta la directory di test nelle opzioni di ambiente,%sè possibile creare nuovi progetti e farne il build in una volta.%sSalvare il progetto? "
|
||
|
||
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Il progetto richiede il pacchetto %s%s%s.%sMa non è stato trovato, Vedere progetto -> Analizzatore progetti."
|
||
|
||
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
||
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "La resourcestring %s%s%s esiste già. %sScegliere un'altro nome. %sUsare Ignora per aggiungerlo comunque."
|
||
|
||
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
||
msgid "The root component can not be deleted."
|
||
msgstr "Il componente radice non può essere cancellato."
|
||
|
||
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
||
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
||
msgstr "La unit %s%s%s esiste già.%sIgnora forzerà il cambio nome,%sCancella cancellerà il salvataggio di questi sorgenti e%sAnnulla annullerà l'intero salvataggio."
|
||
|
||
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
||
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
||
msgstr "La unit %s%s%s non è minuscola.%sIl compilatore FreePascal 1.0.x necessita di nomi di file minuscoli. Se non si sta utilizzando fpc 1.0.x per compilare questa unit, ignorare questo messaggio.%s%sRinominare il file?"
|
||
|
||
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "La unit stessa ha gia il nome %s%s%s. Gli identificatori Pascal devono essere unici."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
||
msgstr "Il nome unit %s%s%s esiste già nel progetto%scon file: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
||
msgstr "Il nome unit %s%s%s esiste già nella selezione%scon file: %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name %s%s%s does not correspond to the filename."
|
||
msgstr "Il nome unit %s%s%s non corrisponde al nome file."
|
||
|
||
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
||
msgstr "Il nome unit %s%s%s non è un identificatore valido pascal."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Il nome della unit %s%s%s è lo stesso di un componente registrato.%sL'uso di questo può provocare messaggi di errore imprevedibili."
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
||
msgstr "Il nome della unit %s%s%s%s ed il nome del file %s%s%s sono differenti."
|
||
|
||
#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
||
msgstr "Il nome unit %s%s%s esiste già nel pacchetto:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname %s%s%s already exists in this package."
|
||
msgstr "In nome unit %s%s%s esiste già in questo pacchetto."
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
||
msgid "The unitname is not a valid pascal identifier."
|
||
msgstr "Il nome della unit non <20> un identificatore valido del pascal"
|
||
|
||
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgid "The unitname is used when the IDE extends uses clauses."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
||
msgid "There are more functions in the popupmenu"
|
||
msgstr "Ci sono più funzioni nel menu a scomparsa"
|
||
|
||
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "Ci sono altri file nella directory con lo stesso nome,%sche differiscono solamente per le maiuscole:%s%s%sVuoi cancellarli?"
|
||
|
||
#: lazarusidestrconsts:lisccoseveralcompilers
|
||
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
||
msgstr "Ci sono due unit con lo stesso nome:%s%s1. %s%s%s da %s%s2. %s%s%s da %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
||
msgstr "Esiste una unit FPC con lo stesso nome del pacchetto:%s%s%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
||
msgstr "Esiste una unit FPC con lo stesso nome di:%s%s%s%s%s da %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
||
msgid "There is a circle in the required packages. See package graph."
|
||
msgstr "C'è un riferimento circolare nel pacchetto richiesto. Vedere il grafo del pacchetto."
|
||
|
||
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
||
msgstr "Esiste un file con lo stesso nome e un'estensione simile su disco%sFile: %s%sFile ambiguo: %s%s%sCancellare il file ambiguo?"
|
||
|
||
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "C'è un massimo di %s strumenti."
|
||
|
||
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
||
msgstr "C'è già una unit con nome %s%s%s nel progetto.%sScegliere un altro nome."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
||
msgstr "Esiste una unit con lo stesso nome di un pacchetto:%s%s1. %s%s%s da %s%s2. %s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name %s%s%s"
|
||
msgstr "C'è già una form con il nome %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
||
msgstr "Esiste già un pacchetto %s%s%s caricato%sdal file %s%s%s.%sVedere Componenti -> Grafico pacchetto.%sRimpiazzarlo è impossibile."
|
||
|
||
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
||
msgstr "C'è già una unit con il nome %s%s%s. Gli identificativi Pascal devono essere unici."
|
||
|
||
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Esiste gi<67> una unit con questo nome.%sFile: %s"
|
||
|
||
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
||
msgid "There is already another component with the name %s%s%s."
|
||
msgstr "Esiste gi<67> un altro componente con il nome %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
||
msgstr "C'è già un altro pacchetto con il nome %s%s%s.%sConflitto con pacchetto. %s%s%s%sFile: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "C'è un pacchetto non salvato nei pacchetti richiesti. Vedere il grafico pacchetti."
|
||
|
||
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Non è stato specificato un debugger. %s Il settaggio dei segnalibri non avrà alcun effetto fino a quando non scegli un Debugger nella finestra di dialogo delle opzioni di debugger nel menu."
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "C'è stato un errore durante la scrittura del componente selezionato %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "C'è stato un errore durante la conversione dello stream binario del componente selezionato %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "C'è stato un errore durante la copia dello stream del componente sugli appunti:%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Questo file non è presente in nessun pacchetto caricato."
