lazarus/languages/lazaruside.pliso.po
2008-09-05 18:31:30 +00:00

11316 lines
302 KiB
Plaintext

msgid ""
msgstr ""
"Last-Translator: Dominik Zablotny <dominz@wp.pl>\n"
"PO-Revision-Date: 2004-02-06 09:01+0100\n"
"Project-Id-Version: lazaruside\n"
"Language-Team: polski <pl@li.org>\n"
"Content-Type: text/plain; charset=ISO_8859-2\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: KBabel 1.3\n"
"Plural-Forms: nplurals=3; plural=(n==1 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
#: lazarusidestrconsts:srkmcommand1
msgid " command1 \""
msgstr " command1 \""
#: lazarusidestrconsts:srkmcommand2
msgid " command2 \""
msgstr " command2 \""
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Token %s%s%s ju¿ istnieje! "
#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Klawisz \"%s\" jest ju¿ przypisany do \"%s\"."
#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr "jest niezgodny z "
#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (kompilacja ...)"
#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (odpluskwianie ...)"
#: lazarusidestrconsts:liscovarious
msgid "%s (various)"
msgstr ""
#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr "%s - (nowy projekt)"
#: lazarusidestrconsts:lislazarusversionstring
msgid "%s beta"
msgstr ""
#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s bajtów"
#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s katalog"
#: lazarusidestrconsts:lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""
#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s nale¿y ju¿ do projektu."
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "katalog projektu %s"
#: lazarusidestrconsts:lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s jest b³êdn± nazw± projektu.%sProszê wybraæ inn± (np. project1.lpi)"
#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s nie jest prawid³owym identyfikatorem."
#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s nie jest prawid³ow± nazw± modu³u."
#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr ""
#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNazwa pliku: %s%s%s"
#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNazwa modu³u: %s%s%s"
#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Zak³adka: %s"
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, utworzony automatycznie"
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, szczególny dla projektu"
#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/Tylko do odczytu"
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sPakiety s± powi±zane, tzn. jeden z nich jest u¿ywany przez drugi, ablo obydwa s± u¿ywane przez inny pakiet."
#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sOpis: %s"
#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sIstniej±cy plik: %s%s%s"
#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr ""
#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr "%sStan: "
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTen pakiet jest zainstalowany, ale nie znalaz³em jego pliku lpk"
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sTen pakiet zosta³ utworzony automatycznie"
#: lazarusidestrconsts:lisnone
msgid "%snone"
msgstr ""
#: lazarusidestrconsts:liswladd
msgid "&Add"
msgstr ""
#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "&Dodaj pu³apkê"
#: lazarusidestrconsts:lisfrbackwardsearch
msgid "&Backward search"
msgstr ""
#: lazarusidestrconsts:dlgcasesensitive
msgid "&Case Sensitive"
msgstr ""
#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr ""
#: lazarusidestrconsts:lisclose
msgid "&Close"
msgstr ""
#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "&Zamknij zak³adkê"
#: lazarusidestrconsts:lismenuviewcomponents
msgid "&Components"
msgstr "&Komponent"
#: lazarusidestrconsts:liswldelete
msgid "&Delete"
msgstr ""
#: lazarusidestrconsts:lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Edycja"
#: lazarusidestrconsts:lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts:liswlenabled
msgid "&Enabled"
msgstr ""
#: lazarusidestrconsts:dlgentirescope
msgid "&Entire Scope"
msgstr ""
#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Plik"
#: lazarusidestrconsts:lismenufind2
msgid "&Find ..."
msgstr ""
#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Znajd¼ deklaracjê"
#: lazarusidestrconsts:dlgfromcursor
msgid "&From Cursor"
msgstr ""
#: lazarusidestrconsts:dlgglobal
msgid "&Global"
msgstr ""
#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Id¼ do zak³adki"
#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "Pomo&c"
#: lazarusidestrconsts:lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts:lisplistobjects
msgid "&Objects"
msgstr ""
#: lazarusidestrconsts:lisok
msgid "&Ok"
msgstr ""
#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Otwórz plik przy kursorze"
#: lazarusidestrconsts:lismenupackage
msgid "&Package"
msgstr ""
#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "P&rojekt"
#: lazarusidestrconsts:dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr ""
#: lazarusidestrconsts:liswlproperties
msgid "&Properties"
msgstr ""
#: lazarusidestrconsts:dlgregularexpressions
msgid "&Regular Expressions"
msgstr ""
#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr ""
#: lazarusidestrconsts:rsremove
msgid "&Remove"
msgstr ""
#: lazarusidestrconsts:lismenureplace2
msgid "&Replace ..."
