mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2026-02-25 05:08:23 +01:00
11316 lines
326 KiB
Plaintext
11316 lines
326 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: \n"
|
|
"POT-Creation-Date: \n"
|
|
"PO-Revision-Date: 2007-06-05 09:18+0100\n"
|
|
"Last-Translator: Darius Blaszijk <dhkblaszyk@zeelandnet.nl>\n"
|
|
"Language-Team: \n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=iso-8859-1\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
|
|
#: lazarusidestrconsts:srkmcommand1
|
|
msgid " command1 \""
|
|
msgstr " commando1 \""
|
|
|
|
#: lazarusidestrconsts:srkmcommand2
|
|
msgid " command2 \""
|
|
msgstr " commando2 \""
|
|
|
|
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
|
|
msgid " A token %s%s%s already exists! "
|
|
msgstr " Het teken %s%s%s bestaat al !"
|
|
|
|
#: lazarusidestrconsts:srkmalreadyconnected
|
|
msgid " The key \"%s\" is already connected to \"%s\"."
|
|
msgstr "Het teken \"%s\" is al gekoppeld aan \"%s\"."
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmconflicw
|
|
msgid " conflicts with "
|
|
msgstr " is in conflict met "
|
|
|
|
#: lazarusidestrconsts:liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (compileren ...)"
|
|
|
|
#: lazarusidestrconsts:lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (aan het debuggen ...)"
|
|
|
|
#: lazarusidestrconsts:liscovarious
|
|
msgid "%s (various)"
|
|
msgstr "%s (diversen)"
|
|
|
|
#: lazarusidestrconsts:lisnewproject
|
|
msgid "%s - (new project)"
|
|
msgstr "%s - (nieuw project)"
|
|
|
|
#: lazarusidestrconsts:lislazarusversionstring
|
|
msgid "%s beta"
|
|
msgstr "%s beta"
|
|
|
|
#: lazarusidestrconsts:lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s bytes"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "%s directory"
|
|
|
|
#: lazarusidestrconsts:lisdoesnotexists
|
|
msgid "%s does not exists: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circle dependency is not allowed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s is al deel van het project."
|
|
|
|
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "%s projectdirectory"
|
|
|
|
#: lazarusidestrconsts:lisunitinpackage
|
|
msgid "%s unit %s in package %s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "%s%s%s is geen geldige projectnaam.%s(Geldig is bijvoorbeeld: project1.lpi)"
|
|
|
|
#: lazarusidestrconsts:lissvuoisnotavalididentifier
|
|
msgid "%s%s%s is not a valid identifier."
|
|
msgstr "%s%s%s is geen geldige identifier."
|
|
|
|
#: lazarusidestrconsts:lisa2pisnotavalidunitname
|
|
msgid "%s%s%s is not a valid unit name."
|
|
msgstr "%s%s%s is geen geldige unit naam."
|
|
|
|
#: lazarusidestrconsts:liscoclickokifaresuretodothat
|
|
msgid "%s%sClick OK if you are sure to do that."
|
|
msgstr "%s%sKlik op OK als je zeker weet dat je dat wilt doen."
|
|
|
|
#: lazarusidestrconsts:lispkgsysfilename
|
|
msgid "%s%sFile Name: %s%s%s"
|
|
msgstr "%s%sbestandsnaam: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sKan de klasse van %s niet wijzigen in %s"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitname
|
|
msgid "%s%sUnit Name: %s%s%s"
|
|
msgstr "%s%sUnitnaam: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Pagina: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, automatisch gegenereerd"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
|
|
msgid "%s, project specific"
|
|
msgstr "%s, projectspecifiek"
|
|
|
|
#: lazarusidestrconsts:lisuereadonly
|
|
msgid "%s/ReadOnly"
|
|
msgstr "%s/uitsluitend leesbaar"
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
|
|
msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
msgstr "%sToevoegen nieuwe afhankelijkheid aan package %s: package %s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
|
|
msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
msgstr "%sToevoegen nieuwe afhankelijkheid voor project %s: package %s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sBeide packages zijn verbonden, ofwel de ene package gebruikt de andere, of een derde gebruikt deze twee."
|
|
|
|
#: lazarusidestrconsts:lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sBeschrijving: %s"
|
|
|
|
#: lazarusidestrconsts:lisa2pexistingfile
|
|
msgid "%sExisting file: %s%s%s"
|
|
msgstr "%sBestaand bestand: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sZie project -> Project Inspecteur"
|
|
|
|
#: lazarusidestrconsts:lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sStatus: "
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
|
|
msgstr "%sDe volgende units zullen aan de uses sectie van %s%s:%s%s%s worden toegevoegd"
|
|
|
|
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sDit package was geïnstalleerd, maar het lpk-bestand was niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
|
|
msgid "%sThis package was automatically created"
|
|
msgstr "%sDit pakket was automatisch aangemaakt"
|
|
|
|
#: lazarusidestrconsts:lisnone
|
|
msgid "%snone"
|
|
msgstr "%sgeen"
|
|
|
|
#: lazarusidestrconsts:liswladd
|
|
msgid "&Add"
|
|
msgstr "&Toevoegen"
|
|
|
|
#: lazarusidestrconsts:uemaddbreakpoint
|
|
msgid "&Add Breakpoint"
|
|
msgstr "&Voeg Breekpunt toe"
|
|
|
|
#: lazarusidestrconsts:lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcasesensitive
|
|
msgid "&Case Sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilecasesensitive
|
|
msgid "&Case sensitive"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisclose
|
|
msgid "&Close"
|
|
msgstr "&Sluiten"
|
|
|
|
#: lazarusidestrconsts:uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Sluit Pagina"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Componenten"
|
|
|
|
#: lazarusidestrconsts:liswldelete
|
|
msgid "&Delete"
|
|
msgstr "&Verwijderen"
|
|
|
|
#: lazarusidestrconsts:lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Bewerken"
|
|
|
|
#: lazarusidestrconsts:lisenableall
|
|
msgid "&Enable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswlenabled
|
|
msgid "&Enabled"
|
|
msgstr "&Ingeschakeld"
|
|
|
|
#: lazarusidestrconsts:dlgentirescope
|
|
msgid "&Entire Scope"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenufile
|
|
msgid "&File"
|
|
msgstr "&Bestand"
|
|
|
|
#: lazarusidestrconsts:lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Zoek declaratie"
|
|
|
|
#: lazarusidestrconsts:dlgfromcursor
|
|
msgid "&From Cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgglobal
|
|
msgid "&Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Ga naar bladwijzer"
|
|
|
|
#: lazarusidestrconsts:lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Help"
|
|
|
|
#: lazarusidestrconsts:lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objecten"
|
|
|
|
#: lazarusidestrconsts:lisok
|
|
msgid "&Ok"
|
|
msgstr "&Ok"
|
|
|
|
#: lazarusidestrconsts:uemopenfileatcursor
|
|
msgid "&Open file at cursor"
|
|
msgstr "&Open bestand op positie van cursor"
|
|
|
|
#: lazarusidestrconsts:lismenupackage
|
|
msgid "&Package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Project"
|
|
|
|
#: lazarusidestrconsts:dlgpromptonreplace
|
|
msgid "&Prompt On Replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Eigenschappen"
|
|
|
|
#: lazarusidestrconsts:dlgregularexpressions
|
|
msgid "&Regular Expressions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfileregularexpressions
|
|
msgid "&Regular expressions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsremove
|
|
msgid "&Remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenureplace2
|
|
msgid "&Replace ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgreplacewith
|
|
msgid "&Replace With"
|
|
msgstr "&Vervang Door"
|
|
|
|
#: lazarusidestrconsts:lismenurun
|
|
msgid "&Run"
|
|
msgstr "&Starten"
|
|
|
|
#: lazarusidestrconsts:uemruntocursor
|
|
msgid "&Run to Cursor"
|
|
msgstr "&Start tot cursor"
|
|
|
|
#: lazarusidestrconsts:lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Zoeken"
|
|
|
|
#: lazarusidestrconsts:dlgselectedtext
|
|
msgid "&Selected Text"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uemsetbookmark
|
|
msgid "&Set Bookmark"
|
|
msgstr "&Zet bladwijzer"
|
|
|
|
#: lazarusidestrconsts:lissourcebreakpoint
|
|
msgid "&Source breakpoint"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgtexttofing
|
|
msgid "&Text to Find"
|
|
msgstr "&Zoek tekst"
|
|
|
|
#: lazarusidestrconsts:lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Hulpmiddelen"
|
|
|
|
#: lazarusidestrconsts:lismenuview
|
|
msgid "&View"
|
|
msgstr "&Tonen"
|
|
|
|
#: lazarusidestrconsts:lismenuviewsource
|
|
msgid "&View Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgwholewordsonly
|
|
msgid "&Whole Words Only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilewholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuwindow
|
|
msgid "&Window"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscefilter
|
|
msgid "(Filter)"
|
|
msgstr "(Filter)"
|
|
|
|
#: lazarusidestrconsts:lisfilter2
|
|
msgid "(filter)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(geen subdirectory)"
|
|
|
|
#: lazarusidestrconsts:liscodehelpnodocumentation
|
|
msgid "(none)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(onbekende macro: %s)"
|
|
|
|
#: lazarusidestrconsts:lisplistall
|
|
msgid "<All>"
|
|
msgstr "<Alles>"
|
|
|
|
#: lazarusidestrconsts:liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr "<GEEN>"
|
|
|
|
#: lazarusidestrconsts:lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Geen>"
|
|
|
|
#: lazarusidestrconsts:lisa2pchooseanexistingfile
|
|
msgid "<choose an existing file>"
|
|
msgstr "<Kies een bestaand bestand>"
|
|
|
|
#: lazarusidestrconsts:lismodifiedlgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisgplnotice
|
|
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<Geen variabele geselecteerd>"
|
|
|
|
#: lazarusidestrconsts:lisoff
|
|
msgid "? (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lison
|
|
msgid "? (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
|
|
msgstr "A %s kan geen TControls bevatten.%sU kunt er alleen niet-visuele componenten op plaatsen."
|
|
|
|
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
|
|
msgid "A file %s%s%s already exists.%sReplace it?"
|
|
msgstr "Een bestand %s%s%s bestaat al.%sOverschrijven?"
|
|
|
|
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
|
|
msgid "A pascal unit must have the extension .pp or .pas"
|
|
msgstr "Een Pascal-unit dient op .pp of .pas te eindigen."
|
|
|
|
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
|
|
msgid "A required packages was not found. See package graph."
|
|
msgstr "Een benodigd pakket was niet gevonden. Zie pakket plaatje."
|
|
|
|
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
|
|
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
|
|
msgstr "Een simpel pascal programma bestand.%sDeze kan gebruikt worden voor een snelle test.%sHet is beter een nieuw project te maken."
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Een geldige Tool heeft tenminste een titel en een bestandsnaam nodig."
|
|
|
|
#: lazarusidestrconsts:lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinfobuildmakeabort
|
|
msgid "Abort"
|
|
msgstr "Afbreken"
|
|
|
|
#: lazarusidestrconsts:lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Bouwen afbreken"
|
|
|
|
#: lazarusidestrconsts:lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Alles afbreken"
|
|
|
|
#: lazarusidestrconsts:lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Het laden afbreken"
|
|
|
|
#: lazarusidestrconsts:liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Het laden van het project afbreken"
|
|
|
|
#: lazarusidestrconsts:lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinfobuildabort
|
|
msgid "Aborted..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenutemplateabout
|
|
msgid "About"
|
|
msgstr "Informatie"
|
|
|
|
#: lazarusidestrconsts:lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Informatie over Lazarus"
|
|
|
|
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract methods - not yet overridden"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Accepteer"
|
|
|
|
#: lazarusidestrconsts:lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildaboaction
|
|
msgid "Action"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Actie: %s"
|
|
|
|
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Activeer reguliere-expressiesyntax voor tekst en vervanging"
|
|
|
|
#: lazarusidestrconsts:liscodetempladd
|
|
msgid "Add"
|
|
msgstr "Toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "%s aan het project toevoegen?"
|
|
|
|
#: lazarusidestrconsts:uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "&Kijk op positie cursor toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisa2paddfile
|
|
msgid "Add File"
|
|
msgstr "Bestand toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Bestanden toevoegen"
|
|
|
|
#: lazarusidestrconsts:rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
|
|
msgid "Add LFM, LRS files, if they exist"
|
|
msgstr "Voeg .lfm- of .lrs-bestanden toe, indien ze bestaan"
|
|
|
|
#: lazarusidestrconsts:lisa2paddunit
|
|
msgid "Add Unit"
|
|
msgstr "Unit Toevoegen"
|
|
|
|
#: lazarusidestrconsts:lismenuaddcurunittopkg
|
|
msgid "Add active unit to a package"
|
|
msgstr "Een actieve unit toevoegen aan een Pakket"
|
|
|
|
#: lazarusidestrconsts:liskmaddactiveunittoproject
|
|
msgid "Add active unit to project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditaddanitem
|
|
msgid "Add an item"
|
|
msgstr "Item toevoegen"
|
|
|
|
#: lazarusidestrconsts:dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmaddbreakpoint
|
|
msgid "Add break point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuaddbreakpoint
|
|
msgid "Add breakpoint"
|
|
msgstr "Breekpunt toevoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Codesjabloon toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisadddirectory
|
|
msgid "Add directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuaddtoproject
|
|
msgid "Add editor file to Project"
|
|
msgstr "Bewerker-bestand aan project toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisprojaddeditorfile
|
|
msgid "Add editor files"
|
|
msgstr "Bewerker-bestanden toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisaf2paddfiletoapackage
|
|
msgid "Add file to a package"
|
|
msgstr "Voeg bestand aan pakket toe"
|
|
|
|
#: lazarusidestrconsts:lisprojaddaddfiletoproject
|
|
msgid "Add file to project:"
|
|
msgstr "Bestand aan project toevoegen:"
|
|
|
|
#: lazarusidestrconsts:lisprojaddfiles
|
|
msgid "Add files"
|
|
msgstr "Bestanden toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisaddfilesofdirectory
|
|
msgid "Add files of directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2paddfilestopackage
|
|
msgid "Add files to package"
|
|
msgstr "Voeg bestanden toe aan pakket"
|
|
|
|
#: lazarusidestrconsts:srkmecaddjumppoint
|
|
msgid "Add jump point"
|
|
msgstr "Springpunt toevoegen"
|
|
|
|
#: lazarusidestrconsts:lismenuaddjumppointtohistory
|
|
msgid "Add jump point to history"
|
|
msgstr "Springpunt aan geschiedenis toevoegen"
|
|
|
|
#: lazarusidestrconsts:liscodehelpaddlinkbutton
|
|
msgid "Add link"
|
|
msgstr "Voeg link toe"
|
|
|
|
#: lazarusidestrconsts:lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Opties aan pakketten en projecten toevoegen"
|
|
|
|
#: lazarusidestrconsts:podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Pad toevoegen"
|
|
|
|
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Paden aan pakketten en projecten toevoegen"
|
|
|
|
#: lazarusidestrconsts:dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
|
|
msgid "Add to favourite properties"
|
|
msgstr "Voeg aan favoriete properties toe"
|
|
|
|
#: lazarusidestrconsts:lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Voeg aan pakket toe"
|
|
|
|
#: lazarusidestrconsts:lisprojaddtoproject
|
|
msgid "Add to project"
|
|
msgstr "Voeg toe aan het project"
|
|
|
|
#: lazarusidestrconsts:lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr "Neem unit in the uses-sectie van package op. Units die niet altijd gecompileerd worden, hoeven niet opgenomen te worden."
|
|
|
|
#: lazarusidestrconsts:liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuaddwatch
|
|
msgid "Add watch ..."
|
|
msgstr "Watch toevoegen ..."
|
|
|
|
#: lazarusidestrconsts:dlgedadd
|
|
msgid "Add..."
|
|
msgstr "Toevoegen ..."
|
|
|
|
#: lazarusidestrconsts:dlgadditionalsrcpath
|
|
msgid "Additional Source search path for all projects (.pp;.pas)"
|
|
msgstr "Additionele bron zoek pad voor alle projecten (.pp, .pas)"
|
|
|
|
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
|
|
msgid "Additional compiler options inherited from packages"
|
|
msgstr "Additionele compiler opties gelijk aan die van packages"
|
|
|
|
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Additionele bestanden om te zoeken (d.w.z. /pad/*.pas, /pad2/*.pp)"
|
|
|
|
#: lazarusidestrconsts:rsadditionalinfo
|
|
msgid "Additional info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Additioneel zoekpad"
|
|
|
|
#: lazarusidestrconsts:dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Bewerk bovenste lijn"
|
|
|
|
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
|
|
msgid "Advanced Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmalignword
|
|
msgid "Align"
|
|
msgstr "Lijn uit"
|
|
|
|
#: lazarusidestrconsts:lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Uitlijning"
|
|
|
|
#: lazarusidestrconsts:lisemdall
|
|
msgid "All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisallfiles
|
|
msgid "All Files"
|
|
msgstr "Alle bestanden"
|
|
|
|
#: lazarusidestrconsts:lisallblockslooksok
|
|
msgid "All blocks looks ok."
|
|
msgstr "Alle blokken zien er goed uit"
|
|
|
|
#: lazarusidestrconsts:dlgallfiles
|
|
msgid "All files"
|
|
msgstr "Alle bestanden"
|
|
|
|
#: lazarusidestrconsts:lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Alle pakketten"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Alle projecten"
|
|
|
|
#: lazarusidestrconsts:lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
|
|
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Sta LABEL en GOTO toe"
|
|
|
|
#: lazarusidestrconsts:lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Sta het zoeken naar meerdere lijnen toe"
|
|
|
|
#: lazarusidestrconsts:dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Alfabetisch"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolalt
|
|
msgid "Alt"
|
|
msgstr "Alt"
|
|
|
|
#: lazarusidestrconsts:dlgaltsetclmode
|
|
msgid "Alt-Key sets column mode"
|
|
msgstr "Alt-toets stelt kolommodus in"
|
|
|
|
#: lazarusidestrconsts:lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmalternkey
|
|
msgid "Alternative key (or 2 keys combination)"
|
|
msgstr "Alternatieve toets (of 2 toets combinaties)"
|
|
|
|
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
|
|
msgid "Always Build before Run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Altijd bouwen (ook als er niks is gewijzigd)"
|
|
|
|
#: lazarusidestrconsts:dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Dubbelzinnig ancestor type"
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Dubbelzinnige klasse naam"
|
|
|
|
#: lazarusidestrconsts:lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Dubbelzinnige unit naam"
|
|
|
|
#: lazarusidestrconsts:lisambiguousunitfound
|
|
msgid "Ambiguous Unit found"
|
|
msgstr "Dubbelzinnige unit gevonden"
|
|
|
|
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Dubbelzinnige, extra compiler configuratie bestand"
|
|
|
|
#: lazarusidestrconsts:lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Dubbelzinnig bestand actie:"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Dubbelzinnig bestand gevonden"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
|
|
msgstr "Dubbelzinnig bestand gevonden: %s%s%s%sDit bestand kan worden verward met %s%s%s%s%sHet dubbelzinnige bestand verwijderen?"
|
|
|
|
#: lazarusidestrconsts:lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Dubbelzinnige bestanden gevonden"
|
|
|
|
#: lazarusidestrconsts:lisambiguousunitfound2
|
|
msgid "Ambiguous unit found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Dubbelzinnige units gevonden"
|
|
|
|
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
|
|
msgstr "Bij het laden van %s is er laatst een fout opgetreden!%s%sDit project opnieuw laden?"
|
|
|
|
#: lazarusidestrconsts:lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Ancestor Type"
|
|
|
|
#: lazarusidestrconsts:lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Anker bewerker - geen control geselecteerd"
|
|
|
|
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
|
|
msgid "Anchor to bottom side of sibling, keep border space"
|
|
msgstr "Anker naar onderzijde van verwante, behoud randruimte"
|
|
|
|
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
|
|
msgid "Anchor to left side of sibling, keep border space"
|
|
msgstr "Anker naar linkerzijde van verwante, behoud randruimte"
|
|
|
|
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
|
|
msgid "Anchor to right side of sibling, keep border space"
|
|
msgstr "Anker naar rechterzijde van verwante, behoud randruimte"
|
|
|
|
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
|
|
msgid "Anchor to top side of sibling, keep border space"
|
|
msgstr "Anker naar bovenzijde van verwante, behoud randruimte"
|
|
|
|
#: lazarusidestrconsts:lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Ankers van geselecteerde controls"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Voeg aan einde van sectie toe"
|
|
|
|
#: lazarusidestrconsts:dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Applicatie"
|
|
|
|
#: lazarusidestrconsts:dlgapplicationsettings
|
|
msgid "Application Settings"
|
|
msgstr "Applicatie instellingen"
|
|
|
|
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
|
|
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr "Applicatie%sEen grafisch lcl/freepascal programma. Het bestand wordt automatisch door Lazarus bijgehouden."
|
|
|
|
#: lazarusidestrconsts:dlgbutapply
|
|
msgid "Apply"
|
|
msgstr "Toepassen"
|
|
|
|
#: lazarusidestrconsts:lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Wijzigingen toepassen"
|
|
|
|
#: lazarusidestrconsts:rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "Arabisch"
|
|
|
|
#: lazarusidestrconsts:dlgcoasis
|
|
msgid "As-Is"
|
|
msgstr "As-Is"
|
|
|
|
#: lazarusidestrconsts:lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Neerwaarts"
|
|
|
|
#: lazarusidestrconsts:dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Vraag"
|
|
|
|
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Vraag voor het vervangen van gevonden tekst"
|
|
|
|
#: lazarusidestrconsts:dlgcoasmstyle
|
|
msgid "Assembler style:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr "Bij"
|
|
|
|
#: lazarusidestrconsts:lispckoptsauthor
|
|
msgid "Author:"
|
|
msgstr "Auteur:"
|
|
|
|
#: lazarusidestrconsts:liscodetemplautocompleteon
|
|
msgid "Auto complete on ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgautoform
|
|
msgid "Auto create form when opening unit"
|
|
msgstr "Maak automatisch een formulier aan bij openen unit"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
|
|
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Automatisch gemaakte nodes kunnen niet bewerkt worden,%tevens kunnen ze geen automatisch gemaakte Child nodes bevatten."
|
|
|
|
#: lazarusidestrconsts:dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Verwijder bestand automatisch"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes can not be edited."
|
|
msgstr "Automatisch gegenereerde nodes kunnen niet bewerkt worden."
|
|
|
|
#: lazarusidestrconsts:dlgautoident
|
|
msgid "Auto indent"
|
|
msgstr "Automatisch inspringen"
|
|
|
|
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Automatisch herbouwen wanneer allen herbouwd worden"
|
|
|
|
#: lazarusidestrconsts:dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Automatisch hernoemen bestand naar kleine letters"
|
|
|
|
#: lazarusidestrconsts:dlgautosave
|
|
msgid "Auto save"
|
|
msgstr "Automatisch saven"
|
|
|
|
#: lazarusidestrconsts:lisautoshowobjectinspector
|
|
msgid "Auto show Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automatisch maken van formulieren"
|
|
|
|
#: lazarusidestrconsts:lispckexplautocreated
|
|
msgid "AutoCreated"
|
|
msgstr "AutoCreated"
|
|
|
|
#: lazarusidestrconsts:rslanguageautomatic
|
|
msgid "Automatic (or english)"
|
|
msgstr "Automatisch (of Engels)"
|
|
|
|
#: lazarusidestrconsts:lisautomaticfeatures
|
|
msgid "Automatic features"
|
|
msgstr "Automatische kenmerken"
|
|
|
|
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
|
|
msgid "Automatically increment version on build"
|
|
msgstr "Automatisch ophogen van versie bij bouwen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automatisch geïnstalleerde packages"
|
|
|
|
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Automatisch herbouwen wanneer nodig"
|
|
|
|
#: lazarusidestrconsts:dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Beschikbare Forms:"
|
|
|
|
#: lazarusidestrconsts:lisavailablepackages
|
|
msgid "Available packages"
|
|
msgstr "Beschikbare pakketten"
|
|
|
|
#: lazarusidestrconsts:dlgedback
|
|
msgid "Back"
|
|
msgstr "Terug"
|
|
|
|
#: lazarusidestrconsts:fdmorderbackone
|
|
msgid "Back one"
|
|
msgstr "Een terug"
|
|
|
|
#: lazarusidestrconsts:dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Achtergrond"
|
|
|
|
#: lazarusidestrconsts:dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Backup"
|
|
|
|
#: lazarusidestrconsts:lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Backup bestand gefaald"
|
|
|
|
#: lazarusidestrconsts:dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Achter methoden"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypebinary
|
|
msgid "Binary"
|
|
msgstr "Binair"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Blok"
|
|
|
|
#: lazarusidestrconsts:dlgblockindent
|
|
msgid "Block indent"
|
|
msgstr "Blok inspringen"
|
|
|
|
#: lazarusidestrconsts:dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Vet"
|
|
|
|
#: lazarusidestrconsts:uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Bookmark"
|
|
|
|
#: lazarusidestrconsts:lisborderspace
|
|
msgid "BorderSpace"
|
|
msgstr "Randruimte"
|
|
|
|
#: lazarusidestrconsts:lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Randruimte rond het control. De andere vier randruimtes worden opgeteld aan deze waarde."
|
|
|
|
#: lazarusidestrconsts:lisbottom
|
|
msgid "Bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Bodem ankering"
|
|
|
|
#: lazarusidestrconsts:lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Bodem randruimte. Deze waarde wordt toegevoegd aan de basis randruimte en gebruikt voor de ruimte onder het control."
|
|
|
|
#: lazarusidestrconsts:lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Bodem gelijk gespaceerd"
|
|
|
|
#: lazarusidestrconsts:lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Bodems"
|
|
|
|
#: lazarusidestrconsts:dlgbrachighlight
|
|
msgid "Bracket highlighting"
|
|
msgstr "Haakjes verlicht"
|
|
|
|
#: lazarusidestrconsts:lisbreak
|
|
msgid "Break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenubeaklinesinselection
|
|
msgid "Break Lines in selection"
|
|
msgstr "Breek lijnen in selectie"
|
|
|
|
#: lazarusidestrconsts:srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Breek lijn, en verplaats cursor"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Breek lijn, verlaat cursor"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
|
|
msgid "Break on Lazarus Exceptions"
|
|
msgstr "Breek op Lazarus excepties"
|
|
|
|
#: lazarusidestrconsts:lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "Breekpunten"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Breekpunt"
|
|
|
|
#: lazarusidestrconsts:lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Gebroken Afhankelijkheden"
|
|
|
|
#: lazarusidestrconsts:lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Gebroken Dependency"
|
|
|
|
#: lazarusidestrconsts:lispatheditbrowse
|
|
msgid "Browse"
|
|
msgstr "Blader"
|
|
|
|
#: lazarusidestrconsts:lisbrowseforcompiler
|
|
msgid "Browse for Compiler (%s)"
|
|
msgstr "Blader voor Compiler (%s)"
|
|
|
|
#: lazarusidestrconsts:lismenubuild
|
|
msgid "Build"
|
|
msgstr "Bouw"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildall
|
|
msgid "Build All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildcodetools
|
|
msgid "Build CodeTools"
|
|
msgstr "Bouw CodeTools"
|
|
|
|
#: lazarusidestrconsts:lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Bouw bestand"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildide
|
|
msgid "Build IDE"
|
|
msgstr "Bouw IDE"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
|
|
msgid "Build IDE with Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
|
|
msgid "Build IDE without Packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildjitform
|
|
msgid "Build JITForm"
|
|
msgstr "Bouw JITForm"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbobuildlcl
|
|
msgid "Build LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenubuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Bouw Lazarus"
|
|
|
|
#: lazarusidestrconsts:lisbuildnumber
|
|
msgid "Build Number"
|
|
msgstr "Bouw Number"
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildoptions
|
|
msgid "Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildsynedit
|
|
msgid "Build SynEdit"
|
|
msgstr "Bouw SynEdit"
|
|
|
|
#: lazarusidestrconsts:lismenubuildall
|
|
msgid "Build all"
|
|
msgstr "Bouw Alles"
|
|
|
|
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
|
|
msgid "Build all files of project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
|
|
msgid "Build components (SynEdit, CodeTools)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildbuildexamples
|
|
msgid "Build examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecbuildlazarus
|
|
msgid "Build lazarus"
|
|
msgstr "Bouw Lazarus"
|
|
|
|
#: lazarusidestrconsts:lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Bouw nieuw project"
|
|
|
|
#: lazarusidestrconsts:liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsbuild
|
|
msgid "Build:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcmacro
|
|
msgid "C Style Macros (global)"
|
|
msgstr "C -stijl macro's (globaal)"
|
|
|
|
#: lazarusidestrconsts:dlgcocops
|
|
msgid "C Style Operators (*=, +=, /= and -=)"
|
|
msgstr "C -stijl Operators (*=, +=, /= and -=)"
|
|
|
|
#: lazarusidestrconsts:dlgcppinline
|
|
msgid "C++ Styled INLINE"
|
|
msgstr "C++-achtige INLINE"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertcvskeyword
|
|
msgid "CVS keyword"
|
|
msgstr "CVS-sleutelwoord"
|
|
|
|
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Aanroepen %Register%s procedure van de geselecteerde unit"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Call Stack"
|
|
|
|
#: lazarusidestrconsts:liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Aanroepen bij:"
|
|
|
|
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
|
|
msgid "Can not copy top level component."
|
|
msgstr "Kan top-level component niet kopiëren."
|
|
|
|
#: lazarusidestrconsts:liscannotcreatefile
|
|
msgid "Can not create file %s%s%s"
|
|
msgstr "Kan bestand %s%s%s niet maken"
|
|
|
|
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
|
|
msgid "Can not register components without unit"
|
|
msgstr "Kan componenten zonder unit niet registreren"
|
|
|
|
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Alleen the class van TComponents kan gewijzigd worden."
|
|
|
|
#: lazarusidestrconsts:dlgcancel
|
|
msgid "Cancel"
|
|
msgstr "Annuleren"
|
|
|
|
#: lazarusidestrconsts:liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Laden van de unit annuleren"
|
|
|
|
#: lazarusidestrconsts:liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Hernoemen annuleren"
|
|
|
|
#: lazarusidestrconsts:lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Kan de lijst van medewerkers niet vinden."
|
|
|
|
#: lazarusidestrconsts:liscannotfindlazarusstarter
|
|
msgid "Cannot find lazarus starter:%s%s"
|
|
msgstr "Kan Lazarus Starter niet vinden:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Hoofd/kleine letter ongevoelig"
|
|
|
|
#: lazarusidestrconsts:rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "Catalaans"
|
|
|
|
#: lazarusidestrconsts:liscecategories
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listtodolcategory
|
|
msgid "Category"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcentercursorline
|
|
msgid "Center Cursor Line"
|
|
msgstr "Centreer Cursor line"
|
|
|
|
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Centreer in window"
|
|
|
|
#: lazarusidestrconsts:liscenters
|
|
msgid "Centers"
|
|
msgstr "Middenpunten"
|
|
|
|
#: lazarusidestrconsts:liscodetemplchange
|
|
msgid "Change"
|
|
msgstr "Wijzig"
|
|
|
|
#: lazarusidestrconsts:lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Wijzig Class"
|
|
|
|
#: lazarusidestrconsts:lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischangefile
|
|
msgid "Change file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischangeparent
|
|
msgid "Change parent ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuinsertchangelogentry
|
|
msgid "ChangeLog entry"
|
|
msgstr "ChangeLog bericht"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffchangedfiles
|
|
msgid "Changed files:"
|
|
msgstr "Gewijzigde bestanden:"
|
|
|
|
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Wijzigen van de package naam of de versie verbreekt afhankelijkheden. Moeten deze afhankelijkheden ook worden gewijzigd?%sKies Ja om alle weergegeven afhankelijkheden te wijzigen.%sKies Negeren om de afhankelijkheden te verbreken."