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
||
msgid "This file was automatically created by Lazarus. Do not edit!"
|
||
msgstr "Questo file è stato creato automaticamente da Lazarus. Da non modificare!"
|
||
|
||
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Questo è un pacchetto virtuale. Non ha ancora sorgente. Salvare prima il pacchetto."
|
||
|
||
#: lazarusidestrconsts:lisresourcefilecomment
|
||
msgid "This is an automatically generated lazarus resource file"
|
||
msgstr "Questo è un file risorse generato automaticamente da Lazarus"
|
||
|
||
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Questo è il pacchetto predefinito. Usato solo per componenti senza un pacchetto. Questi componenti sono obsoleti."
|
||
|
||
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Questo sembra un file pascal. %sSi raccomanda di utilizzare il minuscolo per i nomi dei file per evitra diversi problemi in alcuni filesystem e compilatori diversi. %sRinominare in minuscolo?"
|
||
|
||
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Il pacchetto è installato, tuttavia il file lpk non è stato trovato. Tutti i suoi componenti sono stati disattivati. Pregasi risolvere il problema."
|
||
|
||
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
||
msgid "This source is only used to compile and install the package."
|
||
msgstr "Questo sorgente viene usato solo per compilare ed installare il pacchetto."
|
||
|
||
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Questo comando non può essere estratto.%sSelezionare del codice per estrarre una nuova procedura/metodo."
|
||
|
||
#: lazarusidestrconsts:listhiswillhappencontinue
|
||
msgid "This will happen:%s%s%sContinue?"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Thread"
|
||
|
||
#: lazarusidestrconsts:listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Sono richiesti un titolo ed un nome file"
|
||
|
||
#: lazarusidestrconsts:dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Titolo:"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtodolist
|
||
msgid "ToDo List"
|
||
msgstr "Elenco ToDo"
|
||
|
||
#: lazarusidestrconsts:listodolistoptions
|
||
msgid "ToDo options..."
|
||
msgstr "Opzioni todo..."
|
||
|
||
#: lazarusidestrconsts:lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Cambia da form a unit"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Cambia modalità"
|
||
|
||
#: lazarusidestrconsts:liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Passa tra Unit e Form"
|
||
|
||
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
||
msgid "Toggle form/unit view"
|
||
msgstr "Abilita/disabilita viste form/unit"
|
||
|
||
#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
|
||
msgid "Toggle view Breakpoints"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcallstack
|
||
msgid "Toggle view Call Stack"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
|
||
msgid "Toggle view Debugger Output"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
|
||
msgid "Toggle view Local Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewwatches
|
||
msgid "Toggle view Watches"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
|
||
msgid "Toggle view component palette"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Token:"
|
||
|
||
#: lazarusidestrconsts:lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Strumenti"
|
||
|
||
#: lazarusidestrconsts:srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Comandi per il menu strumenti"
|
||
|
||
#: lazarusidestrconsts:dlgtooltipeval
|
||
msgid "Tooltip expression evaluation"
|
||
msgstr "Suggerimenti sulle valutazioni delle espressioni"
|
||
|
||
#: lazarusidestrconsts:dlgtooltiptools
|
||
msgid "Tooltip symbol Tools"
|
||
msgstr "Suggerimenti sugli strumenti simboli"
|
||
|
||
#: lazarusidestrconsts:listop
|
||
msgid "Top"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Ancoraggio superiore"
|
||
|
||
#: lazarusidestrconsts:listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Spazia in cima equidistante"
|
||
|
||
#: lazarusidestrconsts:dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Cima:"
|
||
|
||
#: lazarusidestrconsts:listops
|
||
msgid "Tops"
|
||
msgstr "Cime"
|
||
|
||
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Elimina gli spazi oltre le righe"
|
||
|
||
#: lazarusidestrconsts:listurbopascal
|
||
msgid "Turbo Pascal"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Tutorial"
|
||
|
||
#: lazarusidestrconsts:dlgenvtype
|
||
msgid "Type"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts:lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Tipo"
|
||
|
||
#: lazarusidestrconsts:liscetypes
|
||
msgid "Types"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "MAIUSCOLO"
|
||
|
||
#: lazarusidestrconsts:rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Ucraino"
|
||
|
||
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Impossibile convertire lo stream binario in testo"
|
||
|
||
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Impossibile copiare i componenti negli appunti"
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Impossibile aggiungere %s al progetto, dato che c'è già una unit con lo stesso nome nel progetto."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossibile aggiungere la risorsa T%s:FORMDATA al file risorse %s%s%s%s.%sÈ probabilmente un errore di sintassi."
|
||
|
||
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
||
msgstr "Impossibile aggiungere un commento intestazione risorse ad un file risorse %s%s%s%s%sÈ probabilmente un errore di sintassi."
|
||
|
||
#: lazarusidestrconsts:lisunabletobackupfileto
|
||
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
||
msgstr "Impossibile backup del file %s%s%s in %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Impossibile cambiare l'elenco form create automaticamente nei sorgenti del programma.%s Correggere prima gli errori."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
||
msgstr "Impossibile pulire %s%s%s.%sControllare i permessi."
|
||
|
||
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Impossibile pulire la directory di destinazione"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Impossibile convertire il testo del componente in formato binario:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
||
msgid "Unable to convert file %s%s%s%sError: %s"
|
||
msgstr "Impossibile convertire il file %s%s%s%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
||
msgid "Unable to convert lfm to lrs and write lrs file."