msgstr ""
#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "&Zamieñ na"
#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "&Uruchom"
#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr "&Dojd¼ do kursora"
#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "&Szukaj"
#: lazarusidestrconsts:dlgselectedtext
msgid "&Selected Text"
msgstr ""
#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Utwórz zak³adkê"
#: lazarusidestrconsts:lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""
#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "&Znajd¼"
#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "&Narzêdzia"
#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Widok"
#: lazarusidestrconsts:lismenuviewsource
msgid "&View Source"
msgstr ""
#: lazarusidestrconsts:dlgwholewordsonly
msgid "&Whole Words Only"
msgstr ""
#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr ""
#: lazarusidestrconsts:lismenuwindow
msgid "&Window"
msgstr ""
#: lazarusidestrconsts:liscefilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts:lisfilter2
msgid "(filter)"
msgstr ""
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts:dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr ""
#: lazarusidestrconsts:liscodehelpnodocumentation
msgid "(none)"
msgstr ""
#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(nieznane makro: %s)"
#: lazarusidestrconsts:lisplistall
msgid "<All>"
msgstr ""
#: lazarusidestrconsts:liscodehelpnotagcaption
msgid "<NONE>"
msgstr ""
#: lazarusidestrconsts:lisplistnone
msgid "<None>"
msgstr ""
#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<wybierz istniej±cy plik>"
#: lazarusidestrconsts:lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nie wybrano zmiennej>"
#: lazarusidestrconsts:lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts:lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr ""
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Plik %s%s%s ju¿ istnieje.%sChcesz go zast±piæ?"
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Modu³ pascala powinien mieæ rozszerzenie .pp lub .pas"
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Nie znalaz³em wymaganego pakietu. Spójrz na listê pakietów."
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr ""
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Poprawny wois narzêdzia wymaga przynajmniej nazwy i nazwy pliku."
#: lazarusidestrconsts:lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts:lisinfobuildmakeabort
msgid "Abort"
msgstr ""
#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr "Przerwij budowanie"
#: lazarusidestrconsts:lisabortall
msgid "Abort all"
msgstr ""
#: lazarusidestrconsts:lisabortallloading
msgid "Abort all loading"
msgstr ""
#: lazarusidestrconsts:liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts:lisabortloadingproject
msgid "Abort loading project"
msgstr ""
#: lazarusidestrconsts:lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts:lisinfobuildabort
msgid "Aborted..."
msgstr ""
#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "Informacja"
#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr "O lazarusie"
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts:lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts:lissortselsort
msgid "Accept"
msgstr "Zatwierd¼"
#: lazarusidestrconsts:lisacknowledgements
msgid "Acknowledgements"
msgstr ""
#: lazarusidestrconsts:lislazbuildaboaction
msgid "Action"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akcja: %s"
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr ""
#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Dodaj"
#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "Chcesz dodaæ %s do projektu?"
#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Dodaj &czujkê przy kursorze"
#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Dodaj plik"
#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr "Dodaj pliki"
#: lazarusidestrconsts:rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Dodaj pliki LFM, LRS, je¶li istniej±"
#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr "Dodaj modu³"
#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Dodaj aktywny modu³ do pakietu"
#: lazarusidestrconsts:liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr ""
#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr "Dodaj element"
#: lazarusidestrconsts:dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""
#: lazarusidestrconsts:liskmaddbreakpoint
msgid "Add break point"
msgstr ""
#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr ""
#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Dodaj szablon kodu"
#: lazarusidestrconsts:lisadddirectory
msgid "Add directory"
msgstr ""
#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Dodaj plik do projektu"
#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr ""
#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Dodaj plik do pakietu"
#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Dodaj plik do projektu:"
#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr ""
#: lazarusidestrconsts:lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""
#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Dodaj pliki do pakietu"
#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr "Dodaj punkt skoku"
#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Dodaj punkt skoku do historii"
#: lazarusidestrconsts:liscodehelpaddlinkbutton
msgid "Add link"
msgstr ""
#: lazarusidestrconsts:lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "dodaj opcje do zale¿nych pakietów i projektów"
#: lazarusidestrconsts:podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts:liscodehelpaddpathbutton
msgid "Add path"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Dodaj ¶cie¿ki do zale¿nych pakietów/projektów"
#: lazarusidestrconsts:dlgaddsemicolon
msgid "Add semicolon"
msgstr ""
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr ""
#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr "Dodaj do pakietu"
#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr ""
#: lazarusidestrconsts:lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts:liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr ""
#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr "Dodaj..."