|
|
|
|
#: lazarusidestrconsts:srkmecchar
|
|
msgid "Char"
|
|
msgstr "Karakter"
|
|
|
|
#: lazarusidestrconsts:lischaracter
|
|
msgid "Character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Karakter tabel"
|
|
|
|
#: lazarusidestrconsts:rscharacterset
|
|
msgid "Character set:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuchecklfm
|
|
msgid "Check LFM file in editor"
|
|
msgstr "Controleer .lfm-bestand in editor"
|
|
|
|
#: lazarusidestrconsts:lischeckchangesondiskwithloading
|
|
msgid "Check changes on disk with loading"
|
|
msgstr "Controleer wijzigingen op schijf tijdens het laden"
|
|
|
|
#: lazarusidestrconsts:dlgcheckconsistency
|
|
msgid "Check consistency"
|
|
msgstr "Controleer consistentie"
|
|
|
|
#: lazarusidestrconsts:dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcochecks
|
|
msgid "Checks:"
|
|
msgstr "Controleert:"
|
|
|
|
#: lazarusidestrconsts:rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "Chinees"
|
|
|
|
#: lazarusidestrconsts:lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Kies Delphi package (*.dpk)"
|
|
|
|
#: lazarusidestrconsts:lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Kies Delphi-project (*.dpr)"
|
|
|
|
#: lazarusidestrconsts:lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Kies Delphi-unit (*.pas)"
|
|
|
|
#: lazarusidestrconsts:lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Kies directory"
|
|
|
|
#: lazarusidestrconsts:lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Kies FPC-directory"
|
|
|
|
#: lazarusidestrconsts:liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Kies Lazarus-directory"
|
|
|
|
#: lazarusidestrconsts:lisedoptschoosescheme
|
|
msgid "Choose Scheme"
|
|
msgstr "Kies schema"
|
|
|
|
#: lazarusidestrconsts:lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
|
|
msgid "Choose a base class for the favourite property %s%s%s."
|
|
msgstr "Kies een basisklasse voor de favoriete eigenschap %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Kies een andere naam"
|
|
|
|
#: lazarusidestrconsts:lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Kies code sjabloonbestand (*.dci)"
|
|
|
|
#: lazarusidestrconsts:lischoosecompilerpath
|
|
msgid "Choose compiler filename (%s)"
|
|
msgstr "Kies compilerbestandsnaam (%s)"
|
|
|
|
#: lazarusidestrconsts:lischoosedebuggerpath
|
|
msgid "Choose debugger filename"
|
|
msgstr "Kies debuggerbestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Kies directory"
|
|
|
|
#: lazarusidestrconsts:lischoosemakepath
|
|
msgid "Choose make path"
|
|
msgstr "Kies maakpad"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Kies een van deze items om een nieuw bestand te maken"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Kies een van deze items om een nieuw Package te maken"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Kies een van deze items om een nieuw Project te maken"
|
|
|
|
#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Kies programmabroncode (*.pp, *.pas, *.lpr)"
|
|
|
|
#: lazarusidestrconsts:lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Kies structuur om selectie te omsluiten"
|
|
|
|
#: lazarusidestrconsts:lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Kies de directory voor testen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
|
|
msgid "Circle in package dependencies"
|
|
msgstr "Circulaire verbindingen in package afhankelijkheden"
|
|
|
|
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
|
|
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
|
|
msgstr "Class %s%s%s is geen geregistreerde componentklasse.%sKan niet plakken."
|
|
|
|
#: lazarusidestrconsts:lisoifclassnotfound
|
|
msgid "Class %s%s%s not found."
|
|
msgstr "Klasse %s%s%s niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lisclassofmethodnotfound
|
|
msgid "Class %s%s%s of method %s%s%s not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Klassenaam bestaat reeds"
|
|
|
|
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
|
|
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Klasse niet gevonden"
|
|
|
|
#: lazarusidestrconsts:dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Klassevolgorde"
|
|
|
|
#: lazarusidestrconsts:dlgclassinsertpolicy
|
|
msgid "Class part insert policy"
|
|
msgstr "Klassegedeelte toevoegingsbeleid"
|
|
|
|
#: lazarusidestrconsts:liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klassiek"
|
|
|
|
#: lazarusidestrconsts:liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Maak directory schoon"
|
|
|
|
#: lazarusidestrconsts:liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Maak Lazarus-broncode schoon"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
|
|
msgid "Clean Up + Build all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazbuildcleanall
|
|
msgid "Clean all"
|
|
msgstr "Maak alles schoon"
|
|
|
|
#: lazarusidestrconsts:lismenucleandirectory
|
|
msgid "Clean directory ..."
|
|
msgstr "Maak directory schoon ..."
|
|
|
|
#: lazarusidestrconsts:liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Maak sub directory schoon"
|
|
|
|
#: lazarusidestrconsts:liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Unit pad opschonen?"
|
|
|
|
#: lazarusidestrconsts:lislazbuildcleanbuild
|
|
msgid "Clean+Build"
|
|
msgstr "Maak schoon + Bouw"
|
|
|
|
#: lazarusidestrconsts:lisuidclear
|
|
msgid "Clear"
|
|
msgstr "Maak schoon"
|
|
|
|
#: lazarusidestrconsts:liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
|
|
msgid "Clear dependency filename"
|
|
msgstr "Maak schoon afhankelijkheid bestandsnaam "
|
|
|
|
#: lazarusidestrconsts:lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Maak schoon log on run"
|
|
|
|
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Klik op een van de bovenstaande items om het verschil te zien"
|
|
|
|
#: lazarusidestrconsts:lismenuclose
|
|
msgid "Close"
|
|
msgstr "Sluiten"
|
|
|
|
#: lazarusidestrconsts:liskmcloseall
|
|
msgid "Close All"
|
|
msgstr "Sluit alles"
|
|
|
|
#: lazarusidestrconsts:lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Sluit project"
|
|
|
|
#: lazarusidestrconsts:lismenucloseall
|
|
msgid "Close all editor files"
|
|
msgstr "Sluit alle editorbestanden"
|
|
|
|
#: lazarusidestrconsts:lissrclosepage
|
|
msgid "Close page"
|
|
msgstr "Sluit pagina"
|
|
|
|
#: lazarusidestrconsts:liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Sluit project"
|
|
|
|
#: lazarusidestrconsts:dlgcodegeneration
|
|
msgid "Code"
|
|
msgstr "Code"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcodebrowser
|
|
msgid "Code Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Codecreatie"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcodeexplorer
|
|
msgid "Code Explorer"
|
|
msgstr "Codeverkenner"
|
|
|
|
#: lazarusidestrconsts:lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Broncodesjablonen ..."
|
|
|
|
#: lazarusidestrconsts:dlgcodetoolstab
|
|
msgid "Code Tools"
|
|
msgstr "Codehulpmiddelen"
|
|
|
|
#: lazarusidestrconsts:liscodebrowser
|
|
msgid "Code browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgusecodefolding
|
|
msgid "Code folding"
|
|
msgstr "Code inschuiven"
|
|
|
|
#: lazarusidestrconsts:dlgedcodeparams
|
|
msgid "Code parameters"
|
|
msgstr "Code parameters"
|
|
|
|
#: lazarusidestrconsts:srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Broncodesjablooncompletering"
|
|
|
|
#: lazarusidestrconsts:dlgedcodetempl
|
|
msgid "Code templates"
|
|
msgstr "Broncode templates"
|
|
|
|
#: lazarusidestrconsts:lisceocodeexplorer
|
|
msgid "CodeExplorer Options"
|
|
msgstr "CodeEplorer-opties"
|
|
|
|
#: lazarusidestrconsts:liscodetools
|
|
msgid "CodeTools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
|
|
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
|
|
msgstr "Codetools - hulpmiddelen en functies om broncodes te parsen, bewerken en te verkennen "
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "Editor voor codeerhulpmiddelendefinities"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
|
|
msgid "CodeTools Defines Preview"
|
|
msgstr "Voorbeeld codeerhulpmiddelendefinities"
|
|
|
|
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "Codeerhulpmiddelen mappen instellingen"
|
|
|
|
#: lazarusidestrconsts:dlgcodetoolsopts
|
|
msgid "CodeTools Options"
|
|
msgstr "CodeTools instellingen"
|
|
|
|
#: lazarusidestrconsts:lismenucodetoolsoptions
|
|
msgid "CodeTools Options ..."
|
|
msgstr "CodeTools instellingen ..."
|
|
|
|
#: lazarusidestrconsts:srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeToolscommando's"
|
|
|
|
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
|
|
msgid "CodeTools defines editor ..."
|
|
msgstr "CodeTools definitieseditor ..."
|
|
|
|
#: lazarusidestrconsts:liskmcodetoolsoptions
|
|
msgid "CodeTools options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
|
|
msgid "Codetools defines editor"
|
|
msgstr "Codetools-definitieseditor"
|
|
|
|
#: lazarusidestrconsts:srkmeccodetoolsoptions
|
|
msgid "Codetools options"
|
|
msgstr "CodeTools opties"
|
|
|
|
#: lazarusidestrconsts:liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenucollectpofil
|
|
msgid "Collect .po files"
|
|
msgstr "Verzamel .po-bestanden"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Dubbele punt"
|
|
|
|
#: lazarusidestrconsts:dlgedcolor
|
|
msgid "Color"
|
|
msgstr "Kleur"
|
|
|
|
#: lazarusidestrconsts:dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Kleuren schema"
|
|
|
|
#: lazarusidestrconsts:dlgenvcolors
|
|
msgid "Colors"
|
|
msgstr "Kleuren"
|
|
|
|
#: lazarusidestrconsts:srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Kolom selectie methode"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Komma"
|
|
|
|
#: lazarusidestrconsts:liscommandafter
|
|
msgid "Command after"
|
|
msgstr "Commando-uitvoer"
|
|
|
|
#: lazarusidestrconsts:liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr "Opdracht na ongeldig"
|
|
|
|
#: lazarusidestrconsts:liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Opdracht na publiceren module"
|
|
|
|
#: lazarusidestrconsts:srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Opdrachtopdrachten"
|
|
|
|
#: lazarusidestrconsts:dlgcommandlineparameters
|
|
msgid "Command line parameters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Command line parameters (zonder applicatie naam)"
|
|
|
|
#: lazarusidestrconsts:liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Command line parameters van het programma"
|
|
|
|
#: lazarusidestrconsts:liscocommand
|
|
msgid "Command:"
|
|
msgstr "Opdracht:"
|
|
|
|
#: lazarusidestrconsts:lismenucommentselection
|
|
msgid "Comment selection"
|
|
msgstr "Commentaarselectie"
|
|
|
|
#: lazarusidestrconsts:liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Commentaar:"
|
|
|
|
#: lazarusidestrconsts:dlgcocompilation
|
|
msgid "Compilation"
|
|
msgstr "Compilatie"
|
|
|
|
#: lazarusidestrconsts:liscocalloncompile
|
|
msgid "Compile"
|
|
msgstr "Compileren"
|
|
|
|
#: lazarusidestrconsts:liscompileidewithoutlinking
|
|
msgid "Compile IDE (without linking)"
|
|
msgstr "Compileer IDE (zonder Linking)"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildcaption
|
|
msgid "Compile Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Alles compileeren?"
|
|
|
|
#: lazarusidestrconsts:lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Compileer package"
|
|
|
|
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "CompiledSrcPath toevoeging"
|
|
|
|
#: lazarusidestrconsts:liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Compiler"
|
|
|
|
#: lazarusidestrconsts:dlgcompileroptions
|
|
msgid "Compiler Options"
|
|
msgstr "Compileropties"
|
|
|
|
#: lazarusidestrconsts:lismenucompileroptions
|
|
msgid "Compiler Options ..."
|
|
msgstr "Compileropties ..."
|
|
|
|
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Compileropties voor Package %s"
|
|
|
|
#: lazarusidestrconsts:liscompileroptionsforproject
|
|
msgid "Compiler Options for Project: %s"
|
|
msgstr "Compileropties voor project: %s"
|
|
|
|
#: lazarusidestrconsts:liscompilererror
|
|
msgid "Compiler error"
|
|
msgstr "Compilerfout"
|
|
|
|
#: lazarusidestrconsts:liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Compilerbestandsnaam"
|
|
|
|
#: lazarusidestrconsts:liskmcompileroptions
|
|
msgid "Compiler options"
|
|
msgstr "Compiler opties"
|
|
|
|
#: lazarusidestrconsts:dlgfpcpath
|
|
msgid "Compiler path (e.g. %s)"
|
|
msgstr "Compilerpad (%s)"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildcomplile
|
|
msgid "Compiling..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenucompletecode
|
|
msgid "Complete Code"
|
|
msgstr "Completeer code"
|
|
|
|
#: lazarusidestrconsts:srkmeccompletecode
|
|
msgid "Complete code"
|
|
msgstr "Completeer code"
|
|
|
|
#: lazarusidestrconsts:dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Completeer properties"
|
|
|
|
#: lazarusidestrconsts:liscomponent
|
|
msgid "Component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
|
|
msgid "Component Class %s%s%s already defined"
|
|
msgstr "Componentklasse %s%s%s reeds gedefinieerd"
|
|
|
|
#: lazarusidestrconsts:liscomponentnameiskeyword
|
|
msgid "Component name %s%s%s is keyword"
|
|
msgstr "Componentnaam %s%s%s is sleutelwoord"
|
|
|
|
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
|
|
msgid "Component name %s%s%s is not a valid identifier"
|
|
msgstr "Component Naam %s%s%s is geen geldige identifier"
|
|
|
|
#: lazarusidestrconsts:lisfpcomponents
|
|
msgid "Components"
|
|
msgstr "Componenten"
|
|
|
|
#: lazarusidestrconsts:liscondition
|
|
msgid "Condition"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmconfigbuildfile
|
|
msgid "Config %sBuild File%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgconfigfiles
|
|
msgid "Config Files:"
|
|
msgstr "Configuratiebestanden:"
|
|
|
|
#: lazarusidestrconsts:lisconfigurebuildlazarus
|
|
msgid "Configure %sBuild Lazarus%s"
|
|
msgstr "Configureer %sLazarus Bouwen%s"
|
|
|
|
#: lazarusidestrconsts:lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Configureer Bouw+Start bestand ..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigurehelp
|
|
msgid "Configure Help"
|
|
msgstr "Configureer help"
|
|
|
|
#: lazarusidestrconsts:lismenuconfigurehelp
|
|
msgid "Configure Help ..."
|
|
msgstr "Configureer Help ..."
|
|
|
|
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Configureer \"Bouw Lazarus\" ..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigurecustomcomponents
|
|
msgid "Configure custom components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuconfigcustomcomps
|
|
msgid "Configure custom components ..."
|
|
msgstr "Configureer aanpasbare componenten ..."
|
|
|
|
#: lazarusidestrconsts:lismenusettings
|
|
msgid "Configure custom tools ..."
|
|
msgstr "Configureer aanpasbare hulpmiddelen ..."
|
|
|
|
#: lazarusidestrconsts:liskmconfigureinstalledpackages
|
|
msgid "Configure installed packages"
|
|
msgstr "Configureer geinstalleerde paketten"
|
|
|
|
#: lazarusidestrconsts:lismenueditinstallpkgs
|
|
msgid "Configure installed packages ..."
|
|
msgstr "Configureer geinstalleerde pakketten ..."
|
|
|
|
#: lazarusidestrconsts:lislazbuildconfirmbuild
|
|
msgid "Confirm before rebuilding Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Bevestig wijzigingen"
|
|
|
|
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Bevestig Afhankelijkheid verwijderen"
|
|
|
|
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Bevestig bestand verwijderen"
|
|
|
|
#: lazarusidestrconsts:liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Conflict "
|
|
|
|
#: lazarusidestrconsts:lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Conflict gevonden"
|
|
|
|
#: lazarusidestrconsts:lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisceconstants
|
|
msgid "Constants"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Constructor naam moet zijn 'init' (destructor moet zijn 'done')"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Inhoud"
|
|
|
|
#: lazarusidestrconsts:lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Contextgevoelige help"
|
|
|
|
#: lazarusidestrconsts:liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Context gevoellige help"
|
|
|
|
#: lazarusidestrconsts:liscontinue
|
|
msgid "Continue"
|
|
msgstr "Doorgaan"
|
|
|
|
#: lazarusidestrconsts:liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Doorgaan zonder het form te laden"
|
|
|
|
#: lazarusidestrconsts:liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Medewerkers"
|
|
|
|
#: lazarusidestrconsts:liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Parent vereist voor control"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Conversieopties"
|
|
|
|
#: lazarusidestrconsts:lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Conversiefout"
|
|
|
|
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM file to LFM"
|
|
msgstr "Converteer DFM bestand naar LFM"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdfmtolfm
|
|
msgid "Convert DFM file to LFM ..."
|
|
msgstr "Converteer .dfm-bestand naar .lfm ..."
|
|
|
|
#: lazarusidestrconsts:lispwconvertproject
|
|
msgid "Convert Delphi Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Converteer Delphi pakket naar Lazarus pakket"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphipackage
|
|
msgid "Convert Delphi package to Lazarus package ..."
|
|
msgstr "Converteer Delphi pakket naar een Lazarus pakket ..."
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi project to Lazarus project"
|
|
msgstr "Converteer Delphi project naar Lazarus project"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphiproject
|
|
msgid "Convert Delphi project to Lazarus project ..."
|
|
msgstr "Converteer Delphi project naar een Lazarus project ..."
|
|
|
|
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi unit to Lazarus unit"
|
|
msgstr "Converteer Delphi unit naar Lazarus unit"
|
|
|
|
#: lazarusidestrconsts:lismenuconvertdelphiunit
|
|
msgid "Convert Delphi unit to Lazarus unit ..."
|
|
msgstr "Converteer Delphi-unit naar Lazarus-unit ..."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Converteer node"
|
|
|
|
#: lazarusidestrconsts:srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Converteer tabs naar spaties in selectie"
|
|
|
|
#: lazarusidestrconsts:lismenucopy
|
|
msgid "Copy"
|
|
msgstr "Kopiëren"
|
|
|
|
#: lazarusidestrconsts:liscopyall
|
|
msgid "Copy All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Kopieerfout"
|
|
|
|
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
|
|
msgid "Copy all and hidden messages to clipboard"
|
|
msgstr "Kopieer alle (ook verborgen) berichten naar het klembord"
|
|
|
|
#: lazarusidestrconsts:liscopyallmessagestoclipboard
|
|
msgid "Copy all messages to clipboard"
|
|
msgstr "Kopieer alle berichten naar klipbord"
|
|
|
|
#: lazarusidestrconsts:liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Kopieerfout"
|
|
|
|
#: lazarusidestrconsts:uemcopyfilename
|
|
msgid "Copy filename"
|
|
msgstr "Kopieer bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
|
|
msgid "Copy selected Components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopieer geselecteerde componenten naar klipbord"
|
|
|
|
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
|
|
msgid "Copy selected messages to clipboard"
|
|
msgstr "Kopieer de geselecteerde boodschap naar het klembord"
|
|
|
|
#: lazarusidestrconsts:srkmeccopy
|
|
msgid "Copy selection to clipboard"
|
|
msgstr "Kopieer selectie naar klembord"
|
|
|
|
#: lazarusidestrconsts:lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr "Kopieer woord asl niets geselecteerd"
|
|
|
|
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Een geheel formulier kopiëren is niet geimplementeerd."
|
|
|
|
#: lazarusidestrconsts:rscopyright
|
|
msgid "Copyright:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Teller (.pp;1)"
|
|
|
|
#: lazarusidestrconsts:lisnpcreate
|
|
msgid "Create"
|
|
msgstr "Maak"
|
|
|
|
#: lazarusidestrconsts:lismenucreatepofile
|
|
msgid "Create .po files"
|
|
msgstr "Maak .po-bestanden"
|
|
|
|
#: lazarusidestrconsts:dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Maak definities voor %s folder"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Maak definities voor %s Project"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Maak definities voor Free Pascal Compiler"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr "Maak definities voor Free Pascal SVN broncode"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
|
|
msgid "Create Defines for Lazarus Directory"
|
|
msgstr "Maak definities voor Lazarusfolder"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Maak FPC-macro's en paden voor een fpc-projectfolder"
|
|
|
|
#: lazarusidestrconsts:lismenucreatefpdocfiles
|
|
msgid "Create FPDoc files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcocreatemakefile
|
|
msgid "Create Makefile"
|
|
msgstr "Maak MakeFile"
|
|
|
|
#: lazarusidestrconsts:lismenueditorcreatesubmenu
|
|
msgid "Create Submenu"
|
|
msgstr "Maak submenu"
|
|
|
|
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
|
|
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
|
|
msgstr "Maak een nieuwe cgi applicatie.%sHet bestand wordt door Lazarus bijgehouden."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Maak een nieuw editor-bestand.%sKies een type."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Maak een nieuw leeg tekst bestand."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
|
|
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
|
|
msgstr "Maak een nieuwe grafische applicatie.%sHet bestand wordt door Lazarus beheerd."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
|
|
msgid "Create a new pascal unit."
|
|
msgstr "Maak een nieuwe Pascal-unit."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
|
|
msgid "Create a new program."
|
|
msgstr "Maak een nieuw programma."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
|
|
msgid "Create a new program.%sThe program file is maintained by Lazarus."
|
|
msgstr "Maak een nieuw programma.%sHet programma wordt door Lazarus beheerd."
|
|
|
|
#: lazarusidestrconsts:lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Maak een nieuw project"
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Maak een nieuw project.%sKies een type."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Maak een nieuw standaard pakket.%sEen pakket is een verzameling units en componenten."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Maak een nieuwe unit met een LCL-formulier."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Maak een nieuwe unit met een datamodule."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Maak eerst een project!"
|
|
|
|
#: lazarusidestrconsts:liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscreateit
|
|
msgid "Create it"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pcreatenewfile
|
|
msgid "Create new file"
|
|
msgstr "Maak een nieuw bestand"
|
|
|
|
#: lazarusidestrconsts:liscreatenewproject
|
|
msgid "Create new project"
|
|
msgstr "Maak nieuw bestand"
|
|
|
|
#: lazarusidestrconsts:dlgruberbandcreationcolor
|
|
msgid "Creation"
|
|
msgstr "Creatie"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolctrl
|
|
msgid "Ctrl"
|
|
msgstr "Ctrl"
|
|
|
|
#: lazarusidestrconsts:liscurrent
|
|
msgid "Current"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Huidig project"
|
|
|
|
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
|
|
msgid "Current Project Directory"
|
|
msgstr "Huidige project folder"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertdatetime
|
|
msgid "Current date and time"
|
|
msgstr "Huidige datum en tijd"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertusername
|
|
msgid "Current username"
|
|
msgstr "Huidige username"
|
|
|
|
#: lazarusidestrconsts:dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Cursor voorbij EOL"
|
|
|
|
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Cursor kolom in huidige editor"
|
|
|
|
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Cursor beweeg commando's"
|
|
|
|
#: lazarusidestrconsts:liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Cursor rij in huidige editor"
|
|
|
|
#: lazarusidestrconsts:dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Aanpasbaar"
|
|
|
|
#: lazarusidestrconsts:liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Aanpasbaar Programma"
|
|
|
|
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
|
|
msgid "Custom Program%sA freepascal program."
|
|
msgstr "Aanpasbaar Programma%sEen Freepascalprogramma."
|
|
|
|
#: lazarusidestrconsts:liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Aanpasbare commando's"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Aanpasbare Opties"
|
|
|
|
#: lazarusidestrconsts:rsiwpcustomposition
|
|
msgid "Custom position"
|
|
msgstr "Aanpasbare positie"
|
|
|
|
#: lazarusidestrconsts:srkmeccustomtool
|
|
msgid "Custom tool %d"
|
|
msgstr "Aanpasbare Tool %d"
|
|
|
|
#: lazarusidestrconsts:lismenucut
|
|
msgid "Cut"
|
|
msgstr "Knippen"
|
|
|
|
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
|
|
msgid "Cut selected Components to clipboard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Knip geselecteerde componenten naar klipbord"
|
|
|
|
#: lazarusidestrconsts:srkmeccut
|
|
msgid "Cut selection to clipboard"
|
|
msgstr "Knip selectie naar klembord"
|
|
|
|
#: lazarusidestrconsts:liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Databases"
|
|
|
|
#: lazarusidestrconsts:lisdate
|
|
msgid "Date"
|
|
msgstr "Datum"
|
|
|
|
#: lazarusidestrconsts:liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uemdebugword
|
|
msgid "Debug"
|
|
msgstr "Debug"
|
|
|
|
#: lazarusidestrconsts:lismenuviewdebugoutput
|
|
msgid "Debug output"
|
|
msgstr "Debugger output"
|
|
|
|
#: lazarusidestrconsts:lismenudebugwindows
|
|
msgid "Debug windows"
|
|
msgstr "Debug schermen"
|
|
|
|
#: lazarusidestrconsts:lismendebuggeroptions
|
|
msgid "Debugger Options ..."
|
|
msgstr "Debuggeropties ..."
|
|
|
|
#: lazarusidestrconsts:lisdebuggererror
|
|
msgid "Debugger error"
|
|
msgstr "Debuggerfout"
|
|
|
|
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Debugger error%sOeps, de debugger is gecrashed%sSla uw werk op!%sKies Stop, en hoop voor het beste!"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Algemene debugger opties"
|
|
|
|
#: lazarusidestrconsts:lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Debugger ongeldig"
|
|
|
|
#: lazarusidestrconsts:dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Debugger pad toevoeging (geen):"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Specifieke opties debugger (hangt af van het type debugger)"
|
|
|
|
#: lazarusidestrconsts:dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Debuggertype en pad"
|
|
|
|
#: lazarusidestrconsts:dlgcodebugging
|
|
msgid "Debugging:"
|
|
msgstr "Debugging:"
|
|
|
|
#: lazarusidestrconsts:lisdecimal
|
|
msgid "Decimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgassemblerdefault
|
|
msgid "Default"
|
|
msgstr "Standaard"
|
|
|
|
#: lazarusidestrconsts:dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Standaard editorfont"
|
|
|
|
#: lazarusidestrconsts:dlgpasext
|
|
msgid "Default pascal extension"
|
|
msgstr "Standaard pascal extenties"
|
|
|
|
#: lazarusidestrconsts:dlgdefvaluecolor
|
|
msgid "Default value"
|
|
msgstr "Standaardwaarde"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Definieer"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Definieer recursief"
|
|
|
|
#: lazarusidestrconsts:lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Definieer templates"
|
|
|
|
#: lazarusidestrconsts:dlgeddelay
|
|
msgid "Delay"
|
|
msgstr "Vertraging"
|
|
|
|
#: lazarusidestrconsts:dlgeddelete
|
|
msgid "Delete"
|
|
msgstr "Verwijder"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenueditordeletefromtemplate
|
|
msgid "Delete From Template..."
|
|
msgstr "Verwijder van template ..."
|
|
|
|
#: lazarusidestrconsts:lismenueditordeleteitem
|
|
msgid "Delete Item"
|
|
msgstr "Verwijder item"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Verwijder laatste karakter"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Verwijder het oude pakket-bestand?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteallbreakpoints2
|
|
msgid "Delete all breakpoints in file %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Al deze bestanden verwijderen?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Verwijder dubbelzinnig bestand?"
|
|
|
|
#: lazarusidestrconsts:lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Verwijder karakter bij cursor"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Verwijder huidige regel"
|
|
|
|
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Verwijder afhankelijkheid voor %s?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Verwijderen mislukt"
|
|
|
|
#: lazarusidestrconsts:lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Verwijderen bestand mislukt"
|
|
|
|
#: lazarusidestrconsts:liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Verwijder laatste karakter"
|
|
|
|
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
|
|
msgid "Delete link"
|
|
msgstr "Verwijder link"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Verwijder node"
|
|
|
|
#: lazarusidestrconsts:lisdeleteoldfile
|
|
msgid "Delete old file %s%s%s?"
|
|
msgstr "Verwijder oud bestand %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
|
|
msgid "Delete old package file %s%s%s?"
|
|
msgstr "Verwijder oud pakket bestand %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmdeleteselection
|
|
msgid "Delete selection"
|
|
msgstr "Verwijder selectie"
|
|
|
|
#: lazarusidestrconsts:dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Verwijder template"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Verwijder tot het begin van de regel"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Verwijder tot het eind van de regel"
|
|
|
|
#: lazarusidestrconsts:srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Verwijder tot het eind van het woord"
|
|
|
|
#: lazarusidestrconsts:srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Verwijder tot het begin van het woord"
|
|
|
|
#: lazarusidestrconsts:srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Verwijder gehele tekst"
|
|
|
|
#: lazarusidestrconsts:lisdeletingoffilefailed
|
|
msgid "Deleting of file %s%s%s failed."
|
|
msgstr "Verwijderen van bestand %s%s%s mislukt."
|
|
|
|
#: lazarusidestrconsts:lisdelphi
|
|
msgid "Delphi"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgdelphi2ext
|
|
msgid "Delphi 2 Extensions"
|
|
msgstr "Delphi 2 extensies"
|
|
|
|
#: lazarusidestrconsts:dlgdeplhicomp
|
|
msgid "Delphi Compatible"
|
|
msgstr "Delphi compatibel"
|
|
|
|
#: lazarusidestrconsts:lisdelphiproject
|
|
msgid "Delphi project"
|
|
msgstr "Delphi project"
|
|
|
|
#: lazarusidestrconsts:lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Afhankelijkheid"
|
|
|
|
#: lazarusidestrconsts:lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Afhankelijkheid eigenschappen"
|
|
|
|
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Afhankelijkheid bestaat al"
|
|
|
|
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Afhankelijkheid zonder eigenaar: %s"
|
|
|
|
#: lazarusidestrconsts:lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Neerwaarts"
|
|
|
|
#: lazarusidestrconsts:listodoldescription
|
|
msgid "Description"
|
|
msgstr "Beschrijving"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdescriptionabstract
|
|
msgid "Description/Abstract"
|
|
msgstr "Beschrijving/Samenvatting"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Beschrijving:"
|
|
|
|
#: lazarusidestrconsts:lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Beschrijving: "
|
|
|
|
#: lazarusidestrconsts:liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Designer acties"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and Runtime"
|
|
msgstr "Designtime en Runtime"
|
|
|
|
#: lazarusidestrconsts:lispckoptsdesigntimeonly
|
|
msgid "Designtime only"
|
|
msgstr "Alleen tijdens het ontwerp"
|
|
|
|
#: lazarusidestrconsts:dlgdesktop
|
|
msgid "Desktop"
|
|
msgstr "Bureaublad"
|
|
|
|
#: lazarusidestrconsts:dlgdesktopfiles
|
|
msgid "Desktop files"
|
|
msgstr "Bureaubladbestanden"
|
|
|
|
#: lazarusidestrconsts:lisaf2pdestinationpackage
|
|
msgid "Destination Package"
|
|
msgstr "Doelpakket"
|
|
|
|
#: lazarusidestrconsts:lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Doeldirectorie"
|
|
|
|
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
|
|
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
|
|
msgstr "Doelfolder %s%s%s is ongeldig.%sKies a.u.b. een geldig pad."
|
|
|
|
#: lazarusidestrconsts:lismenudiff
|
|
msgid "Diff"
|
|
msgstr "Verschil"
|
|
|
|
#: lazarusidestrconsts:liskmdiffeditorfiles
|
|
msgid "Diff editor files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdigits
|
|
msgid "Digits:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Richting"
|
|
|
|
#: lazarusidestrconsts:lisdirectives
|
|
msgid "Directives"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Folder"
|
|
|
|
#: lazarusidestrconsts:dlgdirectorydoesnotexist
|
|
msgid "Directory does not exist"
|
|
msgstr "Folder bestaat niet"
|
|
|
|
#: lazarusidestrconsts:dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Folder voor bouwen van test projecten"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Folder niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lisfindfiledirectoryoptions
|
|
msgid "Directory options"
|
|
msgstr "Folder opties"
|
|
|
|
#: lazarusidestrconsts:lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdisablegroup
|
|
msgid "Disable Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdisabled
|
|
msgid "Disabled"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Wijzigingen verwerpen"
|
|
|
|
#: lazarusidestrconsts:dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Beeld"
|
|
|
|
#: lazarusidestrconsts:dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Display (niet voor win32, bv. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts:dlglnumsbct
|
|
msgid "Display Line Numbers in Run-time Error Backtraces"
|
|
msgstr "Toon regelnummers in Run-time Error Backtraces"
|
|
|
|
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Maak onderscheid tussen hoofd- en kleine letters. Bijv. A en a"
|
|
|
|
#: lazarusidestrconsts:dlgcfdividerdrawlevel
|
|
msgid "Divider Draw Level"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdonotclosetheide
|
|
msgid "Do not close the IDE"
|
|
msgstr "IDE niet sluiten"
|
|
|
|
#: lazarusidestrconsts:lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Sluit project niet"
|
|
|
|
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Geen sessie info opslaan"
|
|
|
|
#: lazarusidestrconsts:lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Splashscherm niet tonen"
|
|
|
|
#: lazarusidestrconsts:lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Toon dit bericht niet meer."