|
||
msgstr "Impossibile convertire lfm in lrs e scrivere un file lrs."
|
||
|
||
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
||
msgstr "Impossibile convertire dati di form testo del file %s%s%s%s%sin formato di stream binario. (%s)"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Impossibile copiare il file"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossibile copiare il file %s%s%s%sin %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocopyfileto2
|
||
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossibile copiare il file %s%s%s%ssu %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test pascal file \"%s\"."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory %s%s%s."
|
||
msgstr "Impossibile creare una directory di backup %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Impossibile creare la directory"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
||
msgid "Unable to create directory %s%s%s"
|
||
msgstr "Impossibile creare la cartella %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatedirectory
|
||
msgid "Unable to create directory %s%s%s."
|
||
msgstr "Impossibile creare la directory %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Impossibile creare il file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile2
|
||
msgid "Unable to create file %s%s%s"
|
||
msgstr "Impossibile creare il file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefilename
|
||
msgid "Unable to create file %s%s%s."
|
||
msgstr "Impossibile creare il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatefile3
|
||
msgid "Unable to create file%s%s%s%s"
|
||
msgstr "Impossibile creare il file%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link %s%s%s with target %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
|
||
msgid "Unable to create new method. Please fix the error shown in the message window."
|
||
msgstr "Impossibile creare un nuovo metodo. Correggere l'errore mostrato nella finestra messaggi."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
||
msgstr "Impossibile creare la directory del risultato %s%s%s%sper il pacchetto %s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
||
msgstr "Impossibile creare la directory dei sorgenti del pacchetto %s%s%s%sper il pacchetto %s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
||
msgstr "Impossibile creare la directory oggetto per lazarus:%s%s%s%s.%sQuesta directory è necessaria per il nuovo IDE lazarus modificato con i pacchetti personalizzati."
|
||
|
||
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Impossibile creare un buffer temporaneo lfm."
|
||
|
||
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file %s%s%s"
|
||
msgstr "Impossibile cancellare il file ambiguo %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Impossibile cancellare il file"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file %s%s%s."
|
||
msgstr "Impossibile cancellare il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
||
msgstr "Impossibile cancellare il vecchio file di stato %s%s%s%sper il pacchetto %s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Impossibile trovare %s nello stream LFM."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Impossibile trovare una sezione ResourceString nè in questa nè in nessun'altra delle unit usate."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in %s%s%s"
|
||
msgstr "Impossibile trovare un nome classe valido in %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfile
|
||
msgid "Unable to find file %s%s%s."
|
||
msgstr "Impossibile trovare il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to find method. Please fix the error shown in the message window."
|
||
msgstr "Impossibile trovare il metodo. Correggere l'errore mostrato nella finestra messaggi."
|
||
|
||
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
|
||
msgid "Unable to find the unit of component class %s%s%s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Impossibile raccogliere i cambiamenti dell'editor."
|
||
|
||
#: lazarusidestrconsts:lisccounabletogetfiledate
|
||
msgid "Unable to get file date of %s."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Impossibile ottenere il sorgente per il designer."
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Impossibile caricare il file"
|
||
|
||
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
||
msgid "Unable to load file %s%s%s."
|
||
msgstr "Impossibile caricare il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
||
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
||
msgstr "Impossibile caricare file di risorse vecchio.%sIl file di risorse è il primo file include nella%ssezione di inizializzazione.%sPer esempio {$I %s.lrs}.%sÈ probabilmente un errore di sintassi."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Impossibile caricare il file"
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadpackage
|
||
msgid "Unable to load package %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
||
msgstr "Non riesco ad aprire il pacchetto %s%s%s.%sIl pacchetto è stato marcato per l'installazione."
|
||
|
||
#: lazarusidestrconsts:lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Impossibile leggere il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfile2
|
||
msgid "Unable to read file %s%s%s!"
|
||
msgstr "Impossibile leggere il file %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfileerror
|
||
msgid "Unable to read file %s%s%s%sError: %s"
|
||
msgstr "Impossibile leggere il file %s%s%s%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoreadfilename
|
||
msgid "Unable to read file %s%s%s."
|
||
msgstr "Impossibile leggere il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file %s%s%s.%sError: %s"
|
||
msgstr "Non riesco a leggere il file del pacchetto %s%s%s.%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Non riesco a leggere lo stato del file %s del progetto %s%s Errore: %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossibile leggere il file stato %s%s%s%sdel pacchetto %s.%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file %s%s%s!"
|
||
msgstr "Impossibile rimuovere il vecchio file di backup %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
||
msgstr "Impossibile rinominare il file ambiguo %s%s%s in %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Impossibile rinominare il file"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto
|
||
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
||
msgstr "Impossibile rinominare il file %s%s%s in %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamefileto2
|
||
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
||
msgstr "Impossibile rinominare il file %s%s%s%sin %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Impossibile rinominare form nel sorgente."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Impossibile rinominare il metodo. Correggere l'errore mostrato nella finestra messaggi."
|
||
|
||
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Impossibile rinominare variabile nel sorgente."
|
||
|
||
#: lazarusidestrconsts:lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
||
msgid "Unable to run the tool %s%s%s:%s%s"
|
||
msgstr "Impossibile eseguire lo strumento %s%s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosavefile
|
||
msgid "Unable to save file %s%s%s"
|
||
msgstr "Impossibile salvare il file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
||
msgid "Unable to show method. Please fix the error shown in the message window."
|
||
msgstr "Impossibile mostrare il metodo. Correggere l'errore mostrato nella finestra messaggi."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Impossibile fare lo streaming %s:T%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Impossibile fare uno stream dei componenti selezionati"
|
||
|
||
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Impossibile fare uno stream dei componenti selezionati."
|
||
|
||
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Impossibile trasformare lo stream componente binario di %s:T%s in testo."