#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Dodatkowa ¶cie¿ka poszukiwañ dla wszystkich projektów (.pp;.pas)"
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr ""
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr ""
#: lazarusidestrconsts:rsadditionalinfo
msgid "Additional info"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr ""
#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Wyrównaj górn± liniê do komentarza z przodu"
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr ""
#: lazarusidestrconsts:rslanguageafrikaans
msgid "Afrikaans"
msgstr ""
#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Wyrównaj"
#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr ""
#: lazarusidestrconsts:lisemdall
msgid "All"
msgstr ""
#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr ""
#: lazarusidestrconsts:lisallblockslooksok
msgid "All blocks looks ok."
msgstr ""
#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr "Wszystkie pliki"
#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr "Wszystkie pakiety"
#: lazarusidestrconsts:lisedtdefsallprojects
msgid "All projects"
msgstr ""
#: lazarusidestrconsts:lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts:lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Pozwalaj na instrukcje LABEL i GOTO"
#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""
#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabetycznie"
#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr ""
#: lazarusidestrconsts:lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts:lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts:srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr ""
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr ""
#: lazarusidestrconsts:dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Niejednoznaczy typ przodka"
#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Niejednoznaczna nazwa klasy"
#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Niejednoznaczna nazwa modu³u"
#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""
#: lazarusidestrconsts:lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Przy niejednoznacznej nazwie pliku:"
#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Znalaz³em niejednoznaczny plik"
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Znalaz³em dwuznaczn± nazwê pliku: %s%s%s%sTen plik mo¿e byæ pomylony z %s%s%s%s%sUsun±æ dwuznaczy plik?"
#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Znalaz³em nietypowy plik"
#: lazarusidestrconsts:lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr ""
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Znaleziono nmodu³y o niejednoznacznej nazwie"
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr ""
#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ przodka"
#: lazarusidestrconsts:lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr ""
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr ""
#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr "Dodaj do sekcji"
#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Aplikacja"
#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Ustawienia aplikacji"
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr "Zastosuj"
#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr "Zastosuj zmiany"
#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr ""
#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr "[bez zmian]"
#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Rosn±co"
#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Zapytaj"
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr ""
#: lazarusidestrconsts:dlgcoasmstyle
msgid "Assembler style:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr "Na"
#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Autor:"
#: lazarusidestrconsts:liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""
#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Automatycznie twórz formularz przy otwieraniu jednostki"
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Wêz³y utworzone automatycznie nie mog± byæ zmieniane %si nie mo¿na dodawaæ rêcznie wêz³ów potomnych"
#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Automatycznie usuñ plik"
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Wêz³y utworzone automatycznie nie mog± byæ zmieniane"
#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr ""
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatycznie przebuduj przy Przebuduj wszystkie"
#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr ""
#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Automatyczne zapisywanie"
#: lazarusidestrconsts:lisautoshowobjectinspector
msgid "Auto show Object Inspector"
msgstr ""
#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatycznie twórz:"
#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr "Automatycznie utworzony"
#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatic (or english)"
#: lazarusidestrconsts:lisautomaticfeatures
msgid "Automatic features"
msgstr ""
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Automatycznie zwiêksz numer wersji przy budowaniu"
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatycznie zainstalowane pakiety"
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatycznie przebuduj gdy trzeba"
#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Dostêpne formularze:"
#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr ""
#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr "W ty³"
#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr ""
#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr ""
#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Kopia zapasowa"
#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Nie mo¿na utworzyæ kopii zapasowej pliku"
#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr "Za metodami"
#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr "Binarny"
#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts:dlgblockindent
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Pogrubiony"
#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Zak³adka"
#: lazarusidestrconsts:lisborderspace
msgid "BorderSpace"
msgstr ""
#: lazarusidestrconsts:lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""
#: lazarusidestrconsts:lisbottom
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts:lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr ""
#: lazarusidestrconsts:lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""
#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""
#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr ""
#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr ""