|
|
|
|
#: lazarusidestrconsts:dlgnotsplitlinefront
|
|
msgid "Do not split line In front of:"
|
|
msgstr "Splits een regel niet voor :"
|
|
|
|
#: lazarusidestrconsts:dlgnotsplitlineafter
|
|
msgid "Do not split line after:"
|
|
msgstr "Splits een regel niet na :"
|
|
|
|
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Weet u zeker dat alle wijzigingen in pakket %s geannuleerd moeten worden en het project opnieuw geladen moet worden?"
|
|
|
|
#: lazarusidestrconsts:lisconfirmlazarusrebuild
|
|
msgid "Do you want to rebuild Lazarus?"
|
|
msgstr "Wil je Lazarus opnieuw bouwen?"
|
|
|
|
#: lazarusidestrconsts:rsiwpdocked
|
|
msgid "Docked"
|
|
msgstr "Gedockt"
|
|
|
|
#: lazarusidestrconsts:lismvdocking
|
|
msgid "Docking"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdocumentationeditor
|
|
msgid "Documentation Editor"
|
|
msgstr "Documentatie bewerker"
|
|
|
|
#: lazarusidestrconsts:lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Domein"
|
|
|
|
#: lazarusidestrconsts:listodoldone
|
|
msgid "Done"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgdoubleclickline
|
|
msgid "Double click line"
|
|
msgstr "Dubble klik regel"
|
|
|
|
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
|
|
msgid "Double click on messages jumps (otherwise: single click)"
|
|
msgstr "Dubble klik regel op een bericht springt (anders: enkele klik)"
|
|
|
|
#: lazarusidestrconsts:dlgdownword
|
|
msgid "Down"
|
|
msgstr "Omlaag"
|
|
|
|
#: lazarusidestrconsts:dlgdragdroped
|
|
msgid "Drag Drop editing"
|
|
msgstr "Sleep-en-plaats bewerking"
|
|
|
|
#: lazarusidestrconsts:dlgdropfiles
|
|
msgid "Drop files"
|
|
msgstr "Sleep bestanden"
|
|
|
|
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "Nederlands"
|
|
|
|
#: lazarusidestrconsts:liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuenvironent
|
|
msgid "E&nvironment"
|
|
msgstr "I&nstellingen"
|
|
|
|
#: lazarusidestrconsts:lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsedit
|
|
msgid "Edit"
|
|
msgstr "Bewerken"
|
|
|
|
#: lazarusidestrconsts:liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Bewerk Code Templates"
|
|
|
|
#: lazarusidestrconsts:lispckediteditgeneraloptions
|
|
msgid "Edit General Options"
|
|
msgstr "Bewerk algemene opies"
|
|
|
|
#: lazarusidestrconsts:srkmeditkeys
|
|
msgid "Edit Keys"
|
|
msgstr "Bewerk toetsen"
|
|
|
|
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
|
|
msgid "Edit Options to compile package"
|
|
msgstr "Bewerk opties ter compilering pakket"
|
|
|
|
#: lazarusidestrconsts:lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Bewerk Tool"
|
|
|
|
#: lazarusidestrconsts:lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Bewerk code template"
|
|
|
|
#: lazarusidestrconsts:lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Bewerk context gevoelige Help"
|
|
|
|
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liseteditcustomscanners
|
|
msgid "Edit custom scanners (%s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Bewerk virtuele unit"
|
|
|
|
#: lazarusidestrconsts:dlgededit
|
|
msgid "Edit..."
|
|
msgstr "Bewerken ..."
|
|
|
|
#: lazarusidestrconsts:dlgedfiles
|
|
msgid "Editor files"
|
|
msgstr "Editor bestanden"
|
|
|
|
#: lazarusidestrconsts:dlgeditorfont
|
|
msgid "Editor font"
|
|
msgstr "Editor Fonts"
|
|
|
|
#: lazarusidestrconsts:dlgeditorfontheight
|
|
msgid "Editor font height"
|
|
msgstr "Tekstverwerker lettertype hoogte"
|
|
|
|
#: lazarusidestrconsts:liskmeditoroptions
|
|
msgid "Editor options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenueditoroptions
|
|
msgid "Editor options ..."
|
|
msgstr "Editor opties ..."
|
|
|
|
#: lazarusidestrconsts:uemeditorproperties
|
|
msgid "Editor properties"
|
|
msgstr "Editor Eigenschappen"
|
|
|
|
#: lazarusidestrconsts:dlgedelement
|
|
msgid "Element"
|
|
msgstr "Element"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr "Else"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr "ElseIf"
|
|
|
|
#: lazarusidestrconsts:lisemdemtpymethods
|
|
msgid "Emtpy Methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenablegroup
|
|
msgid "Enable Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Schakel Macro's in"
|
|
|
|
#: lazarusidestrconsts:rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenabled
|
|
msgid "Enabled"
|
|
msgstr "Ingeschakeld"
|
|
|
|
#: lazarusidestrconsts:lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "Ingeschakeld = Include %s in Ankers"
|
|
|
|
#: lazarusidestrconsts:lisenclose
|
|
msgid "Enclose"
|
|
msgstr "Omsluit"
|
|
|
|
#: lazarusidestrconsts:uemencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Omsluit Selectie"
|
|
|
|
#: lazarusidestrconsts:liskmencloseselection
|
|
msgid "Enclose selection"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuencloseselection
|
|
msgid "Enclose selection ..."
|
|
msgstr "Omsluit Selectie ..."
|
|
|
|
#: lazarusidestrconsts:uemencoding
|
|
msgid "Encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
|
|
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageenglish
|
|
msgid "English"
|
|
msgstr "Engels"
|
|
|
|
#: lazarusidestrconsts:lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Voer data in"
|
|
|
|
#: lazarusidestrconsts:lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Voer Start parameters in"
|
|
|
|
#: lazarusidestrconsts:lisentertransla
|
|
msgid "Enter translation language"
|
|
msgstr "Kies taal"
|
|
|
|
#: lazarusidestrconsts:dlgrunoenvironment
|
|
msgid "Environment"
|
|
msgstr "Omgeving"
|
|
|
|
#: lazarusidestrconsts:srkmcatenvmenu
|
|
msgid "Environment menu commands"
|
|
msgstr "Omgeving Menu commando's"
|
|
|
|
#: lazarusidestrconsts:lismenugeneraloptions
|
|
msgid "Environment options ..."
|
|
msgstr "Omgeving opties ..."
|
|
|
|
#: lazarusidestrconsts:lisccoerrorcaption
|
|
msgid "Error"
|
|
msgstr "Fout"
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Fout bij Lezen Pakket"
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Fout bij schrijven Pakket"
|
|
|
|
#: lazarusidestrconsts:lisiecoerroraccessingxml
|
|
msgid "Error accessing xml"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
|
|
msgid "Error accessing xml file %s%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Fout bij maken bestand"
|
|
|
|
#: lazarusidestrconsts:liserrorcreatinglrs
|
|
msgid "Error creating lrs"
|
|
msgstr "Fout bij maken lrs"
|
|
|
|
#: lazarusidestrconsts:liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Fout bij verwijderen bestand"
|
|
|
|
#: lazarusidestrconsts:liserrorin
|
|
msgid "Error in %s"
|
|
msgstr "Fout in %s"
|
|
|
|
#: lazarusidestrconsts:lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Fout in reguliere expressie"
|
|
|
|
#: lazarusidestrconsts:liserrorinitializingprogramserrors
|
|
msgid "Error initializing program%s%s%s%s%sError: %s"
|
|
msgstr "Fout tijdens initialiseren van programma%s%s%s%s%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisiecoerrorloadingxml
|
|
msgid "Error loading xml"
|
|
msgstr "Fout laden xml"
|
|
|
|
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
|
|
msgid "Error loading xml file %s%s%s:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Fout bij verplaatsen component"
|
|
|
|
#: lazarusidestrconsts:liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Fout bij verplaatsen component %s;%s"
|
|
|
|
#: lazarusidestrconsts:lisabcreationfailed
|
|
msgid "Error occured during Application Bundle creation: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Fout bij het verwerken van de lfm componenten stream."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorreading
|
|
msgid "Error reading %s%s%s%s%s"
|
|
msgstr "Fout bij lezen %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Fout bij lezen bestand"
|
|
|
|
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Fout bij lezen bestand: %s"
|
|
|
|
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Error bij lezen pakket lijst uit bestand%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
|
|
msgid "Error reading project info file %s%s%s%s%s"
|
|
msgstr "Fout bij lezen project info bestand %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liserrorreadingxmlfile
|
|
msgid "Error reading xml file %s%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Fout bij herbenoemen bestand"
|
|
|
|
#: lazarusidestrconsts:liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
|
|
msgid "Error while writing %s%s%s%s%s"
|
|
msgstr "Fout bij het schrijven %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
|
|
msgid "Error while writing project info file %s%s%s%s%s"
|
|
msgstr "Fout tijdens het schrijven project info file %s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lislazbuilderrorwritingfile
|
|
msgid "Error writing file"
|
|
msgstr "Fout bij schrijven bestand"
|
|
|
|
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Error bij schrijven pakketlijst naar bestand%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisinfobuilderror
|
|
msgid "Error..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserror
|
|
msgid "Error: "
|
|
msgstr "Fout:"
|
|
|
|
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Error: ongeldige compiler: %s"
|
|
|
|
#: lazarusidestrconsts:liserrors
|
|
msgid "Errors"
|
|
msgstr "Fouten"
|
|
|
|
#: lazarusidestrconsts:lisinfobuilderrors
|
|
msgid "Errors:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Evalueer/bewerk"
|
|
|
|
#: lazarusidestrconsts:lismenuevaluate
|
|
msgid "Evaluate/Modify ..."
|
|
msgstr "Evalueer/Wijzig ..."
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
|
|
msgid "Event Log"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liseverynthlinenumber
|
|
msgid "Every n-th line number:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Voorbeeld"
|
|
|
|
#: lazarusidestrconsts:lisexamples
|
|
msgid "Examples"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexcludefilter
|
|
msgid "Exclude Filter"
|
|
msgstr "Uitzonderingen filter"
|
|
|
|
#: lazarusidestrconsts:lisexcludefilter2
|
|
msgid "Exclude filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Voer uit Na"
|
|
|
|
#: lazarusidestrconsts:liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Voer uit Voor"
|
|
|
|
#: lazarusidestrconsts:lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr "Voer het commando uit Na"
|
|
|
|
#: lazarusidestrconsts:lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr "Voer het commando uit Voor"
|
|
|
|
#: lazarusidestrconsts:lisexecutionpaused
|
|
msgid "Execution paused"
|
|
msgstr "Uitvoering gepauzeerd"
|
|
|
|
#: lazarusidestrconsts:lisexecutionpausedadress
|
|
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
|
|
msgstr "uitvoering gepauzeerd%s Adres: $%s%s Procedure: %s%s Bestand: %s%s(Hier komt t.z.t. een assembler window)%s"
|
|
|
|
#: lazarusidestrconsts:lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Uitvoering afgebroken"
|
|
|
|
#: lazarusidestrconsts:lisexecutionstoppedon
|
|
msgid "Execution stopped%s"
|
|
msgstr "Uitvoering afgebroken%s"
|
|
|
|
#: lazarusidestrconsts:lispldexists
|
|
msgid "Exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsexit
|
|
msgid "Exit"
|
|
msgstr "Verlaat"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Verlaat zonder Opslaan"
|
|
|
|
#: lazarusidestrconsts:lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Volledige bestandsnaam van huidige editor bestand"
|
|
|
|
#: lazarusidestrconsts:lisexport
|
|
msgid "Export ..."
|
|
msgstr "Exporteer ..."
|
|
|
|
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Export lijst"
|
|
|
|
#: lazarusidestrconsts:liswlexpression
|
|
msgid "Expression"
|
|
msgstr "Expressie"
|
|
|
|
#: lazarusidestrconsts:lisexpression
|
|
msgid "Expression:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr "Unit path uitbreiden?"
|
|
|
|
#: lazarusidestrconsts:liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Extern gereedschap %d"
|
|
|
|
#: lazarusidestrconsts:lisexttoolexternaltools
|
|
msgid "External tools"
|
|
msgstr "Externe gereedschappen"
|
|
|
|
#: lazarusidestrconsts:srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Externe hulpmiddelen instellingen"
|
|
|
|
#: lazarusidestrconsts:dlgextracharspacing
|
|
msgid "Extra char spacing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Extra regel afstand"
|
|
|
|
#: lazarusidestrconsts:lisextract
|
|
msgid "Extract"
|
|
msgstr "Destilleer"
|
|
|
|
#: lazarusidestrconsts:uemextractproc
|
|
msgid "Extract Procedure"
|
|
msgstr "Destilleer procedure"
|
|
|
|
#: lazarusidestrconsts:srkmecextractproc
|
|
msgid "Extract procedure"
|
|
msgstr "Destilleer procedure"
|
|
|
|
#: lazarusidestrconsts:lismenuextractproc
|
|
msgid "Extract procedure ..."
|
|
msgstr "Destilleer procedure ..."
|
|
|
|
#: lazarusidestrconsts:lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "FPC Doc HTML pad"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr "FPC SVN broncode directory"
|
|
|
|
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
|
|
msgid "FPC Source Directory error"
|
|
msgstr "FPC directory fout"
|
|
|
|
#: lazarusidestrconsts:lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "FPC broncode directory"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
|
|
msgid "FPC source directory \"%s\" not found."
|
|
msgstr "FPC directory \"%s\" niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenufpdoceditor
|
|
msgid "FPDoc Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfpdoceditor
|
|
msgid "FPDoc editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
|
|
msgid "FPDoc files path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexttoolfailedtoruntool
|
|
msgid "Failed to run tool"
|
|
msgstr "Fout bij uitvoeren tool"
|
|
|
|
#: lazarusidestrconsts:dlgcofast
|
|
msgid "Faster Code"
|
|
msgstr "Snellere Code"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatefile
|
|
msgid "File"
|
|
msgstr "Bestand"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
|
|
msgid "File %s%s%s already exists in the project."
|
|
msgstr "Bestand %s%s%s bestaat reeds in het project."
|
|
|
|
#: lazarusidestrconsts:lisfilehaschangedsave
|
|
msgid "File %s%s%s has changed. Save?"
|
|
msgstr "Bestand %s%s%s is gewijzigd. Opslaan?"
|
|
|
|
#: lazarusidestrconsts:lisfileisvirtual
|
|
msgid "File %s%s%s is virtual."
|
|
msgstr "Bestand %s%s%s is Virtual."
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenotfound
|
|
msgid "File %s%s%s not found."
|
|
msgstr "Bestand %s%s%s niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lisfilenotfound2
|
|
msgid "File %s%s%s not found.%s"
|
|
msgstr "Bestand %s%s%s niet gevonden.%s"
|
|
|
|
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
|
|
msgid "File %s%s%s not found.%sDo you want to create it?%s"
|
|
msgstr "Bestand %s%s%s niet gevonden.%sWilt u het bestand maken?%s"
|
|
|
|
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
|
|
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Bestand %s%s%s%slijkt niet op een tekst bestand.%sToch openen?"
|
|
|
|
#: lazarusidestrconsts:lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Bestand eigenschappen"
|
|
|
|
#: lazarusidestrconsts:lisfilesettings
|
|
msgid "File Settings ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisaf2pfiletype
|
|
msgid "File Type"
|
|
msgstr "Bestandstype"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Bestand bestaat reeds"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
|
|
msgid "File already in package"
|
|
msgstr "Bestand al aanwezig in pakket"
|
|
|
|
#: lazarusidestrconsts:lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Bestands extensie"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Bestand is reeds aanwezig in pakket"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Bestand is in project"
|
|
|
|
#: lazarusidestrconsts:lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "Bestand is niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Bestand is alleen-lezen"
|
|
|
|
#: lazarusidestrconsts:lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Bestand wordt gebruikt"
|
|
|
|
#: lazarusidestrconsts:lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilefilemaskbak
|
|
msgid "File mask (*;*.*;*.bak?)"
|
|
msgstr "Bestandsfilter (*;*.*;*.bak?)"
|
|
|
|
#: lazarusidestrconsts:srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Bestandsmenu acties"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilename
|
|
msgid "File name:"
|
|
msgstr "Bestandsnaam:"
|
|
|
|
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Bestand niet uitvoerbaar"
|
|
|
|
#: lazarusidestrconsts:lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Bestand niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Bestand niet met kleine letters"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Bestand niet bewaard"
|
|
|
|
#: lazarusidestrconsts:lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "Bestand is geen tekst"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Bestand is geen unit"
|
|
|
|
#: lazarusidestrconsts:lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr "Bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Bestandsnaam verschilt van pakketnaam"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Bestandsnaam in gebruik in ander pakket"
|
|
|
|
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Bestand in gebruik door project"
|
|
|
|
#: lazarusidestrconsts:lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispefilename
|
|
msgid "Filename:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Bestandsnaam: %s"
|
|
|
|
#: lazarusidestrconsts:dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Bestanden"
|
|
|
|
#: lazarusidestrconsts:lisfilter
|
|
msgid "Filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenufind
|
|
msgid "Find"
|
|
msgstr "Zoeken"
|
|
|
|
#: lazarusidestrconsts:lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Zoek &Volgende"
|
|
|
|
#: lazarusidestrconsts:lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Zoek V&orige"
|
|
|
|
#: lazarusidestrconsts:lismenufindinfiles
|
|
msgid "Find &in files ..."
|
|
msgstr "Zoek in &Bestanden ..."
|
|
|
|
#: lazarusidestrconsts:lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at cursor"
|
|
msgstr "Zoek Declaraties (op cursor)"
|
|
|
|
#: lazarusidestrconsts:uemfindidentifierreferences
|
|
msgid "Find Identifier References"
|
|
msgstr "Zoek Identifier Referenties"
|
|
|
|
#: lazarusidestrconsts:lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Zoek Identifier Referenties ..."
|
|
|
|
#: lazarusidestrconsts:lismenutemplatefindnext
|
|
msgid "Find Next"
|
|
msgstr "Zoek Volgende"
|
|
|
|
#: lazarusidestrconsts:lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Zoek referenties"
|
|
|
|
#: lazarusidestrconsts:srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Zoek blok Einde"
|
|
|
|
#: lazarusidestrconsts:srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Zoek blok Start"
|
|
|
|
#: lazarusidestrconsts:lismenufindcodeblockstart
|
|
msgid "Find code block start"
|
|
msgstr "Spring naar begin code blok "
|
|
|
|
#: lazarusidestrconsts:liscomppalfindcomponent
|
|
msgid "Find component"
|
|
msgstr "Vind component"
|
|
|
|
#: lazarusidestrconsts:srkmecfinddeclaration
|
|
msgid "Find declaration"
|
|
msgstr "Zoek Declaratie"
|
|
|
|
#: lazarusidestrconsts:srkmecfindidentifierrefs
|
|
msgid "Find identifier references"
|
|
msgstr "Vind identifier referenties"
|
|
|
|
#: lazarusidestrconsts:srkmecfindinfiles
|
|
msgid "Find in files"
|
|
msgstr "Vind in bestanden"
|
|
|
|
#: lazarusidestrconsts:liskmfindincremental
|
|
msgid "Find incremental"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecfindnext
|
|
msgid "Find next"
|
|
msgstr "Vind volgende"
|
|
|
|
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
|
|
msgid "Find next word occurrence"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Vind of hernoem identifier"
|
|
|
|
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
|
|
msgid "Find other end of code block"
|
|
msgstr "Spring naar eind code blok"
|
|
|
|
#: lazarusidestrconsts:lisfpfindpalettecomponent
|
|
msgid "Find palette component"
|
|
msgstr "Vind palette component"
|
|
|
|
#: lazarusidestrconsts:srkmecfindprevious
|
|
msgid "Find previous"
|
|
msgstr "Vind vorige"
|
|
|
|
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
|
|
msgid "Find previous word occurrence"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecfindproceduredefinition
|
|
msgid "Find procedure definiton"
|
|
msgstr "Vind procedure definitie"
|
|
|
|
#: lazarusidestrconsts:srkmecfindproceduremethod
|
|
msgid "Find procedure method"
|
|
msgstr "Vind procedure methode"
|
|
|
|
#: lazarusidestrconsts:srkmecfind
|
|
msgid "Find text"
|
|
msgstr "Zoek tekst"
|
|
|
|
#: lazarusidestrconsts:dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Zoek Tekst (op cursor)"
|
|
|
|
#: lazarusidestrconsts:rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "Fins"
|
|
|
|
#: lazarusidestrconsts:lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "Repareer .lfm-bestand"
|
|
|
|
#: lazarusidestrconsts:lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
|
|
msgid "Focus messages after compilation"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecjumptoeditor
|
|
msgid "Focus to source editor"
|
|
msgstr "Focus naar Broncode Editor"
|
|
|
|
#: lazarusidestrconsts:liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Volg cursor"
|
|
|
|
#: lazarusidestrconsts:lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Lettertype zonder UTF-8"
|
|
|
|
#: lazarusidestrconsts:lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Hernoemen afdwingen"
|
|
|
|
#: lazarusidestrconsts:dlgforecolor
|
|
msgid "Foreground color"
|
|
msgstr "Voorgrond kleur"
|
|
|
|
#: lazarusidestrconsts:dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Formulierbewerker"
|
|
|
|
#: lazarusidestrconsts:rsformdatafiledfm
|
|
msgid "Form data file (*.dfm)|*.dfm"
|
|
msgstr "Formulier data bestand (*.dfm)|*.dfm"
|
|
|
|
#: lazarusidestrconsts:lisformloaderror
|
|
msgid "Form load error"
|
|
msgstr "Fout bij laden formulier"
|
|
|
|
#: lazarusidestrconsts:lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Formatteerfout"
|
|
|
|
#: lazarusidestrconsts:dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Forms"
|
|
|
|
#: lazarusidestrconsts:lismenuviewforms
|
|
msgid "Forms..."
|
|
msgstr "Forms..."
|
|
|
|
#: lazarusidestrconsts:lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisvsrforwardsearch
|
|
msgid "Forward Search"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmorderforwardone
|
|
msgid "Forward one"
|
|
msgstr "Een vooruit"
|
|
|
|
#: lazarusidestrconsts:lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfreepascal
|
|
msgid "Free Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfreepascalcompilernotfound
|
|
msgid "Free Pascal Compiler not found"
|
|
msgstr "FP compiler niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
|
|
msgid "Free Pascal Sources not found"
|
|
msgstr "FP bronnen niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcefile
|
|
msgid "FreePascal source file"
|
|
msgstr "FreePascal bron bestand"
|
|
|
|
#: lazarusidestrconsts:lisfreepascalsourcedirectory
|
|
msgid "Freepascal source directory"
|
|
msgstr "FreePascal bronnen directory"
|
|
|
|
#: lazarusidestrconsts:rslanguagefrench
|
|
msgid "French"
|
|
msgstr "Frans"
|
|
|
|
#: lazarusidestrconsts:lisfunction
|
|
msgid "Function"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Functie: toevoegen pad scheidingsteken"
|
|
|
|
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
|
|
msgid "Function: chomp path delimiter"
|
|
msgstr "Functie: afhakken pad scheidingsteken"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Functie: destilleer bestandsextensie"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Functie: destilleer alleen bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Functie: destilleer bestandsnaam+extensie"
|
|
|
|
#: lazarusidestrconsts:listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Functie: destilleer pad naar bestand"
|
|
|
|
#: lazarusidestrconsts:dlggpccomp
|
|
msgid "GPC (GNU Pascal Compiler) Compatible"
|
|
msgstr "GPC (GNU Pascal Compiler) Compatibel"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertgplnotice
|
|
msgid "GPL notice"
|
|
msgstr "GPL bericht"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertgeneral
|
|
msgid "General"
|
|
msgstr "Algemeen"
|
|
|
|
#: lazarusidestrconsts:lispckeditgeneraloptions
|
|
msgid "General Options"
|
|
msgstr "Algemene Opties"
|
|
|
|
#: lazarusidestrconsts:srkmecenvironmentoptions
|
|
msgid "General environment options"
|
|
msgstr "Algemene omgeving Opties"
|
|
|
|
#: lazarusidestrconsts:dlgcodbx
|
|
msgid "Generate Debugging Info For DBX (Slows Compiling)"
|
|
msgstr "genereer Debugging info voor DBX (Compileert langzamer)"
|
|
|
|
#: lazarusidestrconsts:dlgcogdb
|
|
msgid "Generate Debugging Info For GDB (Slows Compiling)"
|
|
msgstr "Genereer Debugging info voor GDB (Compileert langzamer)"
|
|
|
|
#: lazarusidestrconsts:dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Genereer code voor gprof"
|
|
|
|
#: lazarusidestrconsts:dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Genereer code voor valgrind"
|
|
|
|
#: lazarusidestrconsts:dlgcogenerate
|
|
msgid "Generate:"
|
|
msgstr "Genereer:"
|
|
|
|
#: lazarusidestrconsts:rslanguagegerman
|
|
msgid "German"
|
|
msgstr "Duits"
|
|
|
|
#: lazarusidestrconsts:dlggetposition
|
|
msgid "Get position"
|
|
msgstr "positie"
|
|
|
|
#: lazarusidestrconsts:lispldglobal
|
|
msgid "Global"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
|
|
msgid "Global Source Path addition"
|
|
msgstr "Globaal Broncode Pad toevoeging"
|
|
|
|
#: lazarusidestrconsts:srkmecgotomarker
|
|
msgid "Go to Marker %d"
|
|
msgstr "Ga naar Marker %d"
|
|
|
|
#: lazarusidestrconsts:srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Ga naar tekstverwerker %d"
|
|
|
|
#: lazarusidestrconsts:srkmecgotolinenumber
|
|
msgid "Go to line number"
|
|
msgstr "Ga naar lijn nummer"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker0
|
|
msgid "Go to marker 0"
|
|
msgstr "Ga naar marker 0"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker1
|
|
msgid "Go to marker 1"
|
|
msgstr "Ga naar marker 1"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker2
|
|
msgid "Go to marker 2"
|
|
msgstr "Ga naar marker 2"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker3
|
|
msgid "Go to marker 3"
|
|
msgstr "Ga naar marker 3"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker4
|
|
msgid "Go to marker 4"
|
|
msgstr "Ga naar marker 4"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker5
|
|
msgid "Go to marker 5"
|
|
msgstr "Ga naar marker 5"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker6
|
|
msgid "Go to marker 6"
|
|
msgstr "Ga naar marker 6"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker7
|
|
msgid "Go to marker 7"
|
|
msgstr "Ga naar marker 7"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker8
|
|
msgid "Go to marker 8"
|
|
msgstr "Ga naar marker 8"
|
|
|
|
#: lazarusidestrconsts:liskmgotomarker9
|
|
msgid "Go to marker 9"
|
|
msgstr "Ga naar marker 9"
|
|
|
|
#: lazarusidestrconsts:srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Ga naar bijpassende haak"
|
|
|
|
#: lazarusidestrconsts:srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Ga naar volgende tekstverwerker"
|
|
|
|
#: lazarusidestrconsts:srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Ga naar vorige tekstverwerker"
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecgotoincludedirective
|
|
msgid "Go to to include directive of current include file"
|
|
msgstr "Ga naar include opdracht van huidig include bestand"
|
|
|
|
#: lazarusidestrconsts:listodogoto
|
|
msgid "Goto"
|
|
msgstr "Ga naar"
|
|
|
|
#: lazarusidestrconsts:srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Ga naar XY"
|
|
|
|
#: lazarusidestrconsts:lismenugotoincludedirective
|
|
msgid "Goto include directive"
|
|
msgstr "Ga naar include directive"
|
|
|
|
#: lazarusidestrconsts:lismenugotoline
|
|
msgid "Goto line ..."
|
|
msgstr "Ga naar lijn ..."
|
|
|
|
#: lazarusidestrconsts:lisuegotoline
|
|
msgid "Goto line :"
|
|
msgstr "Ga naar regel :"
|
|
|
|
#: lazarusidestrconsts:uemnextbookmark
|
|
msgid "Goto next Bookmark"
|
|
msgstr "Ga naar volgend Bookmark"
|
|
|
|
#: lazarusidestrconsts:uemprevbookmark
|
|
msgid "Goto previous Bookmark"
|
|
msgstr "Ga naar vorig Bookmark"
|
|
|
|
#: lazarusidestrconsts:listodolistgotoline
|
|
msgid "Goto selected source line"
|
|
msgstr "Ga naar geselecteerde broncode regel"
|
|
|
|
#: lazarusidestrconsts:srkmgrabkey
|
|
msgid "Grab key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmgrabsecondkey
|
|
msgid "Grab second key"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Kleur opnemen"
|
|
|
|
#: lazarusidestrconsts:dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Raster"
|
|
|
|
#: lazarusidestrconsts:dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Rasterkleur"
|
|
|
|
#: lazarusidestrconsts:dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Rastergrootte X"
|
|
|
|
#: lazarusidestrconsts:dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Rastergrootte Y"
|
|
|
|
#: lazarusidestrconsts:lisgroup
|
|
msgid "Group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecguessmisplacedifdef
|
|
msgid "Guess misplaced $IFDEF"
|
|
msgstr "Corrigeer verkeerde $IFDEF"
|
|
|
|
#: lazarusidestrconsts:lismenuguessmisplacedifdef
|
|
msgid "Guess misplaced IFDEF/ENDIF"
|
|
msgstr "Corrigeer verkeerde IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts:lismenuguessunclosedblock
|
|
msgid "Guess unclosed block"
|
|
msgstr "Corrigeer open blok"
|
|
|
|
#: lazarusidestrconsts:dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Richtlijnen"
|
|
|
|
#: lazarusidestrconsts:dlgguttercolor
|
|
msgid "Gutter color"
|
|
msgstr "Goot kleur"
|
|
|
|
#: lazarusidestrconsts:dlggutterwidth
|
|
msgid "Gutter width"
|
|
msgstr "Goot breedte"
|
|
|
|
#: lazarusidestrconsts:lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Halve pagina scroll"
|
|
|
|
#: lazarusidestrconsts:lismenueditorhandleonclickevent
|
|
msgid "Handle OnClick Event"
|
|
msgstr "Verwerk OnClick-event"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisaf2phasregisterprocedure
|
|
msgid "Has Register procedure"
|
|
msgstr "Heeft Register procedure"
|
|
|
|
#: lazarusidestrconsts:lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Header commentaar voor klasse"
|
|
|
|
#: lazarusidestrconsts:dlgheapsize
|
|
msgid "Heap Size"
|
|
msgstr "Heap grootte"
|
|
|
|
#: lazarusidestrconsts:rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "Hebreeuws"
|
|
|
|
#: lazarusidestrconsts:dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Hoogte:"
|
|
|
|
#: lazarusidestrconsts:lispckedithelp
|
|
msgid "Help"
|
|
msgstr "Help"
|
|
|
|
#: lazarusidestrconsts:lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Help Opties"
|
|
|
|
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for FreePascal Compiler message"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Help menu acties"
|
|
|
|
#: lazarusidestrconsts:lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Help selecteren"
|
|
|
|
#: lazarusidestrconsts:lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Verberg IDE vensters bij uitvoeren"
|
|
|
|
#: lazarusidestrconsts:uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
|
|
msgstr "Hint: De maak resourcestring functie verwacht een string constante.%sSelecteer a.u.b. alleen een string expressie en probeer nogmaals."
|
|
|
|
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgedhintcommand
|
|
msgid "Hint: click on the command you want to edit"
|
|
msgstr "Hint: klik op de actie die u wilt bewerken"
|
|
|
|
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
|
|
msgstr "Hint: u kunt het pad naar de compiler opgeven in Omgeving -> Omgevingsopties -> Bestanden -> Compiler Pad"
|
|
|
|
#: lazarusidestrconsts:dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Hints voor componenten palet"
|
|
|
|
#: lazarusidestrconsts:dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Hints voor snelknoppen in hoofdbalk (openen, opslaan, ...)"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildhint
|
|
msgid "Hints:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Home toets springt naar dichtsbijzijnde begin"
|
|
|
|
#: lazarusidestrconsts:lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Horizontaal"
|
|
|
|
#: lazarusidestrconsts:dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Horizontale rasterafstand"
|
|
|
|
#: lazarusidestrconsts:dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Host applicatie"
|
|
|
|
#: lazarusidestrconsts:uenotimplcapagain
|
|
msgid "I told You: Not implemented yet"
|
|
msgstr "Nog niet geimplementeerd (Yoda rant)"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmid
|
|
msgid "ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liside
|
|
msgid "IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "IDE Integratie"
|
|
|
|
#: lazarusidestrconsts:lisideintf
|
|
msgid "IDE Interface"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IDE opties:"
|
|
|
|
#: lazarusidestrconsts:lismenuideinternals
|
|
msgid "IDE internals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uepins
|
|
msgid "INS"
|
|
msgstr "INS"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsidentifier
|
|
msgid "Identifier"
|
|
msgstr "Identifier"
|
|
|
|
#: lazarusidestrconsts:lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgedidcomlet
|
|
msgid "Identifier completion"
|
|
msgstr "Identifier completering"
|
|
|
|
#: lazarusidestrconsts:lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Identifier lengte:"
|
|
|
|
#: lazarusidestrconsts:dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Identifier beleid"
|
|
|
|
#: lazarusidestrconsts:lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Identifier: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr "If"
|
|
|
|
#: lazarusidestrconsts:uenotimpltext
|
|
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
|
|
msgstr "Als u deze feature kunt implementeren, mail naar lazarus@miraclec.com"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsifdef
|
|
msgid "IfDef"
|
|
msgstr "IfDef"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr "IfNDef"
|
|
|
|
#: lazarusidestrconsts:dlgignoreverb
|
|
msgid "Ignore"
|
|
msgstr "Negeren"
|
|
|
|
#: lazarusidestrconsts:lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Negeer Space"
|
|
|
|
#: lazarusidestrconsts:lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Aantal te negeren spaties"
|
|
|
|
#: lazarusidestrconsts:lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
|
|
msgid "Ignore and save package now"
|
|
msgstr "Negeer en sla pakket nu op"
|
|
|
|
#: lazarusidestrconsts:lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr "Negeer binaire bestanden"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Negeer verschillen in regeleinden (bv. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
|
|
msgid "Ignore disk changes"
|
|
msgstr "Negeer wijzigingen op disk"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Negeer toevoegingen en verwijderingen van lege regels"
|
|
|
|
#: lazarusidestrconsts:lisignoremissingfile
|
|
msgid "Ignore missing file"
|
|
msgstr "Negeer afwezig bestand"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Negeer spaties (regelscheiding karakters niet meegeteld)"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Negeer spaties aan regeleinde"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Negeer spaties aan begin van regel"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Negeer deze exceptions"
|
|
|
|
#: lazarusidestrconsts:lisignoreusetformasancestor
|
|
msgid "Ignore, use TForm as ancestor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr "Ime Str"
|
|
|
|
#: lazarusidestrconsts:lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Import lijst"
|
|
|
|
#: lazarusidestrconsts:dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Voor methoden"
|
|
|
|
#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr "Neem op"
|
|
|
|
#: lazarusidestrconsts:dlgassertcode
|
|
msgid "Include Assertion Code"
|
|
msgstr "Gebruik assertie code"
|
|
|
|
#: lazarusidestrconsts:dlgcoincfiles
|
|
msgid "Include Files (-Fi):"
|
|
msgstr "Include bestanden (-Fi):"
|
|
|
|
#: lazarusidestrconsts:lisincludefilter
|
|
msgid "Include Filter"
|
|
msgstr "Include filter"
|
|
|
|
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
|
|
msgid "Include Version Info in executable"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Include bestand"
|
|
|
|
#: lazarusidestrconsts:lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Include pad"
|
|
|
|
#: lazarusidestrconsts:lisfindfileincludesubdirectories
|
|
msgid "Include sub directories"
|
|
msgstr "Include sub directories"
|
|
|
|
#: lazarusidestrconsts:dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Include systeemvariabelen"
|
|
|
|
#: lazarusidestrconsts:lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Opgenomen door"
|
|
|
|
#: lazarusidestrconsts:lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Incrementeel Zoeken"
|
|
|
|
#: lazarusidestrconsts:srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Blok Inspringen"
|
|
|
|
#: lazarusidestrconsts:dlgindentcodeto
|
|
msgid "Indent code to"
|
|
msgstr "Laat code inspringen tot"
|
|
|
|
#: lazarusidestrconsts:lismenuindentselection
|
|
msgid "Indent selection"
|
|
msgstr "Selectie Inspringen"
|
|
|
|
#: lazarusidestrconsts:lisindex
|
|
msgid "Index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "Indonesisch"
|
|
|
|
#: lazarusidestrconsts:lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Informatie over %s"
|
|
|
|
#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
|
|
msgid "Inherit from an existing component."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcoinherited
|
|
msgid "Inherited"
|
|
msgstr "Overerfd"
|
|
|
|
#: lazarusidestrconsts:lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolinsert
|
|
msgid "Insert"
|
|
msgstr "Invoegen"
|
|
|
|
#: lazarusidestrconsts:liskminsertifdef
|
|
msgid "Insert $IFDEF"
|
|
msgstr "Voeg $IFDEF in"
|
|
|
|
#: lazarusidestrconsts:lismenuconditionalselection
|
|
msgid "Insert $IFDEF..."
|
|
msgstr "$IFDEF Invoegen ..."