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Impossibile aggiornare il comando CreateForm nel sorgente del progetto"
|
||
|
||
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
|
||
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite2
|
||
msgid "Unable to write %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisunabletowrite
|
||
msgid "Unable to write %s%s%s%s%s."
|
||
msgstr "Impossibile scrivere %s%s%s%s%s."
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Impossibile scrivere il file"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefile2
|
||
msgid "Unable to write file %s%s%s"
|
||
msgstr "Impossibile scrivere sul file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefileerror
|
||
msgid "Unable to write file %s%s%s%sError: %s"
|
||
msgstr "Impossibile scrivere il file %s%s%s%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritefilename
|
||
msgid "Unable to write file %s%s%s."
|
||
msgstr "Impossibile scrivere il file %s%s%s."
|
||
|
||
#: lazarusidestrconsts:lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
||
msgstr "Impossibile scrivere il pacchetto %s%s%ssul file %s%s%s.%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
||
msgstr "Impossibile scrivere il file stato %s%s%s%sdel pacchetto %s.%sErrore: %s"
|
||
|
||
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Non riesco a scrivere lo stato del progetto %s%s Errore: %s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile2
|
||
msgid "Unable to write to file %s%s%s"
|
||
msgstr "Impossibile scrivere su file %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritetofile
|
||
msgid "Unable to write to file %s%s%s!"
|
||
msgstr "Impossibile scrivere sul file %s%s%s!"
|
||
|
||
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlguncertopt
|
||
msgid "Uncertain Optimizations"
|
||
msgstr "Ottimizzazioni incerte"
|
||
|
||
#: lazarusidestrconsts:lismenuuncommentselection
|
||
msgid "Uncomment selection"
|
||
msgstr "De-commenta la selezione"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Undefine"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Undefine a tutto"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Undefine ricorsivamente"
|
||
|
||
#: lazarusidestrconsts:dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Sottolineato"
|
||
|
||
#: lazarusidestrconsts:lismenuundo
|
||
msgid "Undo"
|
||
msgstr "Annulla"
|
||
|
||
#: lazarusidestrconsts:dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Annulla dopo il salvataggio"
|
||
|
||
#: lazarusidestrconsts:dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Limite dell'Undo"
|
||
|
||
#: lazarusidestrconsts:srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Deindenta blocco"
|
||
|
||
#: lazarusidestrconsts:lismenuunindentselection
|
||
msgid "Unindent selection"
|
||
msgstr "De-indenta selezione"
|
||
|
||
#: lazarusidestrconsts:lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Disinstalla"
|
||
|
||
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start"
|
||
msgstr "Disinstalla alla prossima partenza"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Disinstallare pacchetto %s?"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Disinstallare pacchetto?"
|
||
|
||
#: lazarusidestrconsts:lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Disinstalla la selezione"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypeunit
|
||
msgid "Unit"
|
||
msgstr "Unit"
|
||
|
||
#: lazarusidestrconsts:lisunithaschangedsave
|
||
msgid "Unit %s%s%s has changed. Save?"
|
||
msgstr "La unit %s%s%s è cambiata. Salvarla?"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
||
msgid "Unit %s%s%s was removed from package"
|
||
msgstr "La unit %s%s%s è stata rimossa dal pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Nome file unit:"
|
||
|
||
#: lazarusidestrconsts:uemshowunitinfo
|
||
msgid "Unit Info"
|
||
msgstr "Informazioni unit"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Nome unit non valido"
|
||
|
||
#: lazarusidestrconsts:lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Nome unit:"
|
||
|
||
#: lazarusidestrconsts:lisaf2punitname
|
||
msgid "Unit Name: "
|
||
msgstr "Nome unit:"
|
||
|
||
#: lazarusidestrconsts:lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Cartella risultati unit"
|
||
|
||
#: lazarusidestrconsts:lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Percorso unit"
|
||
|
||
#: lazarusidestrconsts:dlgcounitstyle
|
||
msgid "Unit Style:"
|
||
msgstr "Stile unit"
|
||
|
||
#: lazarusidestrconsts:dlgunitdepcaption
|
||
msgid "Unit dependencies"
|
||
msgstr "Dipendenze unit"
|
||
|
||
#: lazarusidestrconsts:lisa2punitfilename
|
||
msgid "Unit file name:"
|
||
msgstr "Nome file unit:"
|
||
|
||
#: lazarusidestrconsts:lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Esiste l'identificatore della unit"
|
||
|
||
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Il nome unit esiste già"
|
||
|
||
#: lazarusidestrconsts:lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Il nome della Unit inizia con ..."
|
||
|
||
#: lazarusidestrconsts:lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Il nome della Unit contiene ..."