#: lazarusidestrconsts:lisbreak
msgid "Break"
msgstr ""
#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Po³am wiersze w zaznaczeniu"
#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zawiñ wiersz i przenie¶ kursor"
#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zawiñ wiersz i pozostaw kursor"
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Pu³apki"
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr ""
#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Zerwane zale¿no¶ci"
#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Zerwane zale¿no¶æ"
#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Przegl±daj"
#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr ""
#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Buduj"
#: lazarusidestrconsts:lislazbuildqbobuildall
msgid "Build All"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Buduj CodeTools"
#: lazarusidestrconsts:lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr "Zbuduj plik"
#: lazarusidestrconsts:lislazbuildbuildide
msgid "Build IDE"
msgstr "Buduj IDE"
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Buduj JITForm"
#: lazarusidestrconsts:lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""
#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Buduj Lazarusa"
#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildoptions
msgid "Build Options"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Buduj SynEdit"
#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Buduj wszystko"
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildexamples
msgid "Build examples"
msgstr ""
#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr ""
#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr "Utwórz nowy projekt"
#: lazarusidestrconsts:liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts:rsbuild
msgid "Build:"
msgstr ""
#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr "Makra w stylu C (globalne)"
#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operatory w stylu jêzyka C ( +=, -=, *= i /= )"
#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE w stylu C++"
#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "S³owo kluczowe CVS"
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Wywo³aj procedurê %sRegister%s bie¿±cego modu³u"
#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr "Stos wywo³añ"
#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr ""
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr ""
#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Nie mo¿na rejestrowaæ komponentów bez modu³u"
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""
#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Anuluj"
#: lazarusidestrconsts:liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts:liscancelloadingunit
msgid "Cancel loading unit"
msgstr ""
#: lazarusidestrconsts:liscancelrenaming
msgid "Cancel renaming"
msgstr ""
#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""
#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Bez rozró¿niania wielko¶ci liter"
#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "Catalan"
#: lazarusidestrconsts:liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts:listtodolcategory
msgid "Category"
msgstr ""
#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Wy¶rodkuj aktualny wiersz"
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr ""
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr ""
#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr ""
#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr ""
#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Zmieñ"
#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr ""
#: lazarusidestrconsts:lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts:lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts:lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts:lischangefile
msgid "Change file"
msgstr ""
#: lazarusidestrconsts:lischangeparent
msgid "Change parent ..."
msgstr ""
#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Pozycja dziennika zmian"
#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Zmienione pliki:"
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Zmiananazwy pakietu lub wersji ³amioe zale¿no¶ci. Czy zte zale¿no¶ci powinny tak¿e zostaæ zmienione?%sWci¶nij tak aby zmieniæ wszystkie podane zale¿no¶ci.%sWybierz ignoruj aby z³amaæ zale¿no¶ci i kontynuowaæ."
#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr "Znak"
#: lazarusidestrconsts:lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr "Tablica znaków"
#: lazarusidestrconsts:rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Sprawd¼ plik formularz w edytorze"
#: lazarusidestrconsts:lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr ""
#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Sprawd¼ spójno¶æ"
#: lazarusidestrconsts:dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr "Sprawdzaj:"
#: lazarusidestrconsts:rslanguagechinese
msgid "Chinese"
msgstr ""
#: lazarusidestrconsts:lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts:lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr ""
#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""
#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Wybierz katalog ¼róde³ FPC"
#: lazarusidestrconsts:liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Wybierz katalog lazarusa"
#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Wybierz zestaw"
#: lazarusidestrconsts:lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr ""
#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Wybierz inn± nazwê"
#: lazarusidestrconsts:lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Wybierz szablon ¼ród³a (*.dci)"
#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr ""
#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Wybierz nazwê pliku odpluskwiacza"
#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr "Wybierz katalog"
#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr ""
#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Wybierz ¼ród³o programu (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr ""
#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Wybierz katalog testowy"
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Zale¿no¶ci pakietów s± zapêtlone"
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Jest ju¿ klasa o tej nazwie."
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""
#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr ""
#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr "W kolejno¶ci klas"
#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Zasady wstawiania czê