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Invoegen CVS Keyword Auteur"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Invoegen CVS keyword Datum"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Invoegen CVS keyword Header"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Invoegen CVS keyword ID"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Invoegen CVS keyword Log"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Invoegen CVS keyword Naam"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Invoegen CVS keyword Revisie"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Invoegen CVS keyword Broncode"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "ChangeLog item toevoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Delphi 5 Compiler Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Delphi 5 Directorie Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Delphi 5 Project Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Delphi 6 Compiler Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Delphi 6 Directorie Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Delphi 6 Project Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Delphi 7 Compiler Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Delphi 7 Directorie Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Delphi 7 Project Template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Invoegen FP Compiler Template"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Invoegen FP project Template"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr "Voeg Free Pascal SVN broncode template in"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
|
|
msgid "Insert From Template..."
|
|
msgstr "Invoegen van Template ..."
|
|
|
|
#: lazarusidestrconsts:srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Invoegen GPL notice"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Kylix 3 Compiler template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Kylix 3 Directorie template invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Kylix 3 Project template invoegen"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "LGPL melding invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
|
|
msgid "Insert Lazarus Directory Template"
|
|
msgstr "Lazarus Directorie Template invoegen"
|
|
|
|
#: lazarusidestrconsts:lisctinsertmacro
|
|
msgid "Insert Macro"
|
|
msgstr "Macro invoegen"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Invoeg mode"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
|
|
msgid "Insert New Item (after)"
|
|
msgstr "Nieuw Item toevoegen (na)"
|
|
|
|
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
|
|
msgid "Insert New Item (before)"
|
|
msgstr "Nieuw Item toevoegen (voor)"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Invoegen Template"
|
|
|
|
#: lazarusidestrconsts:listddinserttodo
|
|
msgid "Insert ToDo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:ueminserttodo
|
|
msgid "Insert Todo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Alfabetisch invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Voeg \"Vet\" opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Voeg \"code\" opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Context gevoelig invoegen"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Huidige datum tijd invoegen"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Huidige gebruikers naam invoegen"
|
|
|
|
#: lazarusidestrconsts:liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Voeg datum en tijd in"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertcharacter
|
|
msgid "Insert from Character Map"
|
|
msgstr "Invoegen van Karakter Map"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Invoegen vanaf de karaktermap"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Voeg \"schuin\" opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Node als \"child\" invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Node onder invoegen"
|
|
|
|
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Voeg opmerking opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Spatie achter invoegen"
|
|
|
|
#: lazarusidestrconsts:dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Spatie voor invoegen"
|
|
|
|
#: lazarusidestrconsts:lismenuinserttext
|
|
msgid "Insert text"
|
|
msgstr "Invoegen Tekst"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Voeg \"onderstreep\" opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Voeg gebruikersnaam in"
|
|
|
|
#: lazarusidestrconsts:liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Voeg var opmaak-tag in"
|
|
|
|
#: lazarusidestrconsts:liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Inspecteer"
|
|
|
|
#: lazarusidestrconsts:lismenuinspect
|
|
msgid "Inspect ..."
|
|
msgstr "Inspecteer ..."
|
|
|
|
#: lazarusidestrconsts:lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Installeren"
|
|
|
|
#: lazarusidestrconsts:lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Installeer bij volgende start"
|
|
|
|
#: lazarusidestrconsts:lispckeditinstallpackageintheide
|
|
msgid "Install package in the IDE"
|
|
msgstr "Pakket in IDE installeren"
|
|
|
|
#: lazarusidestrconsts:lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Installeer selectie"
|
|
|
|
#: lazarusidestrconsts:lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr "Installatie mislukt"
|
|
|
|
#: lazarusidestrconsts:lispckexplinstalled
|
|
msgid "Installed"
|
|
msgstr "Geinstalleerd"
|
|
|
|
#: lazarusidestrconsts:lisinstalledpackages
|
|
msgid "Installed Packages"
|
|
msgstr "Geinstalleerde pakketten"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "De installatie van pakket %s zal automatisch het volgende package installeren:"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "De installatie van pakket %s zal automatisch de volgende pakket installeren:"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrminterface
|
|
msgid "Interface"
|
|
msgstr "Interface"
|
|
|
|
#: lazarusidestrconsts:listcompilerinternalerror
|
|
msgid "Internal compiler error! (%d)"
|
|
msgstr "Interne compileer fout! (%d)"
|
|
|
|
#: lazarusidestrconsts:dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Interval in seconden"
|
|
|
|
#: lazarusidestrconsts:lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Ongeldige Ancestor Type"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidcircle
|
|
msgid "Invalid Circle"
|
|
msgstr "Ongeldige Cirkel"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Ongeldige Class naam"
|
|
|
|
#: lazarusidestrconsts:lisinvalidcompilerfilename
|
|
msgid "Invalid Compiler Filename"
|
|
msgstr "Ongeldige compiler bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
|
|
msgid "Invalid Exclude filter"
|
|
msgstr "Ongeldig Exclude filter"
|
|
|
|
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
|
|
msgid "Invalid Free Pascal source directory"
|
|
msgstr "Ongeldige Free Pascal broncode directory"
|
|
|
|
#: lazarusidestrconsts:lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Ongeldige Identifier"
|
|
|
|
#: lazarusidestrconsts:lispublprojinvalidincludefilter
|
|
msgid "Invalid Include filter"
|
|
msgstr "Ongeldig Include filter"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Ongeldige Min-Max versie"
|
|
|
|
#: lazarusidestrconsts:lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Ongeldig Package"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Ongeldige Pakketnaam"
|
|
|
|
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Ongeldige Pascal Identifier"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Ongeldige Resourcestring sectie"
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Ongeldige unit naam"
|
|
|
|
#: lazarusidestrconsts:lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Ongeldige unit naam: %s"
|
|
|
|
#: lazarusidestrconsts:lisinvalidcircle
|
|
msgid "Invalid circle"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Ongeldig commando"
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
|
|
msgid "Invalid compiler filename"
|
|
msgstr "Ongeldige compiler bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Ongeldige component Class"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Ongeldige debugger bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Ongeldige verwijdering"
|
|
|
|
#: lazarusidestrconsts:lisinvaliddestinationdirectory
|
|
msgid "Invalid destination directory"
|
|
msgstr "Ongeldige destinatie directory"
|
|
|
|
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Ongeldige expressie.%sHint: De \"Make Resourcestring\" Functie verwacht een string in een enkel bestand. Selecteer de expressie en probeer het opnieuw."
|
|
|
|
#: lazarusidestrconsts:lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Ongeldig bestand"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Ongeldige bestands extensie"
|
|
|
|
#: lazarusidestrconsts:lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Ongeldige bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
|
|
msgid "Invalid make filename"
|
|
msgstr "Ongeldige Maak bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Ongeldige maximum versie"
|
|
|
|
#: lazarusidestrconsts:lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Ongeldige minimum versie"
|
|
|
|
#: lazarusidestrconsts:lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Ongeldige meervoudige selectie"
|
|
|
|
#: lazarusidestrconsts:liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Ongeldige optie op positie %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts:lisaf2pinvalidpackageid
|
|
msgid "Invalid package ID: %s%s%s"
|
|
msgstr "Ongeldige package ID: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Ongeldige pakket bestandsextensie"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Ongeldige pakket bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Ongeldige pakketnaam"
|
|
|
|
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Ongeldige pakket type"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidpackagename
|
|
msgid "Invalid packagename"
|
|
msgstr "Ongeldige pakketnaam"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Ongeldige parent"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Ongeldige parent node"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
|
|
msgid "Invalid pascal unit name"
|
|
msgstr "Ongeldige Pascal unit naam"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Vorige node is ongeldig"
|
|
|
|
#: lazarusidestrconsts:lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Ongeldige proc naam"
|
|
|
|
#: lazarusidestrconsts:lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Ongeldige project bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Ongeldige selectie"
|
|
|
|
#: lazarusidestrconsts:lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Ongeldige unit bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Ongeldige unit naam"
|
|
|
|
#: lazarusidestrconsts:lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Ongeldige variabele naam"
|
|
|
|
#: lazarusidestrconsts:lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Ongeldige versie"
|
|
|
|
#: lazarusidestrconsts:dlgedinvert
|
|
msgid "Invert"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:ueminvertassignment
|
|
msgid "Invert Assignment"
|
|
msgstr "Draai toekenning om"
|
|
|
|
#: lazarusidestrconsts:srkmecinvertassignment
|
|
msgid "Invert assignment"
|
|
msgstr "Draai toekenning om"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "Itiliaans"
|
|
|
|
#: lazarusidestrconsts:dlgedital
|
|
msgid "Italic"
|
|
msgstr "Italic"
|
|
|
|
#: lazarusidestrconsts:dlgoiitemheight
|
|
msgid "Item height"
|
|
msgstr "Item hoogte"
|
|
|
|
#: lazarusidestrconsts:lisjitform
|
|
msgid "JIT Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "Japans"
|
|
|
|
#: lazarusidestrconsts:lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Spring naar selectie"
|
|
|
|
#: lazarusidestrconsts:lismenujumpback
|
|
msgid "Jump back"
|
|
msgstr "Spring terug"
|
|
|
|
#: lazarusidestrconsts:lismenujumpforward
|
|
msgid "Jump forward"
|
|
msgstr "Spring voorwaarts"
|
|
|
|
#: lazarusidestrconsts:lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Spring naar"
|
|
|
|
#: lazarusidestrconsts:lismenujumptonextbookmark
|
|
msgid "Jump to next bookmark"
|
|
msgstr "Spring naar volgend bookmark"
|
|
|
|
#: lazarusidestrconsts:lismenujumptonexterror
|
|
msgid "Jump to next error"
|
|
msgstr "Spring naar volgende fout"
|
|
|
|
#: lazarusidestrconsts:lismenujumptoprevbookmark
|
|
msgid "Jump to previous bookmark"
|
|
msgstr "Spring naar vorig bookmark"
|
|
|
|
#: lazarusidestrconsts:lismenujumptopreverror
|
|
msgid "Jump to previous error"
|
|
msgstr "Spring naar vorige fout"
|
|
|
|
#: lazarusidestrconsts:dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Springen ('Method Jumping')"
|
|
|
|
#: lazarusidestrconsts:liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Behoud alle Tekst bestanden"
|
|
|
|
#: lazarusidestrconsts:dlgcokeepvarsreg
|
|
msgid "Keep certain variables in registers"
|
|
msgstr "Houd bepaalde variabelen in registers"
|
|
|
|
#: lazarusidestrconsts:dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Bewaar bestanden die aan het filter voldoen"
|
|
|
|
#: lazarusidestrconsts:liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Houd naam"
|
|
|
|
#: lazarusidestrconsts:dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Houd procedure volgorde aan"
|
|
|
|
#: lazarusidestrconsts:liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolkey
|
|
msgid "Key"
|
|
msgstr "Toets"
|
|
|
|
#: lazarusidestrconsts:liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmkey
|
|
msgid "Key (or 2 keys combination)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgkeymappingscheme
|
|
msgid "Key Mapping Scheme"
|
|
msgstr "Toets mapping schema"
|
|
|
|
#: lazarusidestrconsts:dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Toets mapping"
|
|
|
|
#: lazarusidestrconsts:dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Toets mapping fouten"
|
|
|
|
#: lazarusidestrconsts:liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Toets mapping schema"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Sleutelwoord"
|
|
|
|
#: lazarusidestrconsts:dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Sleutelwoord policy"
|
|
|
|
#: lazarusidestrconsts:lislcl
|
|
msgid "LCL"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "LCL Interface specifieke opties:"
|
|
|
|
#: lazarusidestrconsts:lislclwidgettype
|
|
msgid "LCL Widget Type"
|
|
msgstr "LCL Widget Type"
|
|
|
|
#: lazarusidestrconsts:lislazbuildlclinterface
|
|
msgid "LCL interface"
|
|
msgstr "LCL interface"
|
|
|
|
#: lazarusidestrconsts:lislclunitpathmissing
|
|
msgid "LCL unit path missing"
|
|
msgstr "Pad naar LCL unit ontbreekt"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - Lazarus form beschrijving"
|
|
|
|
#: lazarusidestrconsts:lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "LFM bestand"
|
|
|
|
#: lazarusidestrconsts:lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "Corrupt LFM bestand"
|
|
|
|
#: lazarusidestrconsts:lislfmfilenotfound
|
|
msgid "LFM file not found"
|
|
msgstr "LFM bestand niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertlgplnotice
|
|
msgid "LGPL notice"
|
|
msgstr "LGPL melding"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - Lazarus resource"
|
|
|
|
#: lazarusidestrconsts:dlgenvlanguage
|
|
msgid "Language"
|
|
msgstr "Taal"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Taal uitzonderingen"
|
|
|
|
#: lazarusidestrconsts:rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Laatste"
|
|
|
|
#: lazarusidestrconsts:dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Laatste (einde broncode)"
|
|
|
|
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Applicatie wordt gestart"
|
|
|
|
#: lazarusidestrconsts:lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Starten applicatie is ongeldig"
|
|
|
|
#: lazarusidestrconsts:lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Commandoregel voor het starten van programma"
|
|
|
|
#: lazarusidestrconsts:lispkgmanglazarus
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: lazarusidestrconsts:lislazarusdesktopsettings
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Lazarus Desktop instellingen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
|
|
msgid "Lazarus Directory"
|
|
msgstr "Lazarus directorie"
|
|
|
|
#: lazarusidestrconsts:lislazarusfile
|
|
msgid "Lazarus File"
|
|
msgstr "Lazarus bestand"
|
|
|
|
#: lazarusidestrconsts:lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislazarusprojectinfofile
|
|
msgid "Lazarus Project Info file"
|
|
msgstr "Lazarus Project informatie bestand"
|
|
|
|
#: lazarusidestrconsts:lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Lazarus configuratie directorie"
|
|
|
|
#: lazarusidestrconsts:lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Lazarus directory"
|
|
|
|
#: lazarusidestrconsts:dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Lazarus directory (standaard voor alle projecten)"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
|
|
msgid "Lazarus directory \"%s\" not found."
|
|
msgstr "Lazarus directorie \"%s\" niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lislazarusdirectorynotfound
|
|
msgid "Lazarus directory not found"
|
|
msgstr "Lazarus directory niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lislazarusform
|
|
msgid "Lazarus form"
|
|
msgstr "Lazarus form"
|
|
|
|
#: lazarusidestrconsts:lislazarusinclude
|
|
msgid "Lazarus include file"
|
|
msgstr "Lazarus include bestand"
|
|
|
|
#: lazarusidestrconsts:lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Lazarus taal ID (en, de, fi, etc.)"
|
|
|
|
#: lazarusidestrconsts:lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Lazarus taal naam (Engels, Duits, etc.)"
|
|
|
|
#: lazarusidestrconsts:lislazaruspackage
|
|
msgid "Lazarus package"
|
|
msgstr "Lazarus pakket"
|
|
|
|
#: lazarusidestrconsts:lislazarusproject
|
|
msgid "Lazarus project"
|
|
msgstr "Lazarus project"
|
|
|
|
#: lazarusidestrconsts:lislazarusprojectsource
|
|
msgid "Lazarus project source"
|
|
msgstr "Lazarus project broncode"
|
|
|
|
#: lazarusidestrconsts:lislazarusunit
|
|
msgid "Lazarus unit"
|
|
msgstr "Lazarus unit"
|
|
|
|
#: lazarusidestrconsts:lisleaveemptyfo
|
|
msgid "Leave empty for default .po file"
|
|
msgstr "Laat leeg voor het standaard .po bestand"
|
|
|
|
#: lazarusidestrconsts:lisleft
|
|
msgid "Left"
|
|
msgstr "Links"
|
|
|
|
#: lazarusidestrconsts:lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Linker ankering"
|
|
|
|
#: lazarusidestrconsts:lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Linker randruimte. Wordt opgeteld met basis randruimte en gebruikt voor de ruimte links van het control."
|
|
|
|
#: lazarusidestrconsts:lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Linker zijden"
|
|
|
|
#: lazarusidestrconsts:lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Linker kant evenredig verdelen"
|
|
|
|
#: lazarusidestrconsts:dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Links:"
|
|
|
|
#: lazarusidestrconsts:dlglevelnoneopt
|
|
msgid "Level 0 (no extra Optimizations)"
|
|
msgstr "Level 0 (geen extra optimalisaties)"
|
|
|
|
#: lazarusidestrconsts:dlglevel1opt
|
|
msgid "Level 1 (quick and debugger friendly)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlglevel2opt
|
|
msgid "Level 2 (Level 1 + quick optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlglevel3opt
|
|
msgid "Level 3 (Level 2 + slow optimizations)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislevels
|
|
msgid "Levels"
|
|
msgstr "Niveaus"
|
|
|
|
#: lazarusidestrconsts:dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Bibliotheken (-Fl):"
|
|
|
|
#: lazarusidestrconsts:lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Bibliotheek"
|
|
|
|
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
|
|
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
|
|
msgstr "Biblitheek%sEen freepascal bibliotheek (.dll onder windows, .so onder linux, dylib onder macosx). De broncode bestanden worden bijgehouden door Lazarus."
|
|
|
|
#: lazarusidestrconsts:lispckoptslicense
|
|
msgid "License:"
|
|
msgstr "Licentie:"
|
|
|
|
#: lazarusidestrconsts:lisaboutlazarusmsg
|
|
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit linecount to"
|
|
msgstr "Beperk regeltelling tot"
|
|
|
|
#: lazarusidestrconsts:listodolline
|
|
msgid "Line"
|
|
msgstr "Regel"
|
|
|
|
#: lazarusidestrconsts:dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Regel splitsen"
|
|
|
|
#: lazarusidestrconsts:srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Regelselectie mode"
|
|
|
|
#: lazarusidestrconsts:lislinelength
|
|
msgid "Line/Length"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Regels"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildlines
|
|
msgid "Lines:"
|
|
msgstr "Regels:"
|
|
|
|
#: lazarusidestrconsts:dlglinksmart
|
|
msgid "Link Smart"
|
|
msgstr "Slim linken"
|
|
|
|
#: lazarusidestrconsts:dlglinklibraries
|
|
msgid "Link Style:"
|
|
msgstr "Linkstijl"
|
|
|
|
#: lazarusidestrconsts:lislinktarget
|
|
msgid "Link target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislink
|
|
msgid "Link:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linker"
|
|
|
|
#: lazarusidestrconsts:dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Linken"
|
|
|
|
#: lazarusidestrconsts:liscmplstlist
|
|
msgid "List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgloaddfile
|
|
msgid "Load desktop settings from file"
|
|
msgstr "Laad desktop instelling van een bestand"
|
|
|
|
#: lazarusidestrconsts:lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Laad van bestand"
|
|
|
|
#: lazarusidestrconsts:dlgcoloadsave
|
|
msgid "Load/Save"
|
|
msgstr "Laden/Bewaren"
|
|
|
|
#: lazarusidestrconsts:lispckexplloadedpackages
|
|
msgid "Loaded Packages:"
|
|
msgstr "Geladen Pakketten:"
|
|
|
|
#: lazarusidestrconsts:lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
|
|
msgstr "Het laden van Package %s zal package %s%s van bestand %s vervangen.%s Het oude pakket is gewijzigd. %s%sHet oude pakket %s opslaan?"
|
|
|
|
#: lazarusidestrconsts:dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Lokaal"
|
|
|
|
#: lazarusidestrconsts:lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Lokale Variabelen"
|
|
|
|
#: lazarusidestrconsts:lislocals
|
|
msgid "Locals"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislogo
|
|
msgid "Logo"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenulowercaseselection
|
|
msgid "Lowercase selection"
|
|
msgstr "Wijzig selectie in kleine letters"
|
|
|
|
#: lazarusidestrconsts:dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Kleine letters, eerste letter hoofdletter"
|
|
|
|
#: lazarusidestrconsts:liskmmacosx
|
|
msgid "Mac OS X"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismacpascal
|
|
msgid "Mac Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolmacros
|
|
msgid "Macros"
|
|
msgstr "Macros"
|
|
|
|
#: lazarusidestrconsts:dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Hoofd menu"
|
|
|
|
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
|
|
msgid "Main Unit has Application.CreateForm statements"
|
|
msgstr "De hoofd unit bevat Application.CreateFrom statements"
|
|
|
|
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
|
|
msgid "Main Unit has Application.Title statements"
|
|
msgstr "De hoofd unit bevat Application.Title statements"
|
|
|
|
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main Unit has Uses Section containing all Units of project"
|
|
msgstr "De hoofd unit bevat alle project units in de Uses sectie"
|
|
|
|
#: lazarusidestrconsts:lismainunitispascalsource
|
|
msgid "Main Unit is Pascal Source"
|
|
msgstr "De hoofd unit is pascal broncode"
|
|
|
|
#: lazarusidestrconsts:lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Major"
|
|
|
|
#: lazarusidestrconsts:rsmajorrevision
|
|
msgid "Major revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Maak Executable"
|
|
|
|
#: lazarusidestrconsts:lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Maak Resource string ..."
|
|
|
|
#: lazarusidestrconsts:lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Maak ResourceString"
|
|
|
|
#: lazarusidestrconsts:lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "make niet gevonden"
|
|
|
|
#: lazarusidestrconsts:dlgmakepath
|
|
msgid "Make path"
|
|
msgstr "Make pad"
|
|
|
|
#: lazarusidestrconsts:srkmecmakeresourcestring
|
|
msgid "Make resource string"
|
|
msgstr "Maak resource string"
|
|
|
|
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Handmatige compilatie (nooit automatisch)"
|
|
|
|
#: lazarusidestrconsts:dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Marge en goot"
|
|
|
|
#: lazarusidestrconsts:dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Marker kleur"
|
|
|
|
#: lazarusidestrconsts:lissmatches
|
|
msgid "Matches"
|
|
msgstr "Komt overeen"
|
|
|
|
#: lazarusidestrconsts:lismaxs
|
|
msgid "Max %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Max regellengte"
|
|
|
|
#: lazarusidestrconsts:dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Max aantal recente bestanden"
|
|
|
|
#: lazarusidestrconsts:dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Max aantal recente projecten"
|
|
|
|
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Maximum aantal Hulpmiddelen bereikt"
|
|
|
|
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maximum Versie (optioneel):"
|
|
|
|
#: lazarusidestrconsts:lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maximum versie"
|
|
|
|
#: lazarusidestrconsts:dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Maximum teller"
|
|
|
|
#: lazarusidestrconsts:lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Menu editor"
|
|
|
|
#: lazarusidestrconsts:lismenuviewmessages
|
|
msgid "Messages"
|
|
msgstr "Berichten"
|
|
|
|
#: lazarusidestrconsts:lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgmethodinspolicy
|
|
msgid "Method insert policy"
|
|
msgstr "Wijze van methode toevoegen"
|
|
|
|
#: lazarusidestrconsts:dlgminimizeallonminimizemain
|
|
msgid "Minimize all on minimize main"
|
|
msgstr "Alles minimaliseren bij het minimaliseren van het hoofdscherm"
|
|
|
|
#: lazarusidestrconsts:lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Minimum Versie (optioneel):"
|
|
|
|
#: lazarusidestrconsts:lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimum Versie:"
|
|
|
|
#: lazarusidestrconsts:lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Minor"
|
|
|
|
#: lazarusidestrconsts:rsminorrevision
|
|
msgid "Minor revision:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmmirrorhorizontal
|
|
msgid "Mirror horizontal"
|
|
msgstr "Spiegel horizontaal"
|
|
|
|
#: lazarusidestrconsts:fdmmirrorvertical
|
|
msgid "Mirror vertical"
|
|
msgstr "Spiegel vertikaal"
|
|
|
|
#: lazarusidestrconsts:dlgenvmisc
|
|
msgid "Miscellaneous"
|
|
msgstr "Overige"
|
|
|
|
#: lazarusidestrconsts:lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Ontbrekende pakketten"
|
|
|
|
#: lazarusidestrconsts:lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Mix methodes en properties"
|
|
|
|
#: lazarusidestrconsts:uemodified
|
|
msgid "Modified"
|
|
msgstr "Gewijzigd"
|
|
|
|
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL notice"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Gewijzigd: %s"
|
|
|
|
#: lazarusidestrconsts:listodolfile
|
|
msgid "Module"
|
|
msgstr "Module"
|
|
|
|
#: lazarusidestrconsts:lismore
|
|
msgid "More"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditmore
|
|
msgid "More ..."
|
|
msgstr "Meer ..."
|
|
|
|
#: lazarusidestrconsts:dlgmouselinks
|
|
msgid "Mouse links"
|
|
msgstr "Muis verbindingen"
|
|
|
|
#: lazarusidestrconsts:lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Beweeg omlaag (of naar rechts)"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorleft
|
|
msgid "Move Editor Left"
|
|
msgstr "Editor naar links"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorleftmost
|
|
msgid "Move Editor Leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorright
|
|
msgid "Move Editor Right"
|
|
msgstr "Editor naar rechts"
|
|
|
|
#: lazarusidestrconsts:uemmoveeditorrightmost
|
|
msgid "Move Editor Rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismovepage
|
|
msgid "Move Page ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Beweeg omhoog (of naar links)"
|
|
|
|
#: lazarusidestrconsts:lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Verplaats component een terug"
|
|
|
|
#: lazarusidestrconsts:lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Verplaats component een vooruit"
|
|
|
|
#: lazarusidestrconsts:lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Stuur component naar achteren"
|
|
|
|
#: lazarusidestrconsts:lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Breng component naar voren"
|
|
|
|
#: lazarusidestrconsts:srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Verplaats cursor een pagina omlaag"
|
|
|
|
#: lazarusidestrconsts:srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Verplaats cursor een pagina naar links"
|
|
|
|
#: lazarusidestrconsts:srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Verplaats cursor een pagina naar rechts"
|
|
|
|
#: lazarusidestrconsts:srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Verplaats cursor naar het absolute begin"
|
|
|
|
#: lazarusidestrconsts:srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Verplaats cursor naar het absolute eind"
|
|
|
|
#: lazarusidestrconsts:srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Verplaats cursor naar de onderkant van de pagina"
|
|
|
|
#: lazarusidestrconsts:srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Verplaats cursor naar regeleinde"
|
|
|
|
#: lazarusidestrconsts:srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Verplaats cursor naar regelbegin"
|
|
|
|
#: lazarusidestrconsts:srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Verplaats cursor naar de top van de pagina"
|
|
|
|
#: lazarusidestrconsts:srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Verplaats cursor een pagina omhoog"
|
|
|
|
#: lazarusidestrconsts:srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Verplaats cursor een woord naar links"
|
|
|
|
#: lazarusidestrconsts:srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Verplaats cursor een woord naar rechts"
|
|
|
|
#: lazarusidestrconsts:lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Verplaats afhankelijk omlaag"
|
|
|
|
#: lazarusidestrconsts:lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Verplaats afhankelijkheid omhoog"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Editor naar links"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Editor naar rechts"
|
|
|
|
#: lazarusidestrconsts:srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispemovefiledown
|
|
msgid "Move file down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispemovefileup
|
|
msgid "Move file up"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Verplaats node omlaag"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Verplaats node een level omlaag"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Verplaats node een level omhoog"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Verplaats node omhoog"
|
|
|
|
#: lazarusidestrconsts:lispatheditmovepathdown
|
|
msgid "Move path down"
|
|
msgstr "Verplaats pad omlaag"
|
|
|
|
#: lazarusidestrconsts:lispatheditmovepathup
|
|
msgid "Move path up"
|
|
msgstr "Verplaats pad omhoog"
|
|
|
|
#: lazarusidestrconsts:fdmordermovetoback
|
|
msgid "Move to back"
|
|
msgstr "Breng naar achter"
|
|
|
|
#: lazarusidestrconsts:fdmordermovetofront
|
|
msgid "Move to front"
|
|
msgstr "Breng naar voren"
|
|
|
|
#: lazarusidestrconsts:dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Meervoudige selectie"
|
|
|
|
#: lazarusidestrconsts:fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Meervoudig geselecteerd componenten moeten van een enkel form zijn"
|
|
|
|
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "Opmerking: Define Template voor Free Pascal broncode kon niet gemaakt worden"
|
|
|
|
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "Opmerking: Define Template voor Lazarus broncode kon niet gemaakt worden"
|
|
|
|
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "Opmerking: Configuratie bestand voor code tools niet gevonden - de standaard wordt gebruikt"
|
|
|
|
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Opmerking: Oude configuratie bestand voor code tools wordt geladen: "
|
|
|
|
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
|
|
msgid "NOTE: only absolute paths are supported now"
|
|
msgstr "Opmerking: slechts absolute paden worden nu ondersteund"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmname
|
|
msgid "Name"
|
|
msgstr "Naam"
|
|
|
|
#: lazarusidestrconsts:lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Naam van nieuwe procedure"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsname
|
|
msgid "Name:"
|
|
msgstr "Naam:"
|
|
|
|
#: lazarusidestrconsts:dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Naamgeving"
|
|
|
|
#: lazarusidestrconsts:lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Nooit, alleen handmatig"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatenew
|
|
msgid "New"
|
|
msgstr "Nieuw"
|
|
|
|
#: lazarusidestrconsts:lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Nieuw ..."