|
||
|
||
#: lazarusidestrconsts:lisunitnotfound
|
||
msgid "Unit not found"
|
||
msgstr "Unit non trovata"
|
||
|
||
#: lazarusidestrconsts:lispkgsysunitnotfound
|
||
msgid "Unit not found: %s%s%s"
|
||
msgstr "Unit non trovata: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Directory di output delle Unit (-FU):"
|
||
|
||
#: lazarusidestrconsts:lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Path di ricerca delle Unit"
|
||
|
||
#: lazarusidestrconsts:lisunitlfmfile
|
||
msgid "Unit: %s%sLFM file: %s"
|
||
msgstr "Unit: %s%sFile LFM: %s"
|
||
|
||
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Il nome unit esiste già"
|
||
|
||
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Nome unit già nel progetto"
|
||
|
||
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Il nome della Unit e del file non corrispondono.%sEsempio: unit1.pas e Unit1"
|
||
|
||
#: lazarusidestrconsts:lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Nome della Unit:"
|
||
|
||
#: lazarusidestrconsts:lisunitsnotfound2
|
||
msgid "Units not found"
|
||
msgstr "Units non trovate"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunits
|
||
msgid "Units..."
|
||
msgstr "Unit..."
|
||
|
||
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Pacchetto non salvato"
|
||
|
||
#: lazarusidestrconsts:dlgupword
|
||
msgid "Up"
|
||
msgstr "Su"
|
||
|
||
#: lazarusidestrconsts:lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Aggiorna"
|
||
|
||
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
||
msgid "Update/Rebuild"
|
||
msgstr "Aggiorna/Rebuild"
|
||
|
||
#: lazarusidestrconsts:lismenuuppercaseselection
|
||
msgid "Uppercase selection"
|
||
msgstr "Selezione in maiuscolo"
|
||
|
||
#: lazarusidestrconsts:lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Uso"
|
||
|
||
#: lazarusidestrconsts:dlgcoansistr
|
||
msgid "Use Ansi Strings"
|
||
msgstr "Usa stringhe Ansi"
|
||
|
||
#: lazarusidestrconsts:dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging (darwin only)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuseexcludefilter
|
||
msgid "Use Exclude Filter"
|
||
msgstr "Utilizza il filtro di esclusione"
|
||
|
||
#: lazarusidestrconsts:dlgcoheaptrc
|
||
msgid "Use Heaptrc Unit"
|
||
msgstr "Usa la unit heaptrc"
|
||
|
||
#: lazarusidestrconsts:lisuseincludefilter
|
||
msgid "Use Include Filter"
|
||
msgstr "Utilizza il filtro di inclusione"
|
||
|
||
#: lazarusidestrconsts:dlgusecustomconfig
|
||
msgid "Use addional Compiler Config File"
|
||
msgstr "Usa file di configurazione compilatore aggiuntivo"
|
||
|
||
#: lazarusidestrconsts:dlgedusedefcolor
|
||
msgid "Use default color"
|
||
msgstr "Usa colore predefinito"
|
||
|
||
#: lazarusidestrconsts:dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Usa DISPLAY"
|
||
|
||
#: lazarusidestrconsts:dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Usa applicazione di lancio"
|
||
|
||
#: lazarusidestrconsts:dlgpousemanifest
|
||
msgid "Use manifest file to enable themes (windows only)"
|
||
msgstr "Usa il file manifest per abilitare i temi (solo Windows)"
|
||
|
||
#: lazarusidestrconsts:dlgusefpccfg
|
||
msgid "Use standard Compiler Config File (fpc.cfg)"
|
||
msgstr "Usa file di configurazione compilatore standard (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Usa la sintassi evidenziata"
|
||
|
||
#: lazarusidestrconsts:lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Usa unit"
|
||
|
||
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
||
msgid "Use windowmanager setting"
|
||
msgstr "Usa le impostazioni del windowmanager"
|
||
|
||
#: lazarusidestrconsts:lisplduser
|
||
msgid "User"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecuserfirst
|
||
msgid "User First"
|
||
msgstr "Prima l'utente"
|
||
|
||
#: lazarusidestrconsts:dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Estensione definita dall'utente"
|
||
|
||
#: lazarusidestrconsts:dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Estensione definita dall'utente (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts:dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Le impostazioni utente vincono"
|
||
|
||
#: lazarusidestrconsts:lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisceuses
|
||
msgid "Uses"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgvaluecolor
|
||
msgid "Value"
|
||
msgstr "Valore"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Valore come percorso di file"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Valore testo"
|
||
|
||
#: lazarusidestrconsts:dlgrunovariable
|
||
msgid "Variable"
|
||
msgstr "Variabile"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Nome variabile"
|
||
|
||
#: lazarusidestrconsts:dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Prefisso variabile"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Variabile:"
|
||
|
||
#: lazarusidestrconsts:lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Variabile: %s"
|
||
|
||
#: lazarusidestrconsts:liscevariables
|
||
msgid "Variables"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Livello dei dettagli mostrati durante la compilazione:"
|
||
|
||
#: lazarusidestrconsts:lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisversion
|
||
msgid "Version"
|
||
msgstr "Versione"
|
||
|
||
#: lazarusidestrconsts:versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Informazioni sulla versione"
|
||
|
||
#: lazarusidestrconsts:rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsversion
|
||
msgid "Version:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Verticale"
|
||
|
||
#: lazarusidestrconsts:dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Ampiezza passo verticale della griglia"
|
||
|
||
#: lazarusidestrconsts:lismenuviewanchoreditor
|
||
msgid "View Anchor Editor"
|
||
msgstr "mostra editor àncore"
|
||
|
||
#: lazarusidestrconsts:uemviewcallstack
|
||
msgid "View Call Stack"
|
||
msgstr "Mostra lo stack delle chiamate"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Mostra l'esplorer del codice"
|
||
|
||
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
||
msgid "View Component Palette"
|
||
msgstr "Visualizza la palette dei componenti"
|
||
|
||
#: lazarusidestrconsts:srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Visualizza l'editor della Documentazione"
|
||
|
||
#: lazarusidestrconsts:lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Vista form"
|
||
|
||
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Visualizza gli speed buttons dell'IDE"
|
||
|
||
#: lazarusidestrconsts:lismenuviewjumphistory
|
||
msgid "View Jump-History ..."