|
|
|
|
#: lazarusidestrconsts:lisnewancestors
|
|
msgid "New Ancestors"
|
|
msgstr "Nieuwe voorouders"
|
|
|
|
#: lazarusidestrconsts:lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Nieuwe klasse"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewcomponent
|
|
msgid "New Component"
|
|
msgstr "Nieuw Component"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Nieuw bestand"
|
|
|
|
#: lazarusidestrconsts:lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Nieuwe Form"
|
|
|
|
#: lazarusidestrconsts:lispwnewproject
|
|
msgid "New Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Nieuw Project ..."
|
|
|
|
#: lazarusidestrconsts:lismenunewprojectfromfile
|
|
msgid "New Project from file ..."
|
|
msgstr "Nieuw Project van bestand ..."
|
|
|
|
#: lazarusidestrconsts:lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Nieuwe vereiste"
|
|
|
|
#: lazarusidestrconsts:lismenueditornewtemplatedescription
|
|
msgid "New Template Description..."
|
|
msgstr "Nieuw 'template' beschrijving ..."
|
|
|
|
#: lazarusidestrconsts:lismenunewunit
|
|
msgid "New Unit"
|
|
msgstr "Nieuwe Unit"
|
|
|
|
#: lazarusidestrconsts:lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Nieuwe Class naam:"
|
|
|
|
#: lazarusidestrconsts:liskmnewpackage
|
|
msgid "New package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenunewpackage
|
|
msgid "New package ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Nieuw project"
|
|
|
|
#: lazarusidestrconsts:liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Nieuw project van bestand"
|
|
|
|
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "De nieuwe unit bevindt zich niet in het unit pad"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "NieuweNode"
|
|
|
|
#: lazarusidestrconsts:lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr "NieuwPakket"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Nieuwe regel"
|
|
|
|
#: lazarusidestrconsts:srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Volgend bookmark"
|
|
|
|
#: lazarusidestrconsts:lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Geen ResourceString sectie gevonden"
|
|
|
|
#: lazarusidestrconsts:lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Geen backup bestanden"
|
|
|
|
#: lazarusidestrconsts:lisnochange
|
|
msgid "No change"
|
|
msgstr "Geen wijziging"
|
|
|
|
#: lazarusidestrconsts:lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Geen code geselecteerd"
|
|
|
|
#: lazarusidestrconsts:lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Geen compiler opties overgenomen."
|
|
|
|
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Geen debugger aangegeven"
|
|
|
|
#: lazarusidestrconsts:dlgednoerr
|
|
msgid "No errors in key mapping found."
|
|
msgstr "Geen fouten in toets mapping gevonden."
|
|
|
|
#: lazarusidestrconsts:lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Geen item geselecteerd"
|
|
|
|
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
|
|
msgstr "Geen pakket gevonden voor afhankelijkheid %s%s%s.%sKies een bestaand pakket."
|
|
|
|
#: lazarusidestrconsts:lisoipnopackageselected
|
|
msgid "No package selected"
|
|
msgstr "Geen pakket geselecteerd"
|
|
|
|
#: lazarusidestrconsts:lisnoprogramfilesfound
|
|
msgid "No program file %s%s%s found."
|
|
msgstr "Geen programma bestand %s%s%s gevonden."
|
|
|
|
#: lazarusidestrconsts:lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Geen string constante gevonden"
|
|
|
|
#: lazarusidestrconsts:lisldnovalidlazdocpath
|
|
msgid "No valid LazDoc path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
|
|
msgid "Node and its children are only valid for this project"
|
|
msgstr "Node en de child-nodes alleen geldig voor dit project"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Node is niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:dlgenvnone
|
|
msgid "None"
|
|
msgstr "Geen"
|
|
|
|
#: lazarusidestrconsts:dlgconormal
|
|
msgid "Normal Code"
|
|
msgstr "Normale code"
|
|
|
|
#: lazarusidestrconsts:srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normale selectie modus"
|
|
|
|
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Het filter is gewoonlijk een regular expressie. In de eenvoudige syntax betekent een . een gewoon karakter, een * staat voor alles, een ? staat voor elk willekeurig karakter. Komma's en puntkomma's zijn scheidingstekens tussen alternatieven. Bijvoorbeeld: *.pas;*.pp staat voor ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts:lisnotadelphiproject
|
|
msgid "Not a Delphi project"
|
|
msgstr "Geen Dephi project"
|
|
|
|
#: lazarusidestrconsts:lisnotadelphiunit
|
|
msgid "Not a Delphi unit"
|
|
msgstr "Geen Delphi unit"
|
|
|
|
#: lazarusidestrconsts:lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Nog niet geimplementeerd"
|
|
|
|
#: lazarusidestrconsts:lisnotimplementedyet2
|
|
msgid "Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Niet nu"
|
|
|
|
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
|
|
msgid "Note: All keys will be set to the values of the choosen scheme."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisinfobuildnote
|
|
msgid "Notes:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Toelichting: Project bestanden zijn alle bestanden in de project directorie"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Nummer"
|
|
|
|
#: lazarusidestrconsts:lisifdok
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:uepovr
|
|
msgid "OVR"
|
|
msgstr "OVR"
|
|
|
|
#: lazarusidestrconsts:lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Object"
|
|
|
|
#: lazarusidestrconsts:lismenuviewobjectinspector
|
|
msgid "Object Inspector"
|
|
msgstr "Object Inspecteur"
|
|
|
|
#: lazarusidestrconsts:liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Object Inspecteur commando's"
|
|
|
|
#: lazarusidestrconsts:lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgedoff
|
|
msgid "Off"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisokbtn
|
|
msgid "Ok"
|
|
msgstr "Ok"
|
|
|
|
#: lazarusidestrconsts:lisoldancestors
|
|
msgid "Old Ancestors"
|
|
msgstr "Oude Ancestors"
|
|
|
|
#: lazarusidestrconsts:lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Oude Klasse"
|
|
|
|
#: lazarusidestrconsts:dlgedon
|
|
msgid "On"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "On idle"
|
|
|
|
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Online help"
|
|
|
|
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
|
|
msgid "Online Help not yet implemented"
|
|
msgstr "Online help nog niet geimplementeerd"
|
|
|
|
#: lazarusidestrconsts:lispldonlyexistingfiles
|
|
msgid "Only existing files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Alleen hele woorden zoeken"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Alleen de selectie"
|
|
|
|
#: lazarusidestrconsts:lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Alleen tekst bestanden"
|
|
|
|
#: lazarusidestrconsts:lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishintopen
|
|
msgid "Open"
|
|
msgstr "Openen"
|
|
|
|
#: lazarusidestrconsts:lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Open %s"
|
|
|
|
#: lazarusidestrconsts:lismenuopen
|
|
msgid "Open ..."
|
|
msgstr "Openen ..."
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
|
|
msgid "Open Diff in editor"
|
|
msgstr "Toon verschillen in bewerker"
|
|
|
|
#: lazarusidestrconsts:lisopenfile2
|
|
msgid "Open File ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Open Pakket %s"
|
|
|
|
#: lazarusidestrconsts:lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Open Pakket bestand"
|
|
|
|
#: lazarusidestrconsts:lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Open Pakket?"
|
|
|
|
#: lazarusidestrconsts:lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Open voorbeeld"
|
|
|
|
#: lazarusidestrconsts:lispwopenproject
|
|
msgid "Open Project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Open Project ..."
|
|
|
|
#: lazarusidestrconsts:lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Open Project bestand"
|
|
|
|
#: lazarusidestrconsts:lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Open Project?"
|
|
|
|
#: lazarusidestrconsts:lismenutemplateopenrecent
|
|
msgid "Open Recent"
|
|
msgstr "Open Recent"
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecent
|
|
msgid "Open Recent ..."
|
|
msgstr "Open Recent ..."
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecentproject
|
|
msgid "Open Recent Project ..."
|
|
msgstr "Open Recent Project ..."
|
|
|
|
#: lazarusidestrconsts:liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Open unit %s"
|
|
|
|
#: lazarusidestrconsts:lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Open als XML bestand"
|
|
|
|
#: lazarusidestrconsts:lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Open bestannd bestand"
|
|
|
|
#: lazarusidestrconsts:lisopenfile
|
|
msgid "Open file"
|
|
msgstr "Open bestand"
|
|
|
|
#: lazarusidestrconsts:srkmecopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr "Open bestand (op cursor)"
|
|
|
|
#: lazarusidestrconsts:lismenuopenfilenameatcursor
|
|
msgid "Open filename at cursor"
|
|
msgstr "Open bestandsnaam (op cursor)"
|
|
|
|
#: lazarusidestrconsts:dlgqopenlastprj
|
|
msgid "Open last project at start"
|
|
msgstr "Open laatste project bij start"
|
|
|
|
#: lazarusidestrconsts:lisoipopenloadedpackage
|
|
msgid "Open loaded package"
|
|
msgstr "Open een geladen Pakket"
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackage
|
|
msgid "Open loaded package ..."
|
|
msgstr "Open een geladen Pakket ..."
|
|
|
|
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
|
|
msgid "Open or Load Compiler Options"
|
|
msgstr "Open of laad Compiler opties"
|
|
|
|
#: lazarusidestrconsts:liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Open een Pakket"
|
|
|
|
#: lazarusidestrconsts:lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Open pakket bestand"
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackagefile
|
|
msgid "Open package file (.lpk) ..."
|
|
msgstr "Open Pakket bestand (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts:lismenuopenpackageofcurunit
|
|
msgid "Open package of current unit"
|
|
msgstr "Open Pakket van huidige unit"
|
|
|
|
#: lazarusidestrconsts:lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Project openen"
|
|
|
|
#: lazarusidestrconsts:lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Project opnieuw openen"
|
|
|
|
#: lazarusidestrconsts:lisiecoopenrecent
|
|
msgid "Open recent"
|
|
msgstr "Open recent"
|
|
|
|
#: lazarusidestrconsts:lismenuopenrecentpkg
|
|
msgid "Open recent package ..."
|
|
msgstr "Open recent pakket ..."
|
|
|
|
#: lazarusidestrconsts:lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisopentarget
|
|
msgid "Open target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Open het bestand als normale broncode"
|
|
|
|
#: lazarusidestrconsts:lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr "Open het pakket %s?"
|
|
|
|
#: lazarusidestrconsts:lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr "Open het project %s"
|
|
|
|
#: lazarusidestrconsts:liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Open unit"
|
|
|
|
#: lazarusidestrconsts:dlgoptimiz
|
|
msgid "Optimizations:"
|
|
msgstr "Optimaliseringen:"
|
|
|
|
#: lazarusidestrconsts:liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Optie: Snap to grid"
|
|
|
|
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Optie: snap naar guide lijnen"
|
|
|
|
#: lazarusidestrconsts:dlgfropts
|
|
msgid "Options"
|
|
msgstr "Opties"
|
|
|
|
#: lazarusidestrconsts:lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Opties:"
|
|
|
|
#: lazarusidestrconsts:dlgcoopts
|
|
msgid "Options: "
|
|
msgstr "Opties:"
|
|
|
|
#: lazarusidestrconsts:fdmorder
|
|
msgid "Order"
|
|
msgstr "Volgorde"
|
|
|
|
#: lazarusidestrconsts:dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Oorsprong"
|
|
|
|
#: lazarusidestrconsts:dlgcoother
|
|
msgid "Other"
|
|
msgstr "Ander"
|
|
|
|
#: lazarusidestrconsts:dlgcosources
|
|
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Andere Bronnen (.pp / .pas bestanden, alleen door IDE gebruikt)"
|
|
|
|
#: lazarusidestrconsts:dlgotherunitfiles
|
|
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
|
|
msgstr "Andere unit bestanden (-Fu)"
|
|
|
|
#: lazarusidestrconsts:dlgenvotherfiles
|
|
msgid "Other files"
|
|
msgstr "Andere bestanden"
|
|
|
|
#: lazarusidestrconsts:rsotherinfo
|
|
msgid "Other info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgpooutputsettings
|
|
msgid "Output Settings"
|
|
msgstr "Uitvoer Instellingen"
|
|
|
|
#: lazarusidestrconsts:lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Uitvoer directory"
|
|
|
|
#: lazarusidestrconsts:dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Overloop"
|
|
|
|
#: lazarusidestrconsts:lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr "Overrule de ingestelde taal. Bijv. --language=nl. Voor mogelijke waardes zie de bestanden in the directorie languages"
|
|
|
|
#: lazarusidestrconsts:lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Overrule the systeem variabele"
|
|
|
|
#: lazarusidestrconsts:srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Overschrijf mode"
|
|
|
|
#: lazarusidestrconsts:lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Bestand op disk overschrijven"
|
|
|
|
#: lazarusidestrconsts:lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Bestand overschrijven?"
|
|
|
|
#: lazarusidestrconsts:listodolowner
|
|
msgid "Owner"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispackage
|
|
msgid "Package"
|
|
msgstr "Pakket"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Pakket %s"
|
|
|
|
#: lazarusidestrconsts:lispckexplpackagenotfound
|
|
msgid "Package %s not found"
|
|
msgstr "Pakket %s niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagechangedsave
|
|
msgid "Package %s%s%s changed. Save?"
|
|
msgstr "Pakket %s%s%s is gewijzigd. Opslaan?"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
|
|
msgid "Package %s%s%s has changed.%sSave package?"
|
|
msgstr "Pakket %s%s%s is gewijzigd.%sPakket opslaan?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
|
|
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
|
|
msgstr "Pakket %s%s%s heeft geen geldig uitvoer directorie:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisaf2ppackagenotfound
|
|
msgid "Package %s%s%s not found."
|
|
msgstr "Pakket %s%s%s niet gevonden."
|
|
|
|
#: lazarusidestrconsts:lismenupackagegraph
|
|
msgid "Package Graph ..."
|
|
msgstr "Pakketplaatje ..."
|
|
|
|
#: lazarusidestrconsts:lispackageinfo
|
|
msgid "Package Info"
|
|
msgstr "Pakketinformatie"
|
|
|
|
#: lazarusidestrconsts:lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Pakketnaam"
|
|
|
|
#: lazarusidestrconsts:lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Pakketnaam"
|
|
|
|
#: lazarusidestrconsts:lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Pakketopties"
|
|
|
|
#: lazarusidestrconsts:lispkgreg
|
|
msgid "Package Registration"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Pakketbronbestanden directory markering"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Pakket conflicteert."
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagefilemissing
|
|
msgid "Package file missing"
|
|
msgstr "Pakketbestand ontbreekt"
|
|
|
|
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Pakketbestand niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
|
|
msgid "Package file not saved"
|
|
msgstr "Pakketbestand niet opgeslagen"
|
|
|
|
#: lazarusidestrconsts:liskmpackagegraph
|
|
msgid "Package graph"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgpldpackagegroup
|
|
msgid "Package group"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is no designtime package"
|
|
msgstr "Pakket is geen design-time pakket"
|
|
|
|
#: lazarusidestrconsts:lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Pakket niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Pakket is benodigd"
|
|
|
|
#: lazarusidestrconsts:lismenupackagelinks
|
|
msgid "Package links ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Pakketnaam bestaat al"
|
|
|
|
#: lazarusidestrconsts:lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Pakketnaam begint met ..."
|
|
|
|
#: lazarusidestrconsts:lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Pakketnaam bevat ..."
|
|
|
|
#: lazarusidestrconsts:lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Pakket moet geinstalleerd worden"
|
|
|
|
#: lazarusidestrconsts:lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Pakket niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Pakket: %s"
|
|
|
|
#: lazarusidestrconsts:lispckoptspackagetype
|
|
msgid "PackageType"
|
|
msgstr "Pakkettype"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Pakketbestanden moeten de .lpk extensie hebben"
|
|
|
|
#: lazarusidestrconsts:lispackagestoinstallintheide
|
|
msgid "Packages to install in the IDE"
|
|
msgstr "In de IDE te installeren pakketten"
|
|
|
|
#: lazarusidestrconsts:lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Naam van pagina te lang"
|
|
|
|
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr "Teken designer items in idle tijd (reduceert overhead voor langzame computers)"
|
|
|
|
#: lazarusidestrconsts:liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr "Palette pagina:"
|
|
|
|
#: lazarusidestrconsts:lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Paragrafen"
|
|
|
|
#: lazarusidestrconsts:liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parameter"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parameters:"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node can not contain child nodes."
|
|
msgstr "Parent node kan geen child nodes bevatten."
|
|
|
|
#: lazarusidestrconsts:dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Ontleden"
|
|
|
|
#: lazarusidestrconsts:lislazbuildabopart
|
|
msgid "Part"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispascalsourcefile
|
|
msgid "Pascal source file"
|
|
msgstr "Pascal broncode bestand"
|
|
|
|
#: lazarusidestrconsts:lispascalunit
|
|
msgid "Pascal unit"
|
|
msgstr "Pascal unit"
|
|
|
|
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Pascal units moeten de .pp of .pas extensie hebben"
|
|
|
|
#: lazarusidestrconsts:lispasscount
|
|
msgid "Pass Count"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgpassoptslinker
|
|
msgid "Pass Options To The Linker (Delimiter is space)"
|
|
msgstr "Geef opties door aan de linker (Spatie is scheidingsteken)"
|
|
|
|
#: lazarusidestrconsts:lismenupaste
|
|
msgid "Paste"
|
|
msgstr "Plakken"
|
|
|
|
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
|
|
msgid "Paste Components from clipboard"
|
|
msgstr "Plak componenten van clipboard"
|
|
|
|
#: lazarusidestrconsts:srkmecpaste
|
|
msgid "Paste clipboard to current position"
|
|
msgstr "Plak klembord op de huidige positie"
|
|
|
|
#: lazarusidestrconsts:lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Plak geselecteerde componenten van het klembord"
|
|
|
|
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Pad templates"
|
|
|
|
#: lazarusidestrconsts:listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Pad:"
|
|
|
|
#: lazarusidestrconsts:dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Paden:"
|
|
|
|
#: lazarusidestrconsts:lisuidpathsreadonly
|
|
msgid "Paths (Read Only)"
|
|
msgstr "Paden (Niet wijzigbaar)"
|
|
|
|
#: lazarusidestrconsts:lismenupause
|
|
msgid "Pause"
|
|
msgstr "Pauze"
|
|
|
|
#: lazarusidestrconsts:liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Pauseer programma"
|
|
|
|
#: lazarusidestrconsts:dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccochecktestdir
|
|
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispleasecheckthecompilername
|
|
msgid "Please check the compiler name"
|
|
msgstr "Controleer compiler naam"
|
|
|
|
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
|
|
msgid "Please check the freepascal source directory"
|
|
msgstr "Controleer de FP bron directory"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "A.u.b. een unit openen .."
|
|
|
|
#: lazarusidestrconsts:srkmpresskey
|
|
msgid "Please press a key ..."
|
|
msgstr "Druk een toets in"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Sla het bestand op voor het toevoegen aan een package"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
|
|
msgid "Please save the package first."
|
|
msgstr "Sla eerst het pakket op"
|
|
|
|
#: lazarusidestrconsts:lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Selecteer een pakket"
|
|
|
|
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
|
|
msgid "Please select a package to open"
|
|
msgstr "Selecteer een te openen pakket"
|
|
|
|
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Selecteer eerst een item"
|
|
|
|
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Selecteer een stuk code om in een nieuwe procedure/methode te maken"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Punt"
|
|
|
|
#: lazarusidestrconsts:lispointer
|
|
msgid "Pointer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "Pools"
|
|
|
|
#: lazarusidestrconsts:rslanguagepolishwin
|
|
msgid "Polish(CP1250)"
|
|
msgstr "Pools(CP1250)"
|
|
|
|
#: lazarusidestrconsts:rslanguagepolishiso
|
|
msgid "Polish(ISO 8859-2)"
|
|
msgstr "Pools(ISO 8859-2)"
|
|
|
|
#: lazarusidestrconsts:rslanguageportugues
|
|
msgid "Portuguese"
|
|
msgstr "Portugees"
|
|
|
|
#: lazarusidestrconsts:lisceomode
|
|
msgid "Preferred Exhibition Mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgwrdpreview
|
|
msgid "Preview"
|
|
msgstr "Voorbeeld"
|
|
|
|
#: lazarusidestrconsts:dlgcdtpreview
|
|
msgid "Preview (Max line length = 1)"
|
|
msgstr "Voorbeeld (Max regellengte = 1)"
|
|
|
|
#: lazarusidestrconsts:srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Vorig Bookmark"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Vorige node kan geen child nodes bevatten"
|
|
|
|
#: lazarusidestrconsts:lisprint
|
|
msgid "Print"
|
|
msgstr "Druk af"
|
|
|
|
#: lazarusidestrconsts:listodolistprintlist
|
|
msgid "Print todo items"
|
|
msgstr "Druk \"todo\" items af"
|
|
|
|
#: lazarusidestrconsts:listodolpriority
|
|
msgid "Priority"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprivate
|
|
msgid "Private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Private methode"
|
|
|
|
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
|
|
msgstr "Waarschijnlijk moet je nog wat pakketten installeren voordat je verder gaat.%s%sWaarschuwing:%sHet project is afhankelijk van sommige pakketten, die units bevatten met de Register procedure. De register procedure wordt gewoonlijk gebruikt voor het installeren van componenten in de IDE. De volgende pakketten zijn nog niet in de IDE geinstalleerd. Als je een form dat deze componenten bevat, probeert te openen in de IDE zal dat vervelende resultaten geven.%s%sDit heeft geen impact op het laden van het project of de bijbehorende broncode.%s%sDit betekent alleen: Het is een slecht idee om deze forms te openen om te bewerken, voordat de missende pakketten zijn geinstalleerd.%s%s"
|
|
|
|
#: lazarusidestrconsts:lisprocedure
|
|
msgid "Procedure"
|
|
msgstr "Procedure"
|
|
|
|
#: lazarusidestrconsts:uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Procedure sprong"
|
|
|
|
#: lazarusidestrconsts:srkmecprocedurelist
|
|
msgid "Procedure List ..."
|
|
msgstr "Procedure lijst ..."
|
|
|
|
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Wijze van procedures toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Procedure met interface"
|
|
|
|
#: lazarusidestrconsts:lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Proces"
|
|
|
|
#: lazarusidestrconsts:lisprogram
|
|
msgid "Program"
|
|
msgstr "Programma"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Programma bestandsnaam:"
|
|
|
|
#: lazarusidestrconsts:lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Programma vastgesteld"
|
|
|
|
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Programma broncode dient een Pascal extensie, zoals .pas, .pp of .lpr, te hebben."
|
|
|
|
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
|
|
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
|
|
msgstr "Programma%sEen Freepascal programma. Het programma wordt automatisch door Lazarus bijgehouden."
|
|
|
|
#: lazarusidestrconsts:lisexeprograms
|
|
msgid "Programs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Voortgang"
|
|
|
|
#: lazarusidestrconsts:dlgenvproject
|
|
msgid "Project"
|
|
msgstr "Project"
|
|
|
|
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
|
|
msgid "Project %s%s%s successfully built. :)"
|
|
msgstr "Project %s%s%s succesvol gebouwd"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectincpath
|
|
msgid "Project IncPath"
|
|
msgstr "Project IncPath"
|
|
|
|
#: lazarusidestrconsts:lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Project Include Path"
|
|
|
|
#: lazarusidestrconsts:lisprojectinformation
|
|
msgid "Project Information"
|
|
msgstr "Project informatie"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Project Inspecteur"
|
|
|
|
#: lazarusidestrconsts:lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Project Inspecteur - %s"
|
|
|
|
#: lazarusidestrconsts:dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Project Opties"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Project Opties ..."
|
|
|
|
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Project broncode directory merk"
|
|
|
|
#: lazarusidestrconsts:lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Project Src Path"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectsrcpath
|
|
msgid "Project SrcPath"
|
|
msgstr "Project SrcPath"
|
|
|
|
#: lazarusidestrconsts:lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Project Unit pad"
|
|
|
|
#: lazarusidestrconsts:lisedtdefprojectunitpath
|
|
msgid "Project UnitPath"
|
|
msgstr "Project Unit pad"
|
|
|
|
#: lazarusidestrconsts:lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Project is gewijzigd"
|
|
|
|
#: lazarusidestrconsts:lisprojectdirectory
|
|
msgid "Project directory"
|
|
msgstr "Project directory"
|
|
|
|
#: lazarusidestrconsts:lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Project bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:dlgprojfiles
|
|
msgid "Project files"
|
|
msgstr "Project bestanden"
|
|
|
|
#: lazarusidestrconsts:lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Project info bestand gevonden"
|
|
|
|
#: lazarusidestrconsts:lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Project is 'runnable'"
|
|
|
|
#: lazarusidestrconsts:lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Project macro eigenschappen"
|
|
|
|
#: lazarusidestrconsts:srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Project menu commandos"
|
|
|
|
#: lazarusidestrconsts:lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Project: %s"
|
|
|
|
#: lazarusidestrconsts:lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Vraag om een waarde"
|
|
|
|
#: lazarusidestrconsts:lisceproperties
|
|
msgid "Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Properties"
|
|
|
|
#: lazarusidestrconsts:dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Propertie completering"
|
|
|
|
#: lazarusidestrconsts:dlgpropnamecolor
|
|
msgid "Property name"
|
|
msgstr "Propertie naam"
|
|
|
|
#: lazarusidestrconsts:lisprotected
|
|
msgid "Protected"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Beschermde methode"
|
|
|
|
#: lazarusidestrconsts:lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisemdpublic
|
|
msgid "Public"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Publieke methode"
|
|
|
|
#: lazarusidestrconsts:lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Publiceer Pakket"
|
|
|
|
#: lazarusidestrconsts:lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Publiceer Project ..."
|
|
|
|
#: lazarusidestrconsts:liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Publiceer project"
|
|
|
|
#: lazarusidestrconsts:lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Publiceer project directory"
|
|
|
|
#: lazarusidestrconsts:lisemdpublished
|
|
msgid "Published"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Gepubliceerde methode"
|
|
|
|
#: lazarusidestrconsts:lislazbuildquickbuildoptions
|
|
msgid "Quick Build Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuquickcompile
|
|
msgid "Quick compile"
|
|
msgstr "Snel-compilatie"
|
|
|
|
#: lazarusidestrconsts:liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Snel compileren, geen linken"
|
|
|
|
#: lazarusidestrconsts:lismenuquicksyntaxcheck
|
|
msgid "Quick syntax check"
|
|
msgstr "Snellere Syntaxcheck"
|
|
|
|
#: lazarusidestrconsts:lismenuquit
|
|
msgid "Quit"
|
|
msgstr "Afsluiten"
|
|
|
|
#: lazarusidestrconsts:lisquitlazarus
|
|
msgid "Quit Lazarus"
|
|
msgstr "Verlaat Lazarus"
|
|
|
|
#: lazarusidestrconsts:dlgcorange
|
|
msgid "Range"
|
|
msgstr "Bereik"
|
|
|
|
#: lazarusidestrconsts:lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Voeg afhankelijkheid opnieuw toe"
|
|
|
|
#: lazarusidestrconsts:lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Voeg bestand opnieuw toe"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Compileer dit opnieuw en alle benodigde Pakketten?"
|
|
|
|
#: lazarusidestrconsts:lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Leesfout"
|
|
|
|
#: lazarusidestrconsts:uemreadonly
|
|
msgid "Read Only"
|
|
msgstr "Niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Niet wijzigbaar: %s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Leesfout"
|
|
|
|
#: lazarusidestrconsts:dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "Lees voorloop"
|
|
|
|
#: lazarusidestrconsts:uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Lazarus opnieuw bouwen"
|
|
|
|
#: lazarusidestrconsts:lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "Recente bestanden"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompileallrequired
|
|
msgid "Recompile all required"
|
|
msgstr "Hercompileer wat benodigd is"
|
|
|
|
#: lazarusidestrconsts:lispckeditrecompileclean
|
|
msgid "Recompile clean"
|
|
msgstr "Hercompileer opnieuw"
|
|
|
|
#: lazarusidestrconsts:lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuredo
|
|
msgid "Redo"
|
|
msgstr "Opnieuw"
|
|
|
|
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr "Beperk het opnieuw tekenen"
|
|
|
|
#: lazarusidestrconsts:uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Refactoring"
|
|
|
|
#: lazarusidestrconsts:dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Referentie"
|
|
|
|
#: lazarusidestrconsts:dlgunitdeprefresh
|
|
msgid "Refresh"
|
|
msgstr "Verversen"
|
|
|
|
#: lazarusidestrconsts:lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Automatisch verversen"
|
|
|
|
#: lazarusidestrconsts:listodolistrefresh
|
|
msgid "Refresh todo items"
|
|
msgstr "Ververs \"te doen\" items"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "Register proceure is nill"
|
|
|
|
#: lazarusidestrconsts:lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Registreer unit"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "RegisterUnit is aangeroepen, maar er is geen pakket geregistreerd"
|
|
|
|
#: lazarusidestrconsts:lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Geregistreerde plugins"
|
|
|
|
#: lazarusidestrconsts:lispkgsysregistrationerror
|
|
msgid "Registration Error"
|
|
msgstr "Regastratie error"
|
|
|
|
#: lazarusidestrconsts:lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Relatieve paden"
|
|
|
|
#: lazarusidestrconsts:lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Vrijgeven"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffrevertall
|
|
msgid "Reload from disk"
|
|
msgstr "Opnieuw laden van schijf"
|
|
|
|
#: lazarusidestrconsts:lisexttoolremove
|
|
msgid "Remove"
|
|
msgstr "Verwijder"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Verwijder afhankelijkheid"
|
|
|
|
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
|
|
msgid "Remove active unit from project"
|
|
msgstr "Verwijder actieve unit van project"
|
|
|
|
#: lazarusidestrconsts:lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Verwijder alle ongeldige properties"
|
|
|
|
#: lazarusidestrconsts:liskmremovebreakpoint
|
|
msgid "Remove break point"
|
|
msgstr "Verwijder breekpunt"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Verwijder afhankelijkheid"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
|
|
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
msgstr "Verwijder afhankelijkheid %s%s%s%suit pakket %s%s%s"
|
|
|
|
#: lazarusidestrconsts:srkmecremoveemptymethods
|
|
msgid "Remove empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Verwijder bestand"
|
|
|
|
#: lazarusidestrconsts:lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Verwijder bestand %s van het project?"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefilefrompackage
|
|
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
|
|
msgstr "Verwijder bestand %s%s%s%svan pakket %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Bestand verwijderen?"
|
|
|
|
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Overeenkomende bestanden verwijderen"
|
|
|
|
#: lazarusidestrconsts:lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Verwijder van Project ..."
|
|
|
|
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
|
|
msgid "Remove from favourite properties"
|
|
msgstr "Uit favoriete properties verwijderen"
|
|
|
|
#: lazarusidestrconsts:lisremovefromproject
|
|
msgid "Remove from project"
|
|
msgstr "Verwijder van Project"
|
|
|
|
#: lazarusidestrconsts:lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Verwijder pad"
|
|
|
|
#: lazarusidestrconsts:lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Verwijder geselecteerde items"
|
|
|
|
#: lazarusidestrconsts:lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Verwijder ze"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
|
|
msgid "Removed Files (these entries are not saved to the lpk file)"
|
|
msgstr "Verwijderde bestanden (deze worden niet opgeslagen in het lpk bestand)"
|
|
|
|
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
|
|
msgid "Removed required packages"
|
|
msgstr "Benodigde pakketten verwijderd"
|
|
|
|
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
|
|
msgid "Removed required packages (these entries are not saved to the lpk file)"
|
|
msgstr "Benodigde pakketten verwijderd"
|
|
|
|
#: lazarusidestrconsts:lisfrirename
|
|
msgid "Rename"
|
|
msgstr "Hernoemen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Hernoem bestand in kleine letters?"