|
||
msgstr "Visualizza storico salti ..."
|
||
|
||
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Mostra l'analizzatore oggetti"
|
||
|
||
#: lazarusidestrconsts:lispckeditviewpackgesource
|
||
msgid "View Package Source"
|
||
msgstr "Mostra sorgente del pacchetto"
|
||
|
||
#: lazarusidestrconsts:lisviewprojectunits
|
||
msgid "View Project Units"
|
||
msgstr "Mostra unit del progetto"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Mostra risultati della ricerca"
|
||
|
||
#: lazarusidestrconsts:lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Visualizza il sorgente (.lfm)"
|
||
|
||
#: lazarusidestrconsts:srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Mostra l'editor dei sorgenti"
|
||
|
||
#: lazarusidestrconsts:lispeviewtodolist
|
||
msgid "View ToDo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitdependencies
|
||
msgid "View Unit Dependencies"
|
||
msgstr "Visualizza dipendenze unit"
|
||
|
||
#: lazarusidestrconsts:liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Visualizza le informazioni sulla Unit"
|
||
|
||
#: lazarusidestrconsts:lismenuviewunitinfo
|
||
msgid "View Unit Information"
|
||
msgstr "Mostra informazioni sulla unit"
|
||
|
||
#: lazarusidestrconsts:lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Vista unit"
|
||
|
||
#: lazarusidestrconsts:srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Mostra editor delle àncore"
|
||
|
||
#: lazarusidestrconsts:srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Mostra i breakpoint"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Mostra lo stack chiamate"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Visualizza il code browser"
|
||
|
||
#: lazarusidestrconsts:srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Visualizza la palette dei componenti"
|
||
|
||
#: lazarusidestrconsts:srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Mostra il risultato del debugger"
|
||
|
||
#: lazarusidestrconsts:srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Mostra le form"
|
||
|
||
#: lazarusidestrconsts:liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Mostra le variabili locali"
|
||
|
||
#: lazarusidestrconsts:srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Comandi per il menu visualizza"
|
||
|
||
#: lazarusidestrconsts:srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Mostra i messaggi"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewforms
|
||
msgid "View project forms"
|
||
msgstr "Visualizza le form del progetto"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewframes
|
||
msgid "View project frames"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Visualizza le opzioni del progetto"
|
||
|
||
#: lazarusidestrconsts:liskmviewprojectsource
|
||
msgid "View project source"
|
||
msgstr "Visualizza il sorgente del progetto"
|
||
|
||
#: lazarusidestrconsts:dlgmainviewunits
|
||
msgid "View project units"
|
||
msgstr "Visualizza le unit del progetto"
|
||
|
||
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewtodolist
|
||
msgid "View todo list"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Mostra le dipendenze delle unit"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Mostra le informazioni sulle unit"
|
||
|
||
#: lazarusidestrconsts:srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Mostra le unit"
|
||
|
||
#: lazarusidestrconsts:srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Mostra i watch"
|
||
|
||
#: lazarusidestrconsts:lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Visualizzatori"
|
||
|
||
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Unit virtuale"
|
||
|
||
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
||
msgid "Virtual unit (source is not in package)"
|
||
msgstr "Unit virtuale (il sorgente non è nel pacchetto)"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Spaziatura laterale visibile"
|
||
|
||
#: lazarusidestrconsts:dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Margine destro visibile"
|
||
|
||
#: lazarusidestrconsts:lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Avverti prima di compilare"
|
||
|
||
#: lazarusidestrconsts:lisccowarningcaption
|
||
msgid "Warning"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Attenzione: il file aggiuntivo di configurazione del compilatore ha lo stesso nome di un file di configurazione standard ricercato dal compilatore Free Pascal. Ciò comporta l'analisi del SOLO file di configurazione aggiuntivo invece di quello standard."
|
||
|
||
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
||
msgstr "Attenzione: il file %s%s%s%sappartiene al progetto corrente."