|
|
|
|
#: lazarusidestrconsts:uemrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Hernoem Identifier"
|
|
|
|
#: lazarusidestrconsts:lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Hernoem Identifier ..."
|
|
|
|
#: lazarusidestrconsts:lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Hernoem alle referenties"
|
|
|
|
#: lazarusidestrconsts:lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Hernoemen van bestand gefaald."
|
|
|
|
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
|
|
msgid "Rename file in package?"
|
|
msgstr "Hernoem bestand in pakket"
|
|
|
|
#: lazarusidestrconsts:lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Hernoem bestand?"
|
|
|
|
#: lazarusidestrconsts:srkmecrenameidentifier
|
|
msgid "Rename identifier"
|
|
msgstr "Hernoem identifier"
|
|
|
|
#: lazarusidestrconsts:lisfrirenameto
|
|
msgid "Rename to"
|
|
msgstr "Hernoem naar"
|
|
|
|
#: lazarusidestrconsts:lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Hernoemen in kleine letters"
|
|
|
|
#: lazarusidestrconsts:lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenureplace
|
|
msgid "Replace"
|
|
msgstr "Vervangen"
|
|
|
|
#: lazarusidestrconsts:dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Vervang &alles"
|
|
|
|
#: lazarusidestrconsts:lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Vervang bestand"
|
|
|
|
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
|
|
msgid "Replace existing file %s%s%s?"
|
|
msgstr "Vervang bestaand bestand %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:srkmecreplace
|
|
msgid "Replace text"
|
|
msgstr "Vervang tekst"
|
|
|
|
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
|
|
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
|
|
msgstr "Vervang dit exemplaar van %s%s%s%s met %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Het vervangen van de selectie is niet gelukt."
|
|
|
|
#: lazarusidestrconsts:dlgreport
|
|
msgid "Report"
|
|
msgstr "Rapporteer"
|
|
|
|
#: lazarusidestrconsts:lismenureportingbug
|
|
msgid "Reporting a bug..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Benodigde Pakketten"
|
|
|
|
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC source directory"
|
|
msgstr "Lees FPC broncode directory"
|
|
|
|
#: lazarusidestrconsts:lisvsrresetresultlist
|
|
msgid "Reset Result List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuresetdebugger
|
|
msgid "Reset debugger"
|
|
msgstr "Reset debugger"
|
|
|
|
#: lazarusidestrconsts:lisresourceloaderror
|
|
msgid "Resource load error"
|
|
msgstr "Resource laad fout"
|
|
|
|
#: lazarusidestrconsts:lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Fout bij opslaan Resource"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resourcestring bestaat al"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Resourcestring sectie:"
|
|
|
|
#: lazarusidestrconsts:lismenurestart
|
|
msgid "Restart"
|
|
msgstr "Herstart"
|
|
|
|
#: lazarusidestrconsts:lislazbuildrestartafterbuild
|
|
msgid "Restart after successful Build"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Herstel window plaatsing"
|
|
|
|
#: lazarusidestrconsts:rsiwprestorewindowsize
|
|
msgid "Restore window size"
|
|
msgstr "Herstel window afmeting"
|
|
|
|
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccoresults
|
|
msgid "Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Hervat"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr "Ga verder"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr "Ga verder met overige"
|
|
|
|
#: lazarusidestrconsts:lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Terugzetten"
|
|
|
|
#: lazarusidestrconsts:lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Terugzetten mislukt"
|
|
|
|
#: lazarusidestrconsts:lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Pakket terugzetten?"
|
|
|
|
#: lazarusidestrconsts:lisright
|
|
msgid "Right"
|
|
msgstr "Rechts"
|
|
|
|
#: lazarusidestrconsts:dlgrightclickselects
|
|
msgid "Right Click selects"
|
|
msgstr "Rechts klikken selecteert"
|
|
|
|
#: lazarusidestrconsts:lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Rechter ankering"
|
|
|
|
#: lazarusidestrconsts:lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
|
|
msgid "Right click on the items tree to get the popupmenu with all available package functions."
|
|
msgstr "Klik rechts op de boom om een popupmenu te krijgen met beschikbare package functies."
|
|
|
|
#: lazarusidestrconsts:dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Rechter marge"
|
|
|
|
#: lazarusidestrconsts:dlgrightmargincolor
|
|
msgid "Right margin color"
|
|
msgstr "Rechter marge kleur"
|
|
|
|
#: lazarusidestrconsts:dlgrightmousemovescursor
|
|
msgid "Right mouse moves cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Rechter kanten"
|
|
|
|
#: lazarusidestrconsts:lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Verdeel rechter kant evenredig"
|
|
|
|
#: lazarusidestrconsts:dlgrubberbandgroup
|
|
msgid "Rubber band"
|
|
msgstr "Elastiek"
|
|
|
|
#: lazarusidestrconsts:lismenuprojectrun
|
|
msgid "Run"
|
|
msgstr "Starten"
|
|
|
|
#: lazarusidestrconsts:lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Run commando"
|
|
|
|
#: lazarusidestrconsts:lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Start bestand"
|
|
|
|
#: lazarusidestrconsts:lismenurunparameters
|
|
msgid "Run Parameters ..."
|
|
msgstr "Start Parameter ..."
|
|
|
|
#: lazarusidestrconsts:srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Start menu commando's"
|
|
|
|
#: lazarusidestrconsts:dlgrunparameters
|
|
msgid "Run parameters"
|
|
msgstr "Start parameters"
|
|
|
|
#: lazarusidestrconsts:liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Run programma"
|
|
|
|
#: lazarusidestrconsts:lismenuruntocursor
|
|
msgid "Run to cursor"
|
|
msgstr "Start tot cursor"
|
|
|
|
#: lazarusidestrconsts:lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Uitvoeren to mislukte"
|
|
|
|
#: lazarusidestrconsts:lispckoptsruntimeonly
|
|
msgid "Runtime only"
|
|
msgstr "Alleen tijdens het uitvoeren"
|
|
|
|
#: lazarusidestrconsts:rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "Russisch"
|
|
|
|
#: lazarusidestrconsts:lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "SVN revisie: "
|
|
|
|
#: lazarusidestrconsts:dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Dezelfde naam (in subdirectorie)"
|
|
|
|
#: lazarusidestrconsts:lismenusave
|
|
msgid "Save"
|
|
msgstr "Opslaan"
|
|
|
|
#: lazarusidestrconsts:lissavespace
|
|
msgid "Save "
|
|
msgstr "Opslaan "
|
|
|
|
#: lazarusidestrconsts:lissave
|
|
msgid "Save ..."
|
|
msgstr "Opslaan ..."
|
|
|
|
#: lazarusidestrconsts:lismenusaveall
|
|
msgid "Save All"
|
|
msgstr "Alles Opslaan"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatesaveas
|
|
msgid "Save As"
|
|
msgstr "Opslaan Als"
|
|
|
|
#: lazarusidestrconsts:dlgcharcasefileact
|
|
msgid "Save As - auto rename pascal files lower case"
|
|
msgstr "Opslaan als - Pascal bestands namen converteren naar kleine letters."
|
|
|
|
#: lazarusidestrconsts:lismenusaveas
|
|
msgid "Save As ..."
|
|
msgstr "Opslaan Als ..."
|
|
|
|
#: lazarusidestrconsts:lismenueditorsaveastemplate
|
|
msgid "Save As Template..."
|
|
msgstr "Opslaan als Template"
|
|
|
|
#: lazarusidestrconsts:lispckeditsavechanges
|
|
msgid "Save Changes?"
|
|
msgstr "Wijzigingen Opslaan?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Package Opslaan %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackage
|
|
msgid "Save Package?"
|
|
msgstr "Package Opslaan ?"
|
|
|
|
#: lazarusidestrconsts:lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Project Opslaan "
|
|
|
|
#: lazarusidestrconsts:lissaveprojectlpi
|
|
msgid "Save Project %s (*.lpi)"
|
|
msgstr "Opslaan Projecy %s (*.lpi)"
|
|
|
|
#: lazarusidestrconsts:lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Project Opslaan Als ..."
|
|
|
|
#: lazarusidestrconsts:lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Sla instelling op"
|
|
|
|
#: lazarusidestrconsts:lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Alles Opslaan"
|
|
|
|
#: lazarusidestrconsts:lissaveallmessagestofile
|
|
msgid "Save all messages to file"
|
|
msgstr "Alle berichten naar bestand schrijven"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Opslaan en Afsluiten"
|
|
|
|
#: lazarusidestrconsts:lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Opslaan en dialoog sluiten"
|
|
|
|
#: lazarusidestrconsts:lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Opslaan and IDE opnieuw bouwen"
|
|
|
|
#: lazarusidestrconsts:lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Wijzigingen in project %s opslaan?"
|
|
|
|
#: lazarusidestrconsts:lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Wijzigingen opslaan?"
|
|
|
|
#: lazarusidestrconsts:dlgsavedfile
|
|
msgid "Save desktop settings to file"
|
|
msgstr "Desktop instelling opslaan in een bestand"
|
|
|
|
#: lazarusidestrconsts:dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Bewaar bewerker informatie voor gesloten bestanden"
|
|
|
|
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Bewaar bewerker info voor bestanden buiten het project"
|
|
|
|
#: lazarusidestrconsts:dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Sla alleen bewerker informatie op voor project bestanden"
|
|
|
|
#: lazarusidestrconsts:lissavefilebeforeclosingform
|
|
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
|
|
msgstr "Bestand %s%s%s%sopslaan voor het sluiten van form %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Sla bestand op als"
|
|
|
|
#: lazarusidestrconsts:lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr "Bewaar bestand dialoogvenster"
|
|
|
|
#: lazarusidestrconsts:fdmsaveformasxml
|
|
msgid "Save form as xml"
|
|
msgstr "Sla formulier als xml op"
|
|
|
|
#: lazarusidestrconsts:lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Opslaan in .lpi bestand"
|
|
|
|
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Opslaan in .lps bestand in project directory"
|
|
|
|
#: lazarusidestrconsts:lisposaveinideconfigdirectory
|
|
msgid "Save in IDE config directory"
|
|
msgstr "Opslaan in IDE configuratie directorie"
|
|
|
|
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Bewaar info gesloten bewerker bestanden"
|
|
|
|
#: lazarusidestrconsts:lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Berichten opslaan in bestand (*.txt)"
|
|
|
|
#: lazarusidestrconsts:lispckeditsavepackage
|
|
msgid "Save package"
|
|
msgstr "Pakket opslaan"
|
|
|
|
#: lazarusidestrconsts:lispkgmangsavepackage2
|
|
msgid "Save package?"
|
|
msgstr "Pakket opslaan?"
|
|
|
|
#: lazarusidestrconsts:liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Sla project op"
|
|
|
|
#: lazarusidestrconsts:liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Sla project op als"
|
|
|
|
#: lazarusidestrconsts:lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Sessie informatie opslaan in"
|
|
|
|
#: lazarusidestrconsts:lislazbuildsavesettings
|
|
msgid "Save settings"
|
|
msgstr "Sla instellingen op"
|
|
|
|
#: lazarusidestrconsts:lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Sla bestand op"
|
|
|
|
#: lazarusidestrconsts:lisiecosavetorecent
|
|
msgid "Save to recent"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Schaal"
|
|
|
|
#: lazarusidestrconsts:lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Schaal:"
|
|
|
|
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
|
|
msgid "Scan Unit for Unit Name and Register procedure"
|
|
msgstr "Zoek in de Unit naar de unit Naam en Register procedure"
|
|
|
|
#: lazarusidestrconsts:liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Zoek naar FPC meldingen"
|
|
|
|
#: lazarusidestrconsts:liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Zoek naar Make meldingen"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for Free Pascal Compiler messages"
|
|
msgstr "Doorzoek output op Free Pascal Compiler meldingen"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for make messages"
|
|
msgstr "Doorzoek outpput op make meldingen"
|
|
|
|
#: lazarusidestrconsts:dlgscope
|
|
msgid "Scope"
|
|
msgstr "Scope"
|
|
|
|
#: lazarusidestrconsts:dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Scroll met een minder"
|
|
|
|
#: lazarusidestrconsts:srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Scroll een regel naar beneden"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Scroll een karakter naar links"
|
|
|
|
#: lazarusidestrconsts:dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Scroll voorbij het einde van het bestand"
|
|
|
|
#: lazarusidestrconsts:dlgscrollpastendline
|
|
msgid "Scroll past end of line"
|
|
msgstr "Scroll voorbij het eind van de regel"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Scroll een karakter naar rechts"
|
|
|
|
#: lazarusidestrconsts:srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Scroll een regel omhoog"
|
|
|
|
#: lazarusidestrconsts:lissearchfor
|
|
msgid "Search For "
|
|
msgstr "Zoek naar "
|
|
|
|
#: lazarusidestrconsts:lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Zoek Resultaten"
|
|
|
|
#: lazarusidestrconsts:lissearchagain
|
|
msgid "Search again"
|
|
msgstr "Zoek opnieuw"
|
|
|
|
#: lazarusidestrconsts:lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Zoek ook in commentaar"
|
|
|
|
#: lazarusidestrconsts:lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
|
|
msgid "Search or Filter Phrases In List"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Doorzoek paden:"
|
|
|
|
#: lazarusidestrconsts:lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Zoekstring '%s' niet gevonden"
|
|
|
|
#: lazarusidestrconsts:dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Zoekopdracht afgebroken door de gebruiker"
|
|
|
|
#: lazarusidestrconsts:lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Zoek tekst"
|
|
|
|
#: lazarusidestrconsts:lisfrisearchwhere
|
|
msgid "Search where"
|
|
msgstr "Zoek waar"
|
|
|
|
#: lazarusidestrconsts:lisssearching
|
|
msgid "Searching"
|
|
msgstr "Bezig met zoeken"
|
|
|
|
#: lazarusidestrconsts:dlgsearchcaption
|
|
msgid "Searching..."
|
|
msgstr "Bezig met zoeken ..."
|
|
|
|
#: lazarusidestrconsts:lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Zoek naar: %s"
|
|
|
|
#: lazarusidestrconsts:liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Zie ook"
|
|
|
|
#: lazarusidestrconsts:lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Zie meldingen."
|
|
|
|
#: lazarusidestrconsts:srkmecselleft
|
|
msgid "SelLeft"
|
|
msgstr "SelLinks"
|
|
|
|
#: lazarusidestrconsts:srkmecselright
|
|
msgid "SelRight"
|
|
msgstr "SelRechts"
|
|
|
|
#: lazarusidestrconsts:lismenuselect
|
|
msgid "Select"
|
|
msgstr "Selecteer"
|
|
|
|
#: lazarusidestrconsts:srkmecselectall
|
|
msgid "Select All"
|
|
msgstr "Selecteer Alles"
|
|
|
|
#: lazarusidestrconsts:lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Selecteer Code Macro"
|
|
|
|
#: lazarusidestrconsts:lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Selecteer Delphi form bestanden (*.dfm)"
|
|
|
|
#: lazarusidestrconsts:srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Selecteer naar beneden"
|
|
|
|
#: lazarusidestrconsts:srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Selecteer Goto XY"
|
|
|
|
#: lazarusidestrconsts:srkmecsellineend
|
|
msgid "Select Line End"
|
|
msgstr "Selecteer regel einde"
|
|
|
|
#: lazarusidestrconsts:srkmecsellinestart
|
|
msgid "Select Line Start"
|
|
msgstr "Selecteer regel begin"
|
|
|
|
#: lazarusidestrconsts:lismenueditorselectmenu
|
|
msgid "Select Menu:"
|
|
msgstr "Selecteer menu:"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagebottom
|
|
msgid "Select Page Bottom"
|
|
msgstr "Selecteer onderkant Pagina"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Selecteer pagina naar beneden"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Selecteer pagina Links"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Selecteer pagina rechts"
|
|
|
|
#: lazarusidestrconsts:srkmecselpagetop
|
|
msgid "Select Page Top"
|
|
msgstr "Select bovenkant pagina"
|
|
|
|
#: lazarusidestrconsts:srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Selecteer pagina omhoog"
|
|
|
|
#: lazarusidestrconsts:lismenueditorselecttemplate
|
|
msgid "Select Template:"
|
|
msgstr "Selecteer een Template"
|
|
|
|
#: lazarusidestrconsts:srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Selecteer omhoog"
|
|
|
|
#: lazarusidestrconsts:srkmecselwordleft
|
|
msgid "Select Word Left"
|
|
msgstr "Selecteer linker woord"
|
|
|
|
#: lazarusidestrconsts:srkmecselwordright
|
|
msgid "Select Word Right"
|
|
msgstr "Selecteer rechter woord"
|
|
|
|
#: lazarusidestrconsts:lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Selecteer een help item:"
|
|
|
|
#: lazarusidestrconsts:lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Selecteer een node"
|
|
|
|
#: lazarusidestrconsts:lisnpselectaprojecttype
|
|
msgid "Select a project type"
|
|
msgstr "Selecteer een Project type"
|
|
|
|
#: lazarusidestrconsts:lismenuselectall
|
|
msgid "Select all"
|
|
msgstr "Selecteer Alles"
|
|
|
|
#: lazarusidestrconsts:lismenuselectcodeblock
|
|
msgid "Select code block"
|
|
msgstr "Selecteer code blok"
|
|
|
|
#: lazarusidestrconsts:lispatheditselectdirectory
|
|
msgid "Select directory"
|
|
msgstr "Selecteer directory"
|
|
|
|
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
|
|
msgid "Select grand childs"
|
|
msgstr "Selecteer kleinkinderen"
|
|
|
|
#: lazarusidestrconsts:lismenuselectline
|
|
msgid "Select line"
|
|
msgstr "Selecteer lijn"
|
|
|
|
#: lazarusidestrconsts:liskmselectlineend
|
|
msgid "Select line end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmselectlinestart
|
|
msgid "Select line start"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamselectnone
|
|
msgid "Select none"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmselectpagebottom
|
|
msgid "Select page bottom"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmselectpagetop
|
|
msgid "Select page top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuselectparagraph
|
|
msgid "Select paragraph"
|
|
msgstr "Selecteer paragraaf"
|
|
|
|
#: lazarusidestrconsts:lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Selecteer het parent component"
|
|
|
|
#: lazarusidestrconsts:lisselectfile
|
|
msgid "Select the file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Selecteer tot begin"
|
|
|
|
#: lazarusidestrconsts:srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Selecteer tot eind"
|
|
|
|
#: lazarusidestrconsts:lismenuselecttobrace
|
|
msgid "Select to brace"
|
|
msgstr "Selecteer tot accolade"
|
|
|
|
#: lazarusidestrconsts:lismenuselectword
|
|
msgid "Select word"
|
|
msgstr "Selecteer woord"
|
|
|
|
#: lazarusidestrconsts:liskmselectwordleft
|
|
msgid "Select word left"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmselectwordright
|
|
msgid "Select word right"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Geselecteerde node:"
|
|
|
|
#: lazarusidestrconsts:lispckexplisrequiredby
|
|
msgid "Selected package is required by:"
|
|
msgstr "Geselecteerde pakket is nodig voor:"
|
|
|
|
#: lazarusidestrconsts:dlgruberbandselectioncolor
|
|
msgid "Selection"
|
|
msgstr "Selectie"
|
|
|
|
#: lazarusidestrconsts:lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Selectie overschrijdt string constante"
|
|
|
|
#: lazarusidestrconsts:lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Selectie tool"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Puntkomma"
|
|
|
|
#: lazarusidestrconsts:dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Sessie"
|
|
|
|
#: lazarusidestrconsts:srkmecsetmarker
|
|
msgid "Set Marker %d"
|
|
msgstr "Zet markering %d"
|
|
|
|
#: lazarusidestrconsts:uemsetfreebookmark
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Plaats een beschikbaar Bookmark"
|
|
|
|
#: lazarusidestrconsts:lismenusetfreebookmark
|
|
msgid "Set a free bookmark"
|
|
msgstr "Plaats een beschikbare bookmark"
|
|
|
|
#: lazarusidestrconsts:dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Geef alle element standaardwaarde"
|
|
|
|
#: lazarusidestrconsts:dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Geef element standaardwaarde"
|
|
|
|
#: lazarusidestrconsts:liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker0
|
|
msgid "Set marker 0"
|
|
msgstr "Zet marker 0"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker1
|
|
msgid "Set marker 1"
|
|
msgstr "Zet marker 1"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker2
|
|
msgid "Set marker 2"
|
|
msgstr "Zet marker 2"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker3
|
|
msgid "Set marker 3"
|
|
msgstr "Zet marker 3"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker4
|
|
msgid "Set marker 4"
|
|
msgstr "Zet marker 4"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker5
|
|
msgid "Set marker 5"
|
|
msgstr "Zet marker 5"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker6
|
|
msgid "Set marker 6"
|
|
msgstr "Zet marker 6"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker7
|
|
msgid "Set marker 7"
|
|
msgstr "Zet marker 7"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker8
|
|
msgid "Set marker 8"
|
|
msgstr "Zet marker 8"
|
|
|
|
#: lazarusidestrconsts:liskmsetmarker9
|
|
msgid "Set marker 9"
|
|
msgstr "Zet marker 9"
|
|
|
|
#: lazarusidestrconsts:dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Geef property variabele een waarde"
|
|
|
|
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Zet toch een breekpunt"
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolshift
|
|
msgid "Shift"
|
|
msgstr "Shift"
|
|
|
|
#: lazarusidestrconsts:srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr "Shift Tab"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Kort"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisshort
|
|
msgid "Short:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Verkort of verleng bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
|
|
msgid "Should the file be renamed lowercase to%s%s%s%s?"
|
|
msgstr "Moet het bestand met kleine letters hernoemd worden? (%s%s%s%s)"
|
|
|
|
#: lazarusidestrconsts:lisshow
|
|
msgid "Show"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisaf2pshowall
|
|
msgid "Show All"
|
|
msgstr "Toon alles"
|
|
|
|
#: lazarusidestrconsts:liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Toon waarde van CodeTools"
|
|
|
|
#: lazarusidestrconsts:dlgcoshowerr
|
|
msgid "Show Errors"
|
|
msgstr "Toon fouten"
|
|
|
|
#: lazarusidestrconsts:dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Toon steunlijnen"
|
|
|
|
#: lazarusidestrconsts:dlgshowhint
|
|
msgid "Show Hints"
|
|
msgstr "Toon Hints"
|
|
|
|
#: lazarusidestrconsts:dlghintsparametersendernotused
|
|
msgid "Show Hints for parameter \"Sender\" not used"
|
|
msgstr "Toon Hints voor parameter \"Sender\" niet gebruikt"
|
|
|
|
#: lazarusidestrconsts:dlghintsunused
|
|
msgid "Show Hints for unused units in main source"
|
|
msgstr "Toon Hints voor ongebruikte units in de hoofd broncode"
|
|
|
|
#: lazarusidestrconsts:uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Toon regelnummers"
|
|
|
|
#: lazarusidestrconsts:dlgshownotes
|
|
msgid "Show Notes"
|
|
msgstr "Toon notities"
|
|
|
|
#: lazarusidestrconsts:dlgcoshowoptions
|
|
msgid "Show Options"
|
|
msgstr "Toon opties"
|
|
|
|
#: lazarusidestrconsts:fdmshowoptions
|
|
msgid "Show Options for form editing"
|
|
msgstr "Toon opties voor form bewerkingen"
|
|
|
|
#: lazarusidestrconsts:liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshowwarnings
|
|
msgid "Show Warnings"
|
|
msgstr "Toon waarschuwingen"
|
|
|
|
#: lazarusidestrconsts:srkmecshowabstractmethods
|
|
msgid "Show abstract methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pshowall
|
|
msgid "Show all"
|
|
msgstr "Toon alles"
|
|
|
|
#: lazarusidestrconsts:liscoshowallmessages
|
|
msgid "Show all messages"
|
|
msgstr "Toon alle berichten"
|
|
|
|
#: lazarusidestrconsts:dlgshowprocserror
|
|
msgid "Show all procs on error"
|
|
msgstr "Toon alle procs bij een fout"
|
|
|
|
#: lazarusidestrconsts:dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Toon ""border spacing"""
|
|
|
|
#: lazarusidestrconsts:dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Toon sluitknoppen in notebook"
|
|
|
|
#: lazarusidestrconsts:srkmecshowcodecontext
|
|
msgid "Show code context"
|
|
msgstr "Toon code samenhang"
|
|
|
|
#: lazarusidestrconsts:dlgqshowcompiledialog
|
|
msgid "Show compile dialog"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Toon gecompileerde procedures"
|
|
|
|
#: lazarusidestrconsts:dlgshowcompileroptions
|
|
msgid "Show compiler options"
|
|
msgstr "Toon compiler opties"
|
|
|
|
#: lazarusidestrconsts:dlgshowcaps
|
|
msgid "Show component captions"
|
|
msgstr "Toon component titels"
|
|
|
|
#: lazarusidestrconsts:dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Toon voorwaarden"
|
|
|
|
#: lazarusidestrconsts:dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Toon debug informatie"
|
|
|
|
#: lazarusidestrconsts:dlgshowdefinedmacros
|
|
msgid "Show defined macros"
|
|
msgstr "Toon gedefinieerde macros"
|
|
|
|
#: lazarusidestrconsts:dlgshowedrhints
|
|
msgid "Show editor hints"
|
|
msgstr "Toon bewerker hints"
|
|
|
|
#: lazarusidestrconsts:liscodehelpshowemptymethods
|
|
msgid "Show empty methods"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Toon alles"
|
|
|
|
#: lazarusidestrconsts:dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Toon info uitvoerbaar bestand (Win32)"
|
|
|
|
#: lazarusidestrconsts:dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Toon algemene info"
|
|
|
|
#: lazarusidestrconsts:lispldshowgloballinks
|
|
msgid "Show global links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Toon grid"
|
|
|
|
#: lazarusidestrconsts:dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Toon goot hints"
|
|
|
|
#: lazarusidestrconsts:lisshowhintsinobjectinspector
|
|
msgid "Show hints in Object Inspector"
|
|
msgstr "Toon hints in Object Inspecteur"
|
|
|
|
#: lazarusidestrconsts:lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshowlinenumbers
|
|
msgid "Show line numbers"
|
|
msgstr "Toon regelnummers"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Toon meldingen bij stoppen"
|
|
|
|
#: lazarusidestrconsts:dlgshownothing
|
|
msgid "Show nothing (only errors)"
|
|
msgstr "Toon niets (alleen fouten)"
|
|
|
|
#: lazarusidestrconsts:lisshowoldtaborder
|
|
msgid "Show old tab order"
|
|
msgstr "Toon oude tab volgorde"
|
|
|
|
#: lazarusidestrconsts:lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Toon paketten"
|
|
|
|
#: lazarusidestrconsts:dlgshowscrollhint
|
|
msgid "Show scroll hint"
|
|
msgstr "Toon scroll hint"
|
|
|
|
#: lazarusidestrconsts:lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Toon samenvatting"
|
|
|
|
#: lazarusidestrconsts:dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Toon geteste bestanden"
|
|
|
|
#: lazarusidestrconsts:lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Toon units"
|
|
|
|
#: lazarusidestrconsts:dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Toon gebruikte bestanden"
|
|
|
|
#: lazarusidestrconsts:lispldshowuserlinks
|
|
msgid "Show user links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissibling
|
|
msgid "Sibling"
|
|
msgstr "Nakomeling"
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signalen"
|
|
|
|
#: lazarusidestrconsts:lissimplesyntax
|
|
msgid "Simple Syntax"
|
|
msgstr "Eenvoudige syntax"
|
|
|
|
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Eenvoudige syntax (* i.p.v. .*)"
|
|
|
|
#: lazarusidestrconsts:fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Grootte"
|
|
|
|
#: lazarusidestrconsts:lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Grootte"
|
|
|
|
#: lazarusidestrconsts:lisccoskip
|
|
msgid "Skip"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscoskipcallingcompiler
|
|
msgid "Skip calling Compiler"
|
|
msgstr "Sla compiler aanroep over"
|
|
|
|
#: lazarusidestrconsts:lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Sla bestand over en vervolg het laden"
|
|
|
|
#: lazarusidestrconsts:lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Sla het laden van het laatste project over"
|
|
|
|
#: lazarusidestrconsts:lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcosmaller
|
|
msgid "Smaller Code"
|
|
msgstr "Kleinere code"
|
|
|
|
#: lazarusidestrconsts:dlgcosmartlinkable
|
|
msgid "Smart Linkable"
|
|
msgstr "Slim te linken"
|
|
|
|
#: lazarusidestrconsts:dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Slimme tabs"
|
|
|
|
#: lazarusidestrconsts:dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Aan steunlijnen plakken"
|
|
|
|
#: lazarusidestrconsts:dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Aan raster plakken"
|
|
|
|
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Bepaalde bestanden zijn gewijzigd op schijf:"
|
|
|
|
#: lazarusidestrconsts:lissorrynotimplementedyet
|
|
msgid "Sorry, not implemented yet"
|
|
msgstr "Excuses, dit is nog niet geimplementeerd"
|
|
|
|
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Excuses, dit type is nog niet geimplementeerd."
|
|
|
|
#: lazarusidestrconsts:lispesortfiles
|
|
msgid "Sort files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Sorteer Selectie"
|
|
|
|
#: lazarusidestrconsts:lismenusortselection
|
|
msgid "Sort selection ..."
|
|
msgstr "Sorteer Selectie ..."
|
|
|
|
#: lazarusidestrconsts:lisceomodesource
|
|
msgid "Source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuviewsourceeditor
|
|
msgid "Source Editor"
|
|
msgstr "Broncode Bewerker"
|
|
|
|
#: lazarusidestrconsts:srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Bron notitieblok opdrachten"
|
|
|
|
#: lazarusidestrconsts:lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Bron en doel zijn het zelfde:%s%s"
|
|
|
|
#: lazarusidestrconsts:lismenuaddbpsource
|
|
msgid "Source breakpoint"
|
|
msgstr "Broncode breekpunt"
|
|
|
|
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
|
|
msgid "Source directory %s%s%s does not exist."
|
|
msgstr "Bron directory %s%s%s bestaat niet"
|
|
|
|
#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
|
|
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Bron gewijzigd"
|
|
|
|
#: lazarusidestrconsts:lissourceofpagehaschangedsave
|
|
msgid "Source of page %s%s%s has changed. Save?"
|
|
msgstr "Bron van pagina %s%s%s is gewijzigd. Opslaan?"
|
|
|
|
#: lazarusidestrconsts:lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Bron paden"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Bron vooruitzicht"
|
|
|
|
#: lazarusidestrconsts:dlgspacenotcosmos
|
|
msgid "Space"
|
|
msgstr "Spatie"
|
|
|
|
#: lazarusidestrconsts:lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Gelijkmatige verdeling"
|
|
|
|
#: lazarusidestrconsts:rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "Spaans"
|
|
|
|
#: lazarusidestrconsts:lisuidsrc
|
|
msgid "Src"
|
|
msgstr "Src"
|
|
|
|
#: lazarusidestrconsts:dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Stack"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Standaard Edit Menu"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Standaard bestand menu"
|
|
|
|
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Standaard Help Menu"
|
|
|
|
#: lazarusidestrconsts:lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Met een nieuw project starten"
|
|
|
|
#: lazarusidestrconsts:lisoipstate
|
|
msgid "State"
|
|
msgstr "Status"
|
|
|
|
#: lazarusidestrconsts:dlgstatickeyword
|
|
msgid "Static Keyword in Objects"
|
|
msgstr "\"Static\"-sleutelwoord in objecten"
|
|
|
|
#: lazarusidestrconsts:lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Step Into"
|
|
|
|
#: lazarusidestrconsts:lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Step Over"
|
|
|
|
#: lazarusidestrconsts:lismenustepinto
|
|
msgid "Step into"
|
|
msgstr "Step Into"
|
|
|
|
#: lazarusidestrconsts:lismenustepover
|
|
msgid "Step over"
|
|
msgstr "Step Over"
|
|
|
|
#: lazarusidestrconsts:lismenustop
|
|
msgid "Stop"
|
|
msgstr "Stoppen"
|
|
|
|
#: lazarusidestrconsts:lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Stoppen met debuggen?"
|
|
|
|
#: lazarusidestrconsts:dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Stop na aantal fouten:"
|
|
|
|
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Stop huidige debugsessie en het project opnieuw bouwen?"