|
||
|
||
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
||
msgstr "Attenzione: trovato file ambiguo: %s%s%s. Il file sorgente è: %s%s%s"
|
||
|
||
#: lazarusidestrconsts:lisinfobuildwarning
|
||
msgid "Warnings:"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswlwatchlist
|
||
msgid "Watch list"
|
||
msgstr "Elenco delle viste di Watch"
|
||
|
||
#: lazarusidestrconsts:lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Viste di watch"
|
||
|
||
#: lazarusidestrconsts:dlgautocreatenewforms
|
||
msgid "When creating new forms, add them to auto-created forms"
|
||
msgstr "Durante la creazione di nuove form, aggiungile alle form auto-create"
|
||
|
||
#: lazarusidestrconsts:lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Durante lo switch dei file nell'editor dei sorgenti"
|
||
|
||
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor ..."
|
||
msgstr "Quando questo file <20> attivo nell'editor dei sorgenti ..."
|
||
|
||
#: lazarusidestrconsts:lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Dove"
|
||
|
||
#: lazarusidestrconsts:dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Ampiezza:"
|
||
|
||
#: lazarusidestrconsts:dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgwindow
|
||
msgid "Window"
|
||
msgstr "Finestra"
|
||
|
||
#: lazarusidestrconsts:dlgwinpos
|
||
msgid "Window Positions"
|
||
msgstr "Posizioni della finestra"
|
||
|
||
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
||
msgid "With packages"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "Con i Pacchetti richiesti"
|
||
|
||
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Parola al cursore nell'editor corrente"
|
||
|
||
#: lazarusidestrconsts:srkmecwordcompletion
|
||
msgid "Word completion"
|
||
msgstr "Completamento parole"
|
||
|
||
#: lazarusidestrconsts:dlgwordspolicies
|
||
msgid "Words"
|
||
msgstr "Parole"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
|
||
msgid "Working Directory (Leave empty for file path)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Directory di lavoro:"
|
||
|
||
#: lazarusidestrconsts:dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Directory di lavoro"
|
||
|
||
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (Leave empty for file path)"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Directory di lavoro per l'esecuzione"
|
||
|
||
#: lazarusidestrconsts:liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Errore di scrittura"
|
||
|
||
#: lazarusidestrconsts:dlgwritefpclogo
|
||
msgid "Write an FPC logo"
|
||
msgstr "Scrivi un logo FPC"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Errore di scrittura"
|
||
|
||
#: lazarusidestrconsts:liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Scrivi il prefisso"
|
||
|
||
#: lazarusidestrconsts:lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisxmlfiles
|
||
msgid "XML files"
|
||
msgstr "Files XML"
|
||
|
||
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You can not build lazarus while debugging or compiling."
|
||
msgstr "Impossibile fare una build di lazarus durante un debug o una compilazione."
|
||
|
||
#: lazarusidestrconsts:dlgdoesnotexist
|
||
msgid "\" does not exist."
|
||
msgstr "\" non esiste."
|
||
|
||
#: lazarusidestrconsts:uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" non è scrivibile."
|
||
|
||
#: lazarusidestrconsts:lisexttooltitlecompleted
|
||
msgid "\"%s\" completed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "annullamento build"
|
||
|
||
#: lazarusidestrconsts:srkmecaddbreakpoint
|
||
msgid "add break point"
|
||
msgstr "aggiungi un break point"
|
||
|
||
#: lazarusidestrconsts:srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "aggiungi watch"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "auto installato dinamico"
|
||
|
||
#: lazarusidestrconsts:lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "auto installato statico"
|
||
|
||
#: lazarusidestrconsts:lisbegins
|
||
msgid "begins"
|
||
msgstr "inizia"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildall
|
||
msgid "build all files of program/project"
|
||
msgstr "esegui build di tutti i file del programma/progetto"
|
||
|
||
#: lazarusidestrconsts:srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "esegui build del file"
|
||
|
||
#: lazarusidestrconsts:srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "esegui build del programma/progetto"
|
||
|
||
#: lazarusidestrconsts:dlglefttopclr
|
||
msgid "color for left, top"
|
||
msgstr "colore per sinistra, cima"
|
||
|
||
#: lazarusidestrconsts:dlgrightbottomclr
|
||
msgid "color for right, bottom"
|
||
msgstr "colore per destra, fondo"
|
||
|
||
#: lazarusidestrconsts:lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmeccompileroptions
|
||
msgid "compiler options"
|
||
msgstr "opzioni compilatore"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
||
msgid "compiler path"
|
||
msgstr "percorso del compilatore"
|
||
|
||
#: lazarusidestrconsts:srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "file di configurazione di build"
|
||
|
||
#: lazarusidestrconsts:liscontains
|
||
msgid "contains"
|
||
msgstr "contiene"
|
||
|
||
#: lazarusidestrconsts:lisccocontains
|
||
msgid "contains "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "opzioni personalizzate"
|
||
|
||
#: lazarusidestrconsts:liscodefault
|
||
msgid "default (%s)"
|
||
msgstr "predefinito (%s)"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
|
||
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "valuta/modifica"
|
||
|
||
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "file, dove viene scritto l'output di debug. Se non viene specificato, l'output di debug viene scritto sulla console."