|
|
|
|
#: lazarusidestrconsts:lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Stop debugsessie"
|
|
|
|
#: lazarusidestrconsts:liskmstopprogram
|
|
msgid "Stop program"
|
|
msgstr "Stop programma"
|
|
|
|
#: lazarusidestrconsts:lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Stoppen met debuggen?"
|
|
|
|
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
|
|
msgid "Store dependency filename"
|
|
msgstr "Sla afhankelijkheid bestandsnaam op"
|
|
|
|
#: lazarusidestrconsts:dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "Opgeslagen postfix"
|
|
|
|
#: lazarusidestrconsts:lisstreamerror
|
|
msgid "Stream Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Fout in streaming"
|
|
|
|
#: lazarusidestrconsts:lisstring
|
|
msgid "String"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "String constante"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "String constante in broncode"
|
|
|
|
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Strings met dezelfde waarde:"
|
|
|
|
#: lazarusidestrconsts:dlgcostrip
|
|
msgid "Strip Symbols From Executable"
|
|
msgstr "Verwijderen symbolen uit het uitvoerbaar bestand."
|
|
|
|
#: lazarusidestrconsts:lisstyle
|
|
msgid "Style"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Subprocedure"
|
|
|
|
#: lazarusidestrconsts:lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Subprocedure op hetzelfde niveau"
|
|
|
|
#: lazarusidestrconsts:dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Subdirectorie"
|
|
|
|
#: lazarusidestrconsts:dlgsubpropkcolor
|
|
msgid "Subpropertes"
|
|
msgstr "Subproperties"
|
|
|
|
#: lazarusidestrconsts:lissuccess
|
|
msgid "Success"
|
|
msgstr "Succes!"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildsuccess
|
|
msgid "Success..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Wissel paden om"
|
|
|
|
#: lazarusidestrconsts:srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Schakel tussen form en unit"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symbool"
|
|
|
|
#: lazarusidestrconsts:dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Symbool erachter (.pp~)"
|
|
|
|
#: lazarusidestrconsts:dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Symbool ervoor (.~pp)"
|
|
|
|
#: lazarusidestrconsts:lissynedit
|
|
msgid "SynEdit"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
|
|
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
|
|
msgstr "Synedit - de bewerker component gebruikt in Lazarus. http://sourceforge.net/projects/synedit/"
|
|
|
|
#: lazarusidestrconsts:srkmecsyntaxcheck
|
|
msgid "Syntax check"
|
|
msgstr "Syntax controleren"
|
|
|
|
#: lazarusidestrconsts:lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Syntax opties"
|
|
|
|
#: lazarusidestrconsts:dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Systeem variabelen"
|
|
|
|
#: lazarusidestrconsts:dlgbp7cptb
|
|
msgid "TP/BP 7.0 Compatible"
|
|
msgstr "TP/BP 7.0 Compatibel"
|
|
|
|
#: lazarusidestrconsts:listab
|
|
msgid "Tab"
|
|
msgstr "Tab"
|
|
|
|
#: lazarusidestrconsts:listaborderof
|
|
msgid "Tab Order of"
|
|
msgstr "Tab volgorde van"
|
|
|
|
#: lazarusidestrconsts:dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tab laat blokken inspringen"
|
|
|
|
#: lazarusidestrconsts:fdmtaborder
|
|
msgid "Tab order..."
|
|
msgstr "Tab volgorde..."
|
|
|
|
#: lazarusidestrconsts:liseotabwidths
|
|
msgid "Tab widths"
|
|
msgstr "Tab grootte"
|
|
|
|
#: lazarusidestrconsts:dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tabs naar spaties"
|
|
|
|
#: lazarusidestrconsts:lismenutabstospacesselection
|
|
msgid "Tabs to spaces in selection"
|
|
msgstr "Tabs naar Spaties"
|
|
|
|
#: lazarusidestrconsts:lislazbuildqboapplcltarget
|
|
msgid "Target"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Doel processor"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Doel processor"
|
|
|
|
#: lazarusidestrconsts:listargetos
|
|
msgid "Target OS"
|
|
msgstr "Doel OS"
|
|
|
|
#: lazarusidestrconsts:liscotargetosspecificoptions
|
|
msgid "Target OS specific options"
|
|
msgstr "Doel-OS-specifieke opties"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Doel OS:"
|
|
|
|
#: lazarusidestrconsts:dlgtargetplatform
|
|
msgid "Target Platform:"
|
|
msgstr "Doelplatform:"
|
|
|
|
#: lazarusidestrconsts:lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgpotargetfilename
|
|
msgid "Target file name:"
|
|
msgstr "Doelbestandsnaam:"
|
|
|
|
#: lazarusidestrconsts:listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Doelbestandsnaam + parameters"
|
|
|
|
#: lazarusidestrconsts:listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Doelbestandsnaam van het projekt"
|
|
|
|
#: lazarusidestrconsts:dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenueditortemplatepreview
|
|
msgid "Template Preview"
|
|
msgstr "Template vooruitzicht"
|
|
|
|
#: lazarusidestrconsts:dlgtplfname
|
|
msgid "Template file name"
|
|
msgstr "Template bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Templates"
|
|
|
|
#: lazarusidestrconsts:dlgccotest
|
|
msgid "Test"
|
|
msgstr "Test"
|
|
|
|
#: lazarusidestrconsts:listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testdirectorie"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Test directory \"%s\" niet gevonden."
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
|
|
msgid "Test: Checking fpc configs ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypetext
|
|
msgid "Text"
|
|
msgstr "Tekst"
|
|
|
|
#: lazarusidestrconsts:dlgtextattributes
|
|
msgid "Text attributes"
|
|
msgstr "Tekstattributen"
|
|
|
|
#: lazarusidestrconsts:srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Tekstverwerkingsopdrachten"
|
|
|
|
#: lazarusidestrconsts:srkmcatmarker
|
|
msgid "Text marker commands"
|
|
msgstr "Tekstmarkering opdrachten"
|
|
|
|
#: lazarusidestrconsts:srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Tekstzoek- en vervangopdrachten"
|
|
|
|
#: lazarusidestrconsts:srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Tekstselectieopdrachten"
|
|
|
|
#: lazarusidestrconsts:lisfindfiletexttofind
|
|
msgid "Text to find:"
|
|
msgstr "Te zoeken tekst"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgtext1
|
|
msgid "Text1"
|
|
msgstr "Tekst1"
|
|
|
|
#: lazarusidestrconsts:lisdiffdlgtext2
|
|
msgid "Text2"
|
|
msgstr "Tekst2"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: /home/user/kylis%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert,%sdie worden gebruikt door dit %s project.%sBijvoorbeeld: C:/Program Files/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "The %s hoofddirectorie,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld: /home/user/kylis%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "The %s hoofddirectory,%swaar Borland alle %s broncode installeert.%sBijvoorbeeld C:/Program Files/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "De %s project directorie,%waar de .dpr, .dpk bestanden staan."
|
|
|
|
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
|
|
msgstr "De FCL - FreePascol Componenten Bibliotheek bevat de basis klassen voor object pascal"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
|
|
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr "De Free Pascal SVN-broncode directory."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
|
|
msgstr "De Free Pascal SVN-broncode directory. Niet verplicht. Het verbetert het declaraties zoeken en debuggen."
|
|
|
|
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
|
|
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
|
|
msgstr "De Free Pascal compiler (bestandsnaam: %s) niet gevonden.%sHet is raadzaam om FPC te installeren."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "De Free Pascal project directorie."
|
|
|
|
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
|
|
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
|
|
msgstr "The Free Pascal-broncodedirectory is niet gevonden.%sSommige code functies zullen niet werken.%sAan te raden is dit te installeren en het pad in te stellen%sInstellingen -> Omgeving opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
|
|
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
|
|
msgstr "De LCL - Lazarus-componentenbibliotheek bevat alle basis componenten voor het bewerken van een form."
|
|
|
|
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
|
|
msgstr "Het LFM (Lazarus form) bestand bevat ongeldige properties. Dit kan betekenen dat het properties/klassen bevat, die niet in de huidige LCL voorkomen. De manier om dit te repareren is deze properties te verwijderen uit de lfm en de pascal handmatig aan te passen."
|
|
|
|
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
|
|
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr "De lazarus directorie is niet gevonden.%Je kunt geen LCL programmaas maken.%Controleer Instellingen -> Omgeving Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
|
|
msgid "The Lazarus main directory."
|
|
msgstr "De hoofddirectorie van Lazarus"
|
|
|
|
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
|
|
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr "De Maximum Versie %s%s%s is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "De maximum versie is lager dan de minimum versie"
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
|
|
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
|
|
msgstr "De Minimum Versie %s%s%s is ongeldig.%sGebruik het formaat major.minor.release.build%sBijvoorbeeld: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
|
|
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
|
|
msgstr "De RTL - De \"Run-Time Library\" is de basis van alle Free Pascal programma's"
|
|
|
|
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
|
|
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
|
|
msgstr "De testdirectorie is niet gevonden:%s%s%s%s%s(zie omgeving opties)"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
|
|
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr "Het type van de ancestor %s%s%s heeft dezelfde naam als%sde unit %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
|
|
msgstr "Het type van de ancestor %s%s%s is geen geldige pascal identifier."
|
|
|
|
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
|
|
msgstr "De klasse %s%s%s is een TControl en kan niet op een niet control geplaatst worden.%sPlakken mislukt."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
|
|
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
|
|
msgstr "De naam van de klasse %s%s%s en het type van de ancestor %s%s%s zijn gelijk."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
|
|
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
|
|
msgstr "De naam van de klasse %s%s%s bestaat al in%sPackage %s%sBestand: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
|
|
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
|
|
msgstr "De naam van de klasse %s%s%s is dezelfde als%sde unit %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
|
|
msgid "The class name %s%s%s is not a valid pascal identifier."
|
|
msgstr "De naam van de klasse %s%s%s is geen geldige pascal identifier."
|
|
|
|
#: lazarusidestrconsts:listhecodetoolsfoundanerror
|
|
msgid "The codetools found an error:%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhecommandafterisnotexecutable
|
|
msgid "The command after %s%s%s is not executable."
|
|
msgstr "Het commando na %s%s%s kan niet worden uitgevoerd."
|
|
|
|
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
|
|
msgid "The command after publishing is invalid:%s%s%s%s"
|
|
msgstr "Het commando na publicatie is ongeldig:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
|
|
msgid "The compiler file \"%s\" is not an executable."
|
|
msgstr "Het compiler bestand \"%s\" is niet uitvoerbaar."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "Het compiler bestand voor package %s is geen geldige executable:%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
|
|
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
|
|
msgstr "De component bewerker van klasse %s%s%s%saangeroepen met #%s %s%s%s%sveroorzaakte de fout:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr "The huidige FPC broncode directory %s%s%s%slijkt niet correct.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
|
|
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "The huidige FPC-broncodedirectory %s%s%s%slijkt niet correct.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
|
|
msgstr "De huidige Lazarus-directorie %s%s%s%slijkt niet correct.%sZonder dat kunt u geen LCL applicaties bouwen.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
|
|
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "De huidige Lazarus-directorie %s%s%s%slijkt niet correct.%sZonder dat kunt u geen LCL applicaties bouwen.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
|
|
msgstr "De huidige compiler bestandsnaam %s%s%s%sis geen geldige executable.%sKlik op OK voor de standaard %s%s%s.%sOf controleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
|
|
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
|
|
msgstr "De huidige compilerbestandsnaam %s%s%s%sis geen geldige executable.%sControleer Instellingen -> Omgevings Opties -> Bestanden"
|
|
|
|
#: lazarusidestrconsts:lisuethecurre
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
|
|
msgstr "Het huidige bewerker-lettertype ondersteunt geen UTF-8, maar uw systeem schijnt het te gebruiken. Niet-ASCII karakters zullen waarschijnlijk incorrect afgebeeld worden. U kunt een ander lettertype in de bewerker-opties selecteren."
|
|
|
|
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
|
|
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
|
|
msgstr "Het huidige pad naar het bestand%s%s%s%s is%s%s%s%s.%s%sHet pad naar de LCL units %s%s%s ontbreekt.%s%sHint voor newbies:%sMaak een lazarus applicatie en zet het bestand in de project directory."
|
|
|
|
#: lazarusidestrconsts:lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
|
|
msgstr "De debugger %s%s%s%sbestaat niet of is niet uitvoerbaar.%s%sZie Instellingen -> Debugger opties"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Het debuggerbestand \"%s\" is niet uitvoerbaar."
|
|
|
|
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
|
|
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
msgstr "De afhankelijkheid %s%s%s is niet gevonden.%sKies een bestaand package."
|
|
|
|
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
|
|
msgid "The destination directory%s%s%s%s does not exist."
|
|
msgstr "De doel directorie%s%s%s%s bestaat niet."
|
|
|
|
#: lazarusidestrconsts:listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
|
|
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "De directory %s%s%s is overbodig in het unit pad.%sDirectory verwijderen?"
|
|
|
|
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
|
|
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
|
|
msgstr "De directory %s%s%s is nog niet in het unit path.%sDirectory toevoegen?"
|
|
|
|
#: lazarusidestrconsts:dlgthedirectory
|
|
msgid "The directory \""
|
|
msgstr "De directorie \""
|
|
|
|
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
msgid "The file %s seems to be the program file of an existing lazarus Project."
|
|
msgstr "Het bestand %s lijkt het programma bestand te zijn van een bestaand Lazarus project."
|
|
|
|
#: lazarusidestrconsts:listhefile
|
|
msgid "The file %s%s%s"
|
|
msgstr "Het bestand %s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
|
|
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
|
|
msgid "The file %s%s%s is already in the package."
|
|
msgstr "Het bestand %s%s%s maakt al deel uit van het package."
|
|
|
|
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
|
|
msgid "The file %s%s%s is not a Delphi project (.dpr)"
|
|
msgstr "Het bestand %s%s%s is geen Delphi Project (.dpr)"
|
|
|
|
#: lazarusidestrconsts:listhefileisnotadelphiunit
|
|
msgid "The file %s%s%s is not a Delphi unit."
|
|
msgstr "Het bestand %s%s%s is geen Delphi unit."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
|
|
msgid "The file %s%s%s is not a lazarus package."
|
|
msgstr "Het bestand %s%s%s is geen Lazarus package"
|
|
|
|
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Het bestand %s%s%s is onderdeel van het huidige project.%sHet is niet aan te raden bestanden te delen tussen project en packages."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
|
|
msgid "The file %s%s%s%sis already in the package %s."
|
|
msgstr "Het bestand %s%s%s%smaakt al deel uit van het package %s."
|
|
|
|
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
|
|
msgstr "Het bestand %s%s%s%sstaat niet in het unitpad van het package.%s%s %s%s%s toevoegen aan het unitpad?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
|
|
msgid "The file %s%s%s%sof package %s is missing."
|
|
msgstr "Het bestand %s%s%s%svan package %s ontbreekt."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
|
|
msgid "The file %s%s%s%sof package %s needs to be saved first."
|
|
msgstr "Het bestand %s%s%s%svan package %s dient eerst te worden opgeslagen."
|
|
|
|
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
|
|
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "het bestand %s%s%s%slijkt een programma te zijn. Het huidige project sluiten, en een nieuw Lazarus project voor dit programma maken?%s\"Nee\" zal het bestand als een normale bron laden."
|
|
|
|
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
|
|
msgstr "Het bestand %s%s%s%sis gevonden in een broncode directory van het package %s en lijkt een gecompileerde unit. Gecompileerde units moeten in de output directory van het package staan, anders kunnen andere packages problemen ondervinden.%s%s Dit bestand verwijderen?"
|
|
|
|
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
|
|
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
|
|
msgstr "Het bestand %s%s%s%sis niet gevonden.%sWilt u het zelf zoeken?%s"
|
|
|
|
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Het bestand %s%s%s%sis niet gevonden.%sIgnore gaat door met het laden,%sAbort stopt het laden van het project."
|
|
|
|
#: lazarusidestrconsts:uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Het bestand \""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
|
|
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "De bestandsnaam %s%s%s is onderdeel van het huidige project.%sProjecten en Packages mogen geen bestanden delen."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
|
|
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
|
|
msgstr "De bestandsnaam %s%s%s wordt gebruikt door%shet package %s%s%s%sin bestand %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
|
|
msgstr "De bestandsnaam %s%s%s correspondeert niet met de package naam %s%s%s in het bestand.%sPackage naam wijzigen in %s%s%s?"
|
|
|
|
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "De bestandsnaam %s%s%s is onduidelijk, omdat het package geen standaard directorie heeft.%sGeef een bestandsnaam inclusief het pad."
|
|
|
|
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "De volgende methoden gebruikt door %s zijn niet in de bron%s%s%s%s%s%sVerwijder deze referenties?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Het volgende pakket is niet geladen:"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "De volgende pakketten zijn niet geladen:"
|
|
|
|
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
|
|
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
|
|
msgstr "De volgende units werden niet gevonden:%s%s%s%s1) Deze units bevinden zich ofwel niet in het unit pad, u kunt dan afbreken, het pad repareren en opnieuw proberen.%s2) Of u kunt de ontbrekende units negeren."
|
|
|
|
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
|
|
msgid "The host application %s%s%s is not executable."
|
|
msgstr "Het \"host\" programma %s%s%s is niet uitvoerbaar."
|
|
|
|
#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
|
|
msgstr "Het startende programma %s%s%s%sbestaat niet of is niet uitvoerbaar.%s%sZie Starten -> Start paramaters -> Lokaal"
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
|
|
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
|
|
msgstr "De Lazarus directorie \"%s\" lijkt fout te zijn. Normaliter bevat het directories zoals lcl, debugger, designer, components, ... ."
|
|
|
|
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
|
|
msgid "The make file \"%s\" is not an executable."
|
|
msgstr "Het make bestand \"%s\" is niet uitvoerbaar."
|
|
|
|
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
|
|
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "De maximum versie %s%s%s is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
|
|
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "De minimum versie %s%s%s is geen geldige package versie.%s(Correct voorbeeld 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
|
|
msgid "The name %s%s%s is not a valid pascal identifier."
|
|
msgstr "De naam %s%s%s is geen geldige pascal identifier."
|
|
|
|
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
|
|
msgid "The name \"%s\" is not a valid pascal identifier."
|
|
msgstr "De naam \"%s\" is geen geldige pascal identifier."
|
|
|
|
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryismissing
|
|
msgid "The output directory %s%s%s is missing."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
|
|
msgstr "Het package %s is alleen beschikbaar in runtime.%sDit soort packages kunnen niet geinstalleerd worden."
|
|
|
|
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Het package %s is niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Het package %s is nodig voor %s, dat geinstalleerd moet worden.%sZie package plaatje."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
|
|
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
|
|
msgstr "Het package %s bevat het bestand%s%s%s%s.%sMoet het bestand daar ook hernoemd worden?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
|
|
msgstr "Het package %s%s%s kon niet worden gecompileerd.%Het package verwijderen uit de installatie lijst?"
|
|
|
|
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
|
|
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
|
|
msgstr "Het package %s%s%s heeft de \"auto install\" vlag.%sDit betekent dat het in de IDE wordt geinstalleerd. Te installeren packages moeten \"ontwerp\" packages zijn. "
|
|
|
|
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr "Het package %s%s%s is geinstalleerd, maar er is geen geldig .lpk bestand gevonden.%sEen dummy package is aangemaakt."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Het package %s%s%s is aangemeld voor installatie, maar is niet gevonden.%Afhankelijkheid verwijderen van de lijst te installeren packages?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Het package %s%s%s is aangemeld voor installatie.%sLazarus ondersteund alleen statisch gelinkte packages. Om het te installeren moet lazarus opnieuw gebouwd en gestart worden.%s%sWilt u Lazarus opnieuw bouwen?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Het package %s%s%s is verwijderd.%sLazarus ondersteund alleen statisch gelinkte packages. Om het volledig te de-installeren moet lazarus opnieuw gebouwd en gestart worden.%s%sWilt u Lazarus opnieuw bouwen?"
|
|
|
|
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
|
|
msgstr "De bestandsnaam voor package %s%s%s is%s%s%s%s is geen geldige lazarus package naam."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
|
|
msgid "The package has already a dependency for the package %s%s%s."
|
|
msgstr "Het package heeft al een afhankelijkheid van package %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
|
|
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
|
|
msgstr "Het packagenaam %s%s%s is niet geldig.%sKies een bestaand package."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
|
|
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
|
|
msgstr "Het package %s%s%s is niet geldig.%sKies een bestaand package."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "Het packagenaam %s%s%s is geen geldige packagenaam%sKies een andere naam (bijv. package1.lpk)"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
|
|
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
|
|
msgstr "De package naam %s%s%s van%shet bestand %s%s%s is ongeldig."
|
|
|
|
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
|
|
msgid "The page name %s%s%s is too long (max 100 chars)."
|
|
msgstr "De naam van de pagina %s%s%s is te lang (max. 100 letters)."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr "Het pad naar de free pascal compiler voor dit project. Alleen nodig als je de bron FPC SVN hieronder zet. Wordt gebuikt om automatisch macros te maken."
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Het pad naar de Free Pascal compiler.%s Bijv: %s/usr/bin/%s -n%s of %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
|
|
msgstr "Het programma %smake%s is niet gevonden.%sDit is nodig om lazarus te bouwen.%s"
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
|
|
msgid "The project has already a dependency for the package %s%s%s."
|
|
msgstr "Het project is al afhankelijk van het pakket %s%s%s."
|
|
|
|
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
|
|
msgid "The project info file %s%s%s%sis equal to the project main source file!"
|
|
msgstr "Het project info bestand %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Het project moet worden opgeslagen voor het bouwen%sAls je de Test Directory invuld bij de Omgeving Opties,%skun je nieuwe projecten maken en deze gelijk bouwen.%sPorject opslaan?"
|
|
|
|
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Het project heeft het pakket %s%s%s nodig.%sDit is niet gevonden. Zie Project -> Project Inspecteur"
|
|
|
|
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
|
|
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismakeresstrchooseanothername
|
|
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "De resourcestring %s%s%s bestaat al.%sKies een andere naam.%sKlik op Negeren om het toch toe te voegen."
|
|
|
|
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
|
|
msgid "The root component can not be deleted."
|
|
msgstr "Het root component kan niet verwijderd worden."
|
|
|
|
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
|
|
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
|
|
msgstr "De unit %s%s%s bestaat al.%sNegeren forceert een hernoeming,%sAnnuleer stop het opslaan van deze source en%sAbort stopt het hele opslaan."
|
|
|
|
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
|
|
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
|
|
msgstr "De unit %s%s%s is niet in kleine letters.%sDe Free Pascal compiler 1.0.x kent alleen bestandsnamen in kleine letters. Als je geen fpc 1.0.x gebruikt, kun je dit bericht negeren.%s%sBestand hernoemen?"
|
|
|
|
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
|
|
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr "De unit heeft zelf al de naam %s%s%s. Pascal identifiers moeten uniek zijn."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
|
|
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
|
|
msgstr "De unitnaam %s%s%s bestaat al in het project%smet bestand: %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
|
|
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
|
|
msgstr "De unitnaam %s%s%s bestaat al in de selectie%smet bestand: %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
msgid "The unit name %s%s%s does not correspond to the filename."
|
|
msgstr "De unitnaam %s%s%s correspondeert niet met de bestandsnaam."
|
|
|
|
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
msgid "The unit name %s%s%s is not a valid pascal identifier."
|
|
msgstr "De unitnaam %s%s%s is geen geldige pascal identifier."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
|
|
msgstr "De unitnaam %s%s%s is gelijk aan die van een geregistreerd component.%Dit kan tot vreemde foutmeldingen leiden."
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
|
|
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
|
|
msgstr "De naam van de unit %s%s%s%sen de bestandsnaam %s%s%s verschillen"
|
|
|
|
#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
|
|
msgid "The unitname %s%s%s already exists in the package:%s%s"
|
|
msgstr "De unitnaam %s%s%s bestaat al in het package:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
|
|
msgid "The unitname %s%s%s already exists in this package."
|
|
msgstr "De unitnaam %s%s%s bestaat al in dit package."
|
|
|
|
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
|
|
msgid "The unitname is not a valid pascal identifier."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
msgid "The unitname is used when the IDE extends uses clauses."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
|
|
msgid "There are more functions in the popupmenu"
|
|
msgstr "Er zijn meer functies in het popup menu"
|
|
|
|
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "Er zijn andere bestanden in de directory met dezelfde naam,%salleen met andere hoofdletters:%s%s%sDeze verwijderen?"
|
|
|
|
#: lazarusidestrconsts:lisccoseveralcompilers
|
|
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
|
|
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
|
|
msgstr "Er zijn twee units met dezelfde naam:%s%s1. %s%s%s uit %s%s2. %s%s%s uit %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
|
|
msgstr "Er is een FPC unit met dezelfde naam als een package:%s%s%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
|
|
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
|
|
msgstr "Er is een FPC unit met dezelfde naam als:%s%s%s%s%s uit %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
|
|
msgid "There is a circle in the required packages. See package graph."
|
|
msgstr "Benodigde packages refereren aan elkaar. Zie package plaatje."
|
|
|
|
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
|
|
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
|
|
msgstr "Er is een bestand met dezelfde naam en een gelijke extensie op disk%sBestand%s%sDubbel bestand %s%s%s verwijderen?"
|
|
|
|
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Er is een maximum van %s hulpmiddelen"
|
|
|
|
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
|
|
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
|
|
msgstr "Er is een unit met de naam %s%s%s in het project.%sKies een andere naam"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
|
|
msgstr "Er is een unit met dezelfde naam als een package:%s%s1. %s%s%s uit %s%s2. %s%s%s%s"
|
|
|
|
#: lazarusidestrconsts:listhereisalreadyaformwiththename
|
|
msgid "There is already a form with the name %s%s%s"
|
|
msgstr "Er is al een form net de naam %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
|
|
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
|
|
msgstr "Er is al een package %s%s%s geladen van bestand %s%s%s.%sZie Componenten -> Package plaatje.%sVervangen is onmogelijk"
|
|
|
|
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
|
|
msgstr "Er is al een unit met de naam %s%s%S. Pascal identifiers moeten uniek zijn."
|
|
|
|
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
|
|
msgid "There is already another component with the name %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
|
|
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
|
|
msgstr "There is al een ander package met de naam %s%s%s.%sConflicterend package: %s%s%s%sBestand: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Er is een niet opgeslagen package in the benodigde packages. Zie package plaatje."
|
|
|
|
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Er is geen debugger ingesteld.%Het plaatsen van breakpoints heeft geen effect totdat je een debugger hebt aangegeven in de Debugger Instellingen in het menu."
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Er is een fout opgetreden tijdens het opslaan van het geselecteerde component %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Er is een fout opgetreden tijdens het converteren van de binaire stream van het geselecteerde component %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Er is een fout opgetreden tijdens het kopiëren van de component stream naar het klembord:%s%s"
|
|
|
|
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Dit bestand is niet aanwezig in een van de geladen packages."
|
|
|
|
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
|
|
msgid "This file was automatically created by Lazarus. Do not edit!"
|
|
msgstr "Dit bestand is automatisch aangemaakt door Lazarus. Niet wijzigen!"
|
|
|
|
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Dit is een viruteel pakket. Er is nog geen broncode. Sla het pakket eerst op."
|
|
|
|
#: lazarusidestrconsts:lisresourcefilecomment
|
|
msgid "This is an automatically generated lazarus resource file"
|
|
msgstr "Dit is een automatisch aangemaakt lazarus broncode bestand"
|
|
|
|
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "Dit is het standaard pakket. Het wordt alleen gebruikt voor componenten zonder package. Deze zijn verouderd."
|
|
|
|
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
|
|
msgstr "Dit is het verwante control waaraan de bodemzijde is verankerd. Laat het leeg voor ouders."
|
|
|
|
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
|
|
msgstr "Dit is het verwante control waaraan de linkerzijde is verankerd. Laat het leeg voor ouders"
|
|
|
|
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
|
|
msgstr "Dit is het verwante control waaraan de rechterzijde is verankerd. Laat het leeg voor ouders"
|
|
|
|
#: lazarusidestrconsts:listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
|
|
msgstr "Dit is het verwante control waaraan de bovenzijde is verankerd. Laat het leeg voor ouders"
|
|
|
|
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Dit lijkt op een pascal bestand.%sAangeraden wordt om alleen kleine letters te gebruiken in de bestandnaam, om problemen te voorkomen.%sHernoemen naar kleine letters?"
|
|
|
|
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr "Het pakket is geinstalleerd, maar het lpk-bestand niet gevonden. Alle componenten hieruit zijn gedeactiveed. Herstel dit alstublieft."
|
|
|
|
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
|
|
msgid "This source is only used to compile and install the package."
|
|
msgstr "Deze broncode is alleen gebruikt voor compilatie en installatie."
|
|
|
|
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Dit statement kan niet worden gedistilleerd.%sSelecteer meer code om een nieuwe procedure te distilleren."
|
|
|
|
#: lazarusidestrconsts:listhiswillhappencontinue
|
|
msgid "This will happen:%s%s%sContinue?"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Thread"
|
|
|
|
#: lazarusidestrconsts:listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Titel en bestandsnaam nodig"
|
|
|
|
#: lazarusidestrconsts:dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Titel:"
|
|
|
|
#: lazarusidestrconsts:lismenuviewtodolist
|
|
msgid "ToDo List"
|
|
msgstr "ToDo Lijst"
|
|
|
|
#: lazarusidestrconsts:listodolistoptions
|
|
msgid "ToDo options..."
|
|
msgstr "ToDo opties..."
|
|
|
|
#: lazarusidestrconsts:lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Schakel tussen Form/Unit"
|
|
|
|
#: lazarusidestrconsts:srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Wissel mode"
|
|
|
|
#: lazarusidestrconsts:liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuviewtoggleformunit
|
|
msgid "Toggle form/unit view"
|
|
msgstr "Schakel tussen Form/Unit zicht"
|
|
|
|
#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
|
|
msgid "Toggle view Breakpoints"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcallstack
|
|
msgid "Toggle view Call Stack"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
|
|
msgid "Toggle view Debugger Output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
|
|
msgid "Toggle view Local Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewwatches
|
|
msgid "Toggle view Watches"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
|
|
msgid "Toggle view component palette"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Teken:"
|
|
|
|
#: lazarusidestrconsts:lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Hulpmiddelen"
|
|
|
|
#: lazarusidestrconsts:srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Hulpmiddelen menu commando's"
|
|
|
|
#: lazarusidestrconsts:dlgtooltipeval
|
|
msgid "Tooltip expression evaluation"
|
|
msgstr "Tooltip expressie evaluatie"
|
|
|
|
#: lazarusidestrconsts:dlgtooltiptools
|
|
msgid "Tooltip symbol Tools"
|
|
msgstr "Tooltip symbool Hulpmiddelen"
|
|
|
|
#: lazarusidestrconsts:listop
|
|
msgid "Top"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Top verankering"
|
|
|
|
#: lazarusidestrconsts:listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Top randruimte."
|
|
|
|
#: lazarusidestrconsts:listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Top evenredig verdelen"
|
|
|
|
#: lazarusidestrconsts:dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Top:"
|
|
|
|
#: lazarusidestrconsts:listops
|
|
msgid "Tops"
|
|
msgstr "Tops"
|
|
|
|
#: lazarusidestrconsts:dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Spatie aan het eind verwijderen"
|
|
|
|
#: lazarusidestrconsts:listurbopascal
|
|
msgid "Turbo Pascal"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Leerprogramma"
|
|
|
|
#: lazarusidestrconsts:dlgenvtype
|
|
msgid "Type"
|
|
msgstr "Type"
|
|
|
|
#: lazarusidestrconsts:lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Type:"
|
|
|
|
#: lazarusidestrconsts:liscetypes
|
|
msgid "Types"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "HOOFDLETTERS"
|
|
|
|
#: lazarusidestrconsts:rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "Oekraiens"
|
|
|
|
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Kan binaire stream niet omzetten naar tekst"
|
|
|
|
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Kan component niet naar het klembord kopiëren"
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "Kan %s niet toevoegen aan het project omdat er al een unit met dezelfde naam in het project is."