|
||
|
||
#: lazarusidestrconsts:lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
|
||
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidinproject
|
||
msgid "in Project:"
|
||
msgstr "In progetto:"
|
||
|
||
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "in tutti i pacchetti e i progetti aperti"
|
||
|
||
#: lazarusidestrconsts:lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "nella unit corrente"
|
||
|
||
#: lazarusidestrconsts:lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "nel progetto principale"
|
||
|
||
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "nel progetto/pacchetto a cui appartiene la unit corrente"
|
||
|
||
#: lazarusidestrconsts:lisincludepath
|
||
msgid "include path"
|
||
msgstr "percorso di inclusione"
|
||
|
||
#: lazarusidestrconsts:srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "analizza"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "installato dinamico"
|
||
|
||
#: lazarusidestrconsts:lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "installato statico"
|
||
|
||
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "nome file compilatore non valido"
|
||
|
||
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [opzioni] <nomefile-progetto>"
|
||
|
||
#: lazarusidestrconsts:lislibrarypath
|
||
msgid "library path"
|
||
msgstr "percorso libreria"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "opzioni compilatore"
|
||
|
||
#: lazarusidestrconsts:dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "minuscolo"
|
||
|
||
#: lazarusidestrconsts:lisprojectmacrounitpath
|
||
msgid "macro ProjectUnitPath"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisoipmissing
|
||
msgid "missing"
|
||
msgstr "mancante"
|
||
|
||
#: lazarusidestrconsts:lisoipmodified
|
||
msgid "modified"
|
||
msgstr "modificato"
|
||
|
||
#: lazarusidestrconsts:lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnew
|
||
msgid "new"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidno
|
||
msgid "no"
|
||
msgstr "no"
|
||
|
||
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
||
msgid "no automatic renaming"
|
||
msgstr "nessuna rinomina automatica"
|
||
|
||
#: lazarusidestrconsts:lisccdnoclass
|
||
msgid "no class"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisnoname
|
||
msgid "noname"
|
||
msgstr "senzanome"
|
||
|
||
#: lazarusidestrconsts:lisnone2
|
||
msgid "none"
|
||
msgstr "nessuno"
|
||
|
||
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "nessuna selezionata"
|
||
|
||
#: lazarusidestrconsts:lisobjectpath
|
||
msgid "object path"
|
||
msgstr "percorso oggetto"
|
||
|
||
#: lazarusidestrconsts:lisold
|
||
msgid "old"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisor
|
||
msgid "or"
|
||
msgstr "oppure"
|
||
|
||
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "pacchetto %s non salvato"
|
||
|
||
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "file sorgente principale del pacchetto"
|
||
|
||
#: lazarusidestrconsts:srkmecpause
|
||
msgid "pause program"
|
||
msgstr "poni in pausa il programma"
|
||
|
||
#: lazarusidestrconsts:lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "prego selezionare una macro"
|
||
|
||
#: lazarusidestrconsts:lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "directory di configurazione primaria, dove Lazarus salva i suoi file di configurazione. Per default è "
|
||
|
||
#: lazarusidestrconsts:srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "compilazione veloce, senza linking"
|
||
|
||
#: lazarusidestrconsts:lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "solalettura"
|
||
|
||
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
|
||
msgid "relative unit path found in fpc cfg: %s"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisremove
|
||
msgid "remove"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:srkmecremovebreakpoint
|
||
msgid "remove break point"
|
||
msgstr "elimina break point"
|
||
|
||
#: lazarusidestrconsts:srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "reimposta debugger"
|
||
|
||
#: lazarusidestrconsts:srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "file di esecuzione"
|
||
|
||
#: lazarusidestrconsts:srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "parametri di esecuzione"
|
||
|
||
#: lazarusidestrconsts:srkmecrun
|
||
msgid "run program"
|
||
msgstr "programma di esecuzione"
|
||
|
||
#: lazarusidestrconsts:lissaveallmodified
|
||
msgid "save all modified files"
|
||
msgstr "salva tutti i file modificati"
|
||
|
||
#: lazarusidestrconsts:lissavecurrenteditorfile
|
||
msgid "save current editor file"
|
||
msgstr "salva file dell'editor corrente"
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:dlgtimesecondunit
|
||
msgid "sec"
|
||
msgstr "sec"
|
||
|
||
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "directory di configurazione secondaria, dove Lazarus cerca i modelli di file di configurazione. Per default è "
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "imposta modalità FPC a Delphi"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "imposta modalità FPC a GPC"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "imposta modalità FPC a TP"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "imposta IOCHECKS abilitati"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "imposta OVERFLOWCHECKS abilitati"
|
||
|
||
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "imposta RANGECHECKS abilitati"
|
||
|
||
#: lazarusidestrconsts:lissmallerratherthanfaster
|
||
msgid "smaller rather than faster"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccospaces
|
||
msgid "spaces"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "file configurazione pacchetti statici"
|
||
|
||
#: lazarusidestrconsts:srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "blocca il programma"
|
||
|
||
#: lazarusidestrconsts:listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "questo messaggio di aiuto"
|
||
|
||
#: lazarusidestrconsts:lisunitpath
|
||
msgid "unit path"
|
||
msgstr "percorso unit"
|
||
|
||
#: lazarusidestrconsts:srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "comando editor sconosciuto"
|
||
|
||
#: lazarusidestrconsts:lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "usa la unit HeapTrc"
|
||
|
||
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "usa la unit LineInfo"
|
||
|
||
#: lazarusidestrconsts:lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts:lisuidyes
|
||
msgid "yes"
|
||
msgstr "sì"
|
||
|