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr "Kan resource T%s:FORMDATA niet toevoegen aan resource bestand %s%s%s%s.%sWaarschijnlijk een syntax fout."
|
|
|
|
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
|
|
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
|
|
msgstr "Kan het resourceheader commentaar niet toeogen aan resource bestand %s%s%s%s.%sWaarschijnlijk een syntax fout."
|
|
|
|
#: lazarusidestrconsts:lisunabletobackupfileto
|
|
msgid "Unable to backup file %s%s%s to %s%s%s!"
|
|
msgstr "Kan het bestand %s%s%s niet backup-en naar %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Kan de \"Auto createlijst\" niet wijzigen in de broncode.%sLos eerst de fouten op."
|
|
|
|
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
|
|
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
|
|
msgstr "Kan %s%s%s niet opschonen.%sControleer de rechten."
|
|
|
|
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Kan doel directory niet opschonen"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Kan de component tekst niet omzetten in binair formaat:%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertfileerror
|
|
msgid "Unable to convert file %s%s%s%sError: %s"
|
|
msgstr "Kan het bestand %s%s%s niet convertere%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
|
|
msgid "Unable to convert lfm to lrs and write lrs file."
|
|
msgstr "Kan het lfm bestand niet converteren en het lrs bestand opslaan."
|
|
|
|
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
|
|
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
|
|
msgstr "Kan de tekst form data van bestand %s%s%s%s%sniet wijzigen in een binaire stream. (%s)."
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Kan het bestand niet kopiëren"
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfileto
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s"
|
|
msgstr "Kan het bestand %s%s%s%s niet kopiëren naar %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocopyfileto2
|
|
msgid "Unable to copy file %s%s%s%sto %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s%s niet kopiëren naar %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test pascal file \"%s\"."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
|
|
msgid "Unable to create backup directory %s%s%s."
|
|
msgstr "Kan geen backup directory maken."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Kan de directory niet maken"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatedirectory2
|
|
msgid "Unable to create directory %s%s%s"
|
|
msgstr "Kan de directory %s%s%s niet maken"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatedirectory
|
|
msgid "Unable to create directory %s%s%s."
|
|
msgstr "Kan de directory %s%s%s niet maken."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Kan het bestand niet maken"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile2
|
|
msgid "Unable to create file %s%s%s"
|
|
msgstr "Kan het bestand %s%s%s niet maken"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefilename
|
|
msgid "Unable to create file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet maken."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatefile3
|
|
msgid "Unable to create file%s%s%s%s"
|
|
msgstr "Kan het bestand %s%s%s niet maken%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
|
|
msgid "Unable to create link %s%s%s with target %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
|
|
msgid "Unable to create new method. Please fix the error shown in the message window."
|
|
msgstr "Kan de nieuwe methode niet maken. Herstel de in het boodschappen scherm getoonde fout."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
|
|
msgid "Unable to create output directory %s%s%s%sfor package %s."
|
|
msgstr "Kan de uitvoerdirectory %s%s%s%svoor package %s niet maken."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
msgid "Unable to create package source directory %s%s%s%sfor package %s."
|
|
msgstr "Kan geen package broncode directory %s%s%s%svoor package %s."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
|
|
msgstr "Kan doel directorie for lazarus:%s%s%s%s niet maken.%sDeze directorie is nodig voor de nieuwe lazarus IDE met je packages."
|
|
|
|
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Lan geen tijdelijk lfm buffer maken."
|
|
|
|
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
|
|
msgid "Unable to delete ambiguous file %s%s%s"
|
|
msgstr "Kan het dubbele bestand %s%s%s niet verwijderen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Kan het bestand niet verwijderen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeletefile
|
|
msgid "Unable to delete file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet verwijderen."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
|
|
msgid "Unable to delete old state file %s%s%s%sfor package %s."
|
|
msgstr "Kan het oude status bestand %s%s%s%svoor package %s niet verwijderen."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "Kan %s niet vinden in LFM stream."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr "Kan geen resource string sectie vinden in deze of een \"uses\" unit."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
|
|
msgid "Unable to find a valid classname in %s%s%s"
|
|
msgstr "Kan geen geldige klassenaam vinden in %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletofindfile
|
|
msgid "Unable to find file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet vinden."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to find method. Please fix the error shown in the message window."
|
|
msgstr "Kan de methode niet vinden. Herstel de fout getoond in het mededelingen scherm."
|
|
|
|
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
|
|
msgid "Unable to find the unit of component class %s%s%s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Kan de bewerker-wijzigingen niet verzamelen."
|
|
|
|
#: lazarusidestrconsts:lisccounabletogetfiledate
|
|
msgid "Unable to get file date of %s."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Kan de broncode niet vinden voor de \"designer\"."
|
|
|
|
#: lazarusidestrconsts:lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Kan het bestand niet laden"
|
|
|
|
#: lazarusidestrconsts:lisdebugunabletoloadfile2
|
|
msgid "Unable to load file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet laden."
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
|
|
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
|
|
msgstr "Kan het oude resource bestand niet laden.%sHet resource bestand is de eerste include file in de%sinitialization sectie.%sBijvoorbeeld {$I %s.lrs}.%sWaarschijnlijk een syntax fout."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr "Kan het package niet laden"
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadpackage
|
|
msgid "Unable to load package %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
msgid "Unable to load the component class %s%s%s, because it depends on itself."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
|
|
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
|
|
msgstr "Kan het package %s%s%s niet openen.%sDit package moet geinstalleerd worden."
|
|
|
|
#: lazarusidestrconsts:lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Kan het bestand niet lezen"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfile2
|
|
msgid "Unable to read file %s%s%s!"
|
|
msgstr "Kan het bestand %s%s%s niet lezen"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfileerror
|
|
msgid "Unable to read file %s%s%s%sError: %s"
|
|
msgstr "Kan het bestand %s%s%s niet lezen%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoreadfilename
|
|
msgid "Unable to read file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet lezen."
|
|
|
|
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
|
|
msgid "Unable to read package file %s%s%s.%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Kan het status bestand %s van project %s%s niet lezen. Fout: %s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
|
|
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr "Kan het status bestand %s%s%s%svan package %s niet vinden.%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
|
|
msgid "Unable to remove old backup file %s%s%s!"
|
|
msgstr "Kan het oude backup bestand %s%s%s niet verwijderen!"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
|
|
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
|
|
msgstr "Kan het dubbele bestand %s%s%s%sniet hernoemen in %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Kan het bestand niet hernoemen"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefileto
|
|
msgid "Unable to rename file %s%s%s to %s%s%s!"
|
|
msgstr "Kan het bestand %s%s%s niet hernoemen naar %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamefileto2
|
|
msgid "Unable to rename file %s%s%s%sto %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s%sniet hernoemen in %s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Kan het form niet in de broncode hernoemen."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Kan de methode niet hernoemen. Herstel de fout in het mededelingen scherm."
|
|
|
|
#: lazarusidestrconsts:lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Kan de variabele niet hernoemen in de broncode."
|
|
|
|
#: lazarusidestrconsts:lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisexttoolunabletorunthetool
|
|
msgid "Unable to run the tool %s%s%s:%s%s"
|
|
msgstr "Kan het hulpmiddel %s%s%s:%s%s niet uitvoeren"
|
|
|
|
#: lazarusidestrconsts:lisunabletosavefile
|
|
msgid "Unable to save file %s%s%s"
|
|
msgstr "Kan het bestand %s%s%s niet opslaan"
|
|
|
|
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
|
|
msgid "Unable to show method. Please fix the error shown in the message window."
|
|
msgstr "Kan de methode niet tonen. Herstel de fout in het mededelingen scherm."
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "Kan %s:T%s niet in stream opslaan."
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Kan geselecteerde componenten niet in stream opslaan"
|
|
|
|
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Kan geselecteerde componenten niet in stream opslaan."
|
|
|
|
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "Kan de binaire stream met componenten van %s:T%s niet omzetten in tekst."
|
|
|
|
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "Kan het CreateForm statement niet wijzigen in de project broncode"
|
|
|
|
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
|
|
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletowrite2
|
|
msgid "Unable to write %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunabletowrite
|
|
msgid "Unable to write %s%s%s%s%s."
|
|
msgstr "Kan niet schrijven naar %s%s%s%s%s."
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Kan het bestand niet schrijven"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefile2
|
|
msgid "Unable to write file %s%s%s"
|
|
msgstr "Kan het bestand %s%s%s niet schrijven"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefileerror
|
|
msgid "Unable to write file %s%s%s%sError: %s"
|
|
msgstr "Kan het bestand %s%s%s niet schrijven%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritefilename
|
|
msgid "Unable to write file %s%s%s."
|
|
msgstr "Kan het bestand %s%s%s niet schrijven."
|
|
|
|
#: lazarusidestrconsts:lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
|
|
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
|
|
msgstr "Kan het package %s%s%s%sniet schrijven in bestand %s%s%S.%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
|
|
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
|
|
msgstr "Kan het status bestand %s%s%s%s van package %s niet schrijven.%sFout: %s"
|
|
|
|
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Kan het status bestand van project %s%s niet schrijven. Four %s"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritetofile2
|
|
msgid "Unable to write to file %s%s%s"
|
|
msgstr "Kan het bestand %s%s%s niet schrijven"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritetofile
|
|
msgid "Unable to write to file %s%s%s!"
|
|
msgstr "Kan het bestand %s%s%s niet schrijven!"
|
|
|
|
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlguncertopt
|
|
msgid "Uncertain Optimizations"
|
|
msgstr "Onzekere optimalisaties"
|
|
|
|
#: lazarusidestrconsts:lismenuuncommentselection
|
|
msgid "Uncomment selection"
|
|
msgstr "Commentaar Selectie ongedaan maken"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Ondefinieer"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Ondefinieer alles"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Ondefinieer recursie"
|
|
|
|
#: lazarusidestrconsts:dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Onderstreep"
|
|
|
|
#: lazarusidestrconsts:lismenuundo
|
|
msgid "Undo"
|
|
msgstr "Ongedaan maken"
|
|
|
|
#: lazarusidestrconsts:dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Ongedaan maken na Opslaan"
|
|
|
|
#: lazarusidestrconsts:dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Limiet ongedaan maken"
|
|
|
|
#: lazarusidestrconsts:srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Unindent Blok"
|
|
|
|
#: lazarusidestrconsts:lismenuunindentselection
|
|
msgid "Unindent selection"
|
|
msgstr "Selectie Inspringen ongedaan maken"
|
|
|
|
#: lazarusidestrconsts:lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "De-installeer"
|
|
|
|
#: lazarusidestrconsts:lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start"
|
|
msgstr "De-installeer bij volgende start"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Package %s de-installeren?"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Package de-installeren"
|
|
|
|
#: lazarusidestrconsts:lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "De-installeer Selectie"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypeunit
|
|
msgid "Unit"
|
|
msgstr "Unit"
|
|
|
|
#: lazarusidestrconsts:lisunithaschangedsave
|
|
msgid "Unit %s%s%s has changed. Save?"
|
|
msgstr "Unit %s%s%s is gewijzigd. Opslaan?"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
|
|
msgid "Unit %s%s%s was removed from package"
|
|
msgstr "Unit %s%s%s is uit het package verwijderd"
|
|
|
|
#: lazarusidestrconsts:lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Unit bestand naam:"
|
|
|
|
#: lazarusidestrconsts:uemshowunitinfo
|
|
msgid "Unit Info"
|
|
msgstr "Unit informatie"
|
|
|
|
#: lazarusidestrconsts:lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Unitnaam ongeldig"
|
|
|
|
#: lazarusidestrconsts:lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Unitnaam:"
|
|
|
|
#: lazarusidestrconsts:lisaf2punitname
|
|
msgid "Unit Name: "
|
|
msgstr "Unitnaam: "
|
|
|
|
#: lazarusidestrconsts:lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Unit uitvoer directorie"
|
|
|
|
#: lazarusidestrconsts:lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Unitpad"
|
|
|
|
#: lazarusidestrconsts:dlgcounitstyle
|
|
msgid "Unit Style:"
|
|
msgstr "Unitstijl:"
|
|
|
|
#: lazarusidestrconsts:dlgunitdepcaption
|
|
msgid "Unit dependencies"
|
|
msgstr "Unit afhankelijkheden"
|
|
|
|
#: lazarusidestrconsts:lisa2punitfilename
|
|
msgid "Unit file name:"
|
|
msgstr "Unit bestandsnaam:"
|
|
|
|
#: lazarusidestrconsts:lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Unit identifier bestaat al"
|
|
|
|
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Unitnaam bestaat al"
|
|
|
|
#: lazarusidestrconsts:lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Unit naam begint met ..."
|
|
|
|
#: lazarusidestrconsts:lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Unit naam bevat ..."
|
|
|
|
#: lazarusidestrconsts:lisunitnotfound
|
|
msgid "Unit not found"
|
|
msgstr "Unit niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lispkgsysunitnotfound
|
|
msgid "Unit not found: %s%s%s"
|
|
msgstr "Unit niet gevonden: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Unit paden"
|
|
|
|
#: lazarusidestrconsts:lisunitlfmfile
|
|
msgid "Unit: %s%sLFM file: %s"
|
|
msgstr "Unit: %s%sLFM bestand: %s"
|
|
|
|
#: lazarusidestrconsts:lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Unitnaam bestaat al"
|
|
|
|
#: lazarusidestrconsts:lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Unitname existiert bereits im Projekt"
|
|
|
|
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Unitnaam:"
|
|
|
|
#: lazarusidestrconsts:lisunitsnotfound2
|
|
msgid "Units not found"
|
|
msgstr "Units niet gevonden"
|
|
|
|
#: lazarusidestrconsts:lismenuviewunits
|
|
msgid "Units..."
|
|
msgstr "Units..."
|
|
|
|
#: lazarusidestrconsts:lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Niet opgeslagen package"
|
|
|
|
#: lazarusidestrconsts:dlgupword
|
|
msgid "Up"
|
|
msgstr "Naar boven"
|
|
|
|
#: lazarusidestrconsts:lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Update"
|
|
|
|
#: lazarusidestrconsts:lispckoptsupdaterebuild
|
|
msgid "Update/Rebuild"
|
|
msgstr "Update/Herbouwen"
|
|
|
|
#: lazarusidestrconsts:lismenuuppercaseselection
|
|
msgid "Uppercase selection"
|
|
msgstr "Wijzig selectie in hoofdletters"
|
|
|
|
#: lazarusidestrconsts:lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Gebruik"
|
|
|
|
#: lazarusidestrconsts:dlgcoansistr
|
|
msgid "Use Ansi Strings"
|
|
msgstr "Gebruik ANSI strings"
|
|
|
|
#: lazarusidestrconsts:dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging (darwin only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisuseexcludefilter
|
|
msgid "Use Exclude Filter"
|
|
msgstr "Gebruik \"uitsluit\" filter"
|
|
|
|
#: lazarusidestrconsts:dlgcoheaptrc
|
|
msgid "Use Heaptrc Unit"
|
|
msgstr "Gebruik Heaptrc unit"
|
|
|
|
#: lazarusidestrconsts:lisuseincludefilter
|
|
msgid "Use Include Filter"
|
|
msgstr "Gebruik \"bevat\" filter"
|
|
|
|
#: lazarusidestrconsts:dlgusecustomconfig
|
|
msgid "Use addional Compiler Config File"
|
|
msgstr "Gebruik additioneel compiler configuratie bestand"
|
|
|
|
#: lazarusidestrconsts:dlgedusedefcolor
|
|
msgid "Use default color"
|
|
msgstr "Gebruik standaard kleur"
|
|
|
|
#: lazarusidestrconsts:dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Gebruik display"
|
|
|
|
#: lazarusidestrconsts:dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Gebruik start programma"
|
|
|
|
#: lazarusidestrconsts:dlgpousemanifest
|
|
msgid "Use manifest file to enable themes (windows only)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgusefpccfg
|
|
msgid "Use standard Compiler Config File (fpc.cfg)"
|
|
msgstr "Gebruik standaard compiler configuratie bestand (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts:dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Gebruik syntax highlighting"
|
|
|
|
#: lazarusidestrconsts:lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Gebruik unit"
|
|
|
|
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
|
|
msgid "Use windowmanager setting"
|
|
msgstr "Gebruik windowmanager instellingen"
|
|
|
|
#: lazarusidestrconsts:lisplduser
|
|
msgid "User"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecuserfirst
|
|
msgid "User First"
|
|
msgstr "Gebruiker eerst"
|
|
|
|
#: lazarusidestrconsts:dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Door gebruiker gedefinieerde extensie"
|
|
|
|
#: lazarusidestrconsts:dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Door gebruiker gedefinieerde extensie (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts:dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Gebruiker voorkeuren"
|
|
|
|
#: lazarusidestrconsts:lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisceuses
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgvaluecolor
|
|
msgid "Value"
|
|
msgstr "Waarde"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr "Waarde als bestandpad"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Waarde als tekst"
|
|
|
|
#: lazarusidestrconsts:dlgrunovariable
|
|
msgid "Variable"
|
|
msgstr "Variabele"
|
|
|
|
#: lazarusidestrconsts:lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Variabelenaam"
|
|
|
|
#: lazarusidestrconsts:dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Variabele prefix"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Variabele:"
|
|
|
|
#: lazarusidestrconsts:lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Variabele: %s"
|
|
|
|
#: lazarusidestrconsts:liscevariables
|
|
msgid "Variables"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Aantal melding tijdens compilatie:"
|
|
|
|
#: lazarusidestrconsts:lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisversion
|
|
msgid "Version"
|
|
msgstr "Versie"
|
|
|
|
#: lazarusidestrconsts:versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Verie informatie"
|
|
|
|
#: lazarusidestrconsts:rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsversion
|
|
msgid "Version:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Verticaal"
|
|
|
|
#: lazarusidestrconsts:dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Vertikale stapgrootte van raster"
|
|
|
|
#: lazarusidestrconsts:lismenuviewanchoreditor
|
|
msgid "View Anchor Editor"
|
|
msgstr "Toon Anker Bewerker"
|
|
|
|
#: lazarusidestrconsts:uemviewcallstack
|
|
msgid "View Call Stack"
|
|
msgstr "Toon Call Stack"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Toon Code Verkenner"
|
|
|
|
#: lazarusidestrconsts:lismenuviewcomponentpalette
|
|
msgid "View Component Palette"
|
|
msgstr "Toon component palette"
|
|
|
|
#: lazarusidestrconsts:srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Toon Forms"
|
|
|
|
#: lazarusidestrconsts:lismenuviewidespeedbuttons
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Toon IDE speed buttons"
|
|
|
|
#: lazarusidestrconsts:lismenuviewjumphistory
|
|
msgid "View Jump-History ..."
|
|
msgstr "Toon Springpunt geschiedenis ..."
|
|
|
|
#: lazarusidestrconsts:srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Toon Object Inspecteur"
|
|
|
|
#: lazarusidestrconsts:lispckeditviewpackgesource
|
|
msgid "View Package Source"
|
|
msgstr "Toon Pakket Bron"
|
|
|
|
#: lazarusidestrconsts:lisviewprojectunits
|
|
msgid "View Project Units"
|
|
msgstr "Toon Project Units"
|
|
|
|
#: lazarusidestrconsts:srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Toon zoek resultaten"
|
|
|
|
#: lazarusidestrconsts:lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Toon bron (.lfm)"
|
|
|
|
#: lazarusidestrconsts:srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Toon Broncode Bewerker"
|
|
|
|
#: lazarusidestrconsts:lispeviewtodolist
|
|
msgid "View ToDo list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuviewunitdependencies
|
|
msgid "View Unit Dependencies"
|
|
msgstr "Toon Unit Afhankelijkheden"
|
|
|
|
#: lazarusidestrconsts:liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuviewunitinfo
|
|
msgid "View Unit Information"
|
|
msgstr "Toon Unit informatie"
|
|
|
|
#: lazarusidestrconsts:lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Toon Units"
|
|
|
|
#: lazarusidestrconsts:srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Toon anker bewerker"
|
|
|
|
#: lazarusidestrconsts:srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Toon Breekpunten"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Toon Call Stack"
|
|
|
|
#: lazarusidestrconsts:srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Toon component palette"
|
|
|
|
#: lazarusidestrconsts:srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Toon Debugger output "
|
|
|
|
#: lazarusidestrconsts:srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Toon Forms"
|
|
|
|
#: lazarusidestrconsts:liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Toon lokale variabelen"
|
|
|
|
#: lazarusidestrconsts:srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Toon Menu commando's"
|
|
|
|
#: lazarusidestrconsts:srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Toon Berichten"
|
|
|
|
#: lazarusidestrconsts:dlgmainviewforms
|
|
msgid "View project forms"
|
|
msgstr "Toon Project Forms"
|
|
|
|
#: lazarusidestrconsts:dlgmainviewframes
|
|
msgid "View project frames"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liskmviewprojectsource
|
|
msgid "View project source"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgmainviewunits
|
|
msgid "View project units"
|
|
msgstr "Toon Project Units"
|
|
|
|
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecviewtodolist
|
|
msgid "View todo list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Toon Unit Afhankelijkheden"
|
|
|
|
#: lazarusidestrconsts:srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Toon Unit informatie"
|
|
|
|
#: lazarusidestrconsts:srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Toon Units"
|
|
|
|
#: lazarusidestrconsts:srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Toon Watches"
|
|
|
|
#: lazarusidestrconsts:lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Viewers"
|
|
|
|
#: lazarusidestrconsts:lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Virtuele Unit"
|
|
|
|
#: lazarusidestrconsts:lisaf2pisvirtualunit
|
|
msgid "Virtual unit (source is not in package)"
|
|
msgstr "Virtuele unit (broncode is geen onderdeel van package"
|
|
|
|
#: lazarusidestrconsts:dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Zichtbare goot"
|
|
|
|
#: lazarusidestrconsts:dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Zichtbare rechter marge"
|
|
|
|
#: lazarusidestrconsts:lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Waarschuw voor compilatie"
|
|
|
|
#: lazarusidestrconsts:lisccowarningcaption
|
|
msgid "Warning"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Waarschuwing: Het extra compiler configuratie bestand heeft dezelfde naam als een van de standaard configuratie bestanden waar de FreePascal compiler naar zoekt. Dit kan leiden tot het alleen verwerken van het extra configuratie bestand en het overslaan van de standaard configuraite."
|
|
|
|
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
|
|
msgid "Warning: The file %s%s%s%sbelongs to the current project."
|
|
msgstr "Waarschuwing: Het bestand %s%s%s%sbehoort tot het huidige project."
|
|
|
|
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
|
|
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
|
|
msgstr "Waarschuwing: dubbel bestand gevonden: %s%s%s. Broncode bestand is: %s%s%s"
|
|
|
|
#: lazarusidestrconsts:lisinfobuildwarning
|
|
msgid "Warnings:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswlwatchlist
|
|
msgid "Watch list"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Watches"
|
|
|
|
#: lazarusidestrconsts:dlgautocreatenewforms
|
|
msgid "When creating new forms, add them to auto-created forms"
|
|
msgstr "Nieuwe forms toevoegen aan de \"auto-created forms\""
|
|
|
|
#: lazarusidestrconsts:lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Bij het wisselen van bestand in de bewerker"
|
|
|
|
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Waar"
|
|
|
|
#: lazarusidestrconsts:dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Breedte:"
|
|
|
|
#: lazarusidestrconsts:dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgwindow
|
|
msgid "Window"
|
|
msgstr "Venster"
|
|
|
|
#: lazarusidestrconsts:dlgwinpos
|
|
msgid "Window Positions"
|
|
msgstr "Venster Posities"
|
|
|
|
#: lazarusidestrconsts:lislazbuildwithstaticpackages
|
|
msgid "With packages"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Met benodigde paketten"
|
|
|
|
#: lazarusidestrconsts:liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Woord bij de huidige bewerker positie"
|
|
|
|
#: lazarusidestrconsts:srkmecwordcompletion
|
|
msgid "Word completion"
|
|
msgstr "Woord completering"
|
|
|
|
#: lazarusidestrconsts:dlgwordspolicies
|
|
msgid "Words"
|
|
msgstr "Woorden"
|
|
|
|
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
|
|
msgid "Working Directory (Leave empty for file path)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Werkdirectory:"
|
|
|
|
#: lazarusidestrconsts:dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Werkdirectory"
|
|
|
|
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (Leave empty for file path)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Schrijffout"
|
|
|
|
#: lazarusidestrconsts:dlgwritefpclogo
|
|
msgid "Write an FPC logo"
|
|
msgstr "Maak een FPC logo"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Schrijffout"
|
|
|
|
#: lazarusidestrconsts:liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "Schrijf voorvoegsel"
|
|
|
|
#: lazarusidestrconsts:lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisxmlfiles
|
|
msgid "XML files"
|
|
msgstr "XML bestanden"
|
|
|
|
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You can not build lazarus while debugging or compiling."
|
|
msgstr "Je kunt lazarus niet bouwen tijdens het debuggen of compileren."
|
|
|
|
#: lazarusidestrconsts:dlgdoesnotexist
|
|
msgid "\" does not exist."
|
|
msgstr "\" niet gevonden."
|
|
|
|
#: lazarusidestrconsts:uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" is niet beschrijfbaar."
|
|
|
|
#: lazarusidestrconsts:lisexttooltitlecompleted
|
|
msgid "\"%s\" completed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "Bouw afbreken"
|
|
|
|
#: lazarusidestrconsts:srkmecaddbreakpoint
|
|
msgid "add break point"
|
|
msgstr "Break punt toevoegen"
|
|
|
|
#: lazarusidestrconsts:srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "Watch toevoegen"
|
|
|
|
#: lazarusidestrconsts:lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "Automatisch installeren dynamisch"
|
|
|
|
#: lazarusidestrconsts:lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "Automatisch installeren statisch"
|
|
|
|
#: lazarusidestrconsts:lisbegins
|
|
msgid "begins"
|
|
msgstr "begint met"
|
|
|
|
#: lazarusidestrconsts:srkmecbuildall
|
|
msgid "build all files of program/project"
|
|
msgstr "Alle bestanden van een programma/project bouwen"
|
|
|
|
#: lazarusidestrconsts:srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "Bouw bestand"
|
|
|
|
#: lazarusidestrconsts:srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "Bouw programma/project"
|
|
|
|
#: lazarusidestrconsts:dlglefttopclr
|
|
msgid "color for left, top"
|
|
msgstr "Kleur voor links, boven"
|
|
|
|
#: lazarusidestrconsts:dlgrightbottomclr
|
|
msgid "color for right, bottom"
|
|
msgstr "Kleur voor rechts, onder"
|
|
|
|
#: lazarusidestrconsts:lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmeccompileroptions
|
|
msgid "compiler options"
|
|
msgstr "compileropties"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
|
|
msgid "compiler path"
|
|
msgstr "Pad naar compiler"
|
|
|
|
#: lazarusidestrconsts:srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "Configureer bouwbestand"
|
|
|
|
#: lazarusidestrconsts:liscontains
|
|
msgid "contains"
|
|
msgstr "bevat"
|
|
|
|
#: lazarusidestrconsts:lisccocontains
|
|
msgid "contains "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "aanpasbare opties"
|
|
|
|
#: lazarusidestrconsts:liscodefault
|
|
msgid "default (%s)"
|
|
msgstr "standaard (%s)"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
|
|
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "bereken/wijzig"
|
|
|
|
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr "bestand, waar de debug uitvoer naar geschreven wordt. Als dit niet wordt gegeven, wordt de uitvoer naar de console geschreven."
|
|
|
|
#: lazarusidestrconsts:lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
|
|
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisuidinproject
|
|
msgid "in Project:"
|
|
msgstr "in Project:"
|
|
|
|
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "in alle geopende packages en projecten"
|
|
|
|
#: lazarusidestrconsts:lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "in huidige unit"
|
|
|
|
#: lazarusidestrconsts:lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "in hoofd project"
|
|
|
|
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "in het project/package waar de huidige unit toebehoort"
|
|
|
|
#: lazarusidestrconsts:lisincludepath
|
|
msgid "include path"
|
|
msgstr "pad gebruiken"
|
|
|
|
#: lazarusidestrconsts:srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "inspecteer"
|
|
|
|
#: lazarusidestrconsts:lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "dynamisch geinstalleerd"
|
|
|
|
#: lazarusidestrconsts:lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "statisch geinstalleerd"
|
|
|
|
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr "ongeldige compiler bestandsnaam"
|
|
|
|
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [opties] <project-bestandsnaam>"
|
|
|
|
#: lazarusidestrconsts:lislibrarypath
|
|
msgid "library path"
|
|
msgstr "Bibliotheek pad"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "Linker opties"
|
|
|
|
#: lazarusidestrconsts:dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "Kleine letters"
|
|
|
|
#: lazarusidestrconsts:lisprojectmacrounitpath
|
|
msgid "macro ProjectUnitPath"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisoipmissing
|
|
msgid "missing"
|
|
msgstr "niet aanwwezig"
|
|
|
|
#: lazarusidestrconsts:lisoipmodified
|
|
msgid "modified"
|
|
msgstr "gewijzigd"
|
|
|
|
#: lazarusidestrconsts:lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnew
|
|
msgid "new"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisuidno
|
|
msgid "no"
|
|
msgstr "nee"
|
|
|
|
#: lazarusidestrconsts:dlgnoautomaticrenaming
|
|
msgid "no automatic renaming"
|
|
msgstr "niet automatisch hernoemen"
|
|
|
|
#: lazarusidestrconsts:lisccdnoclass
|
|
msgid "no class"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisnoname
|
|
msgid "noname"
|
|
msgstr "geen naam"
|
|
|
|
#: lazarusidestrconsts:lisnone2
|
|
msgid "none"
|
|
msgstr "geen"
|
|
|
|
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "geen geselecteerd"
|
|
|
|
#: lazarusidestrconsts:lisobjectpath
|
|
msgid "object path"
|
|
msgstr "obectpad"
|
|
|
|
#: lazarusidestrconsts:lisold
|
|
msgid "old"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisor
|
|
msgid "or"
|
|
msgstr "of"
|
|
|
|
#: lazarusidestrconsts:lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "package %s niet opgeslagen"
|
|
|
|
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "package hoofd broncode"
|
|
|
|
#: lazarusidestrconsts:srkmecpause
|
|
msgid "pause program"
|
|
msgstr "pauzeer programma"
|
|
|
|
#: lazarusidestrconsts:lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "selecteer een macro"
|
|
|
|
#: lazarusidestrconsts:lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr "eerste configuratie directory, waar Lazarus de configuratie bestanden opslaat. Standaard is "
|
|
|
|
#: lazarusidestrconsts:srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "Snel-compilatie, geen linking"
|
|
|
|
#: lazarusidestrconsts:lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "niet wijzigbaar"
|
|
|
|
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
|
|
msgid "relative unit path found in fpc cfg: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisremove
|
|
msgid "remove"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:srkmecremovebreakpoint
|
|
msgid "remove break point"
|
|
msgstr "verwijder breekpunt"
|
|
|
|
#: lazarusidestrconsts:srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "reset debugger"
|
|
|
|
#: lazarusidestrconsts:srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "voer bestand uit"
|
|
|
|
#: lazarusidestrconsts:srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "uitvoer parameters"
|
|
|
|
#: lazarusidestrconsts:srkmecrun
|
|
msgid "run program"
|
|
msgstr "voer programma uit"
|
|
|
|
#: lazarusidestrconsts:lissaveallmodified
|
|
msgid "save all modified files"
|
|
msgstr "alle gewijzigde bestanden opslaan"
|
|
|
|
#: lazarusidestrconsts:lissavecurrenteditorfile
|
|
msgid "save current editor file"
|
|
msgstr "huidige bestanden in de bewerker opslaan"
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:dlgtimesecondunit
|
|
msgid "sec"
|
|
msgstr "sec"
|
|
|
|
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr "tweede configuratie directory, waar Lazarus zoekt voor configuratie template bestanden. Standaard is "
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "zet FPC DELPHI-mode aan"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "zet FPC GPC-mode aan"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "zet FPC TP-mode aan"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "zet IO-controles aan"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "zet OVERFLOW controles aan"
|
|
|
|
#: lazarusidestrconsts:lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "zet RANGE controles aam"
|
|
|
|
#: lazarusidestrconsts:lissmallerratherthanfaster
|
|
msgid "smaller rather than faster"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccospaces
|
|
msgid "spaces"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr " configuratiebestand statische packages"
|
|
|
|
#: lazarusidestrconsts:srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "Stop programma"
|
|
|
|
#: lazarusidestrconsts:listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "Dit Help bericht"
|
|
|
|
#: lazarusidestrconsts:lisunitpath
|
|
msgid "unit path"
|
|
msgstr "Unitpad"
|
|
|
|
#: lazarusidestrconsts:srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "Onbekend bewerker-commando"
|
|
|
|
#: lazarusidestrconsts:lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "gebruik HeapTrc-unit"
|
|
|
|
#: lazarusidestrconsts:lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "gebruik LineInfo-unit"
|
|
|
|
#: lazarusidestrconsts:lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts:lisuidyes
|
|
msgid "yes"
|
|
msgstr "Ja"
|
|
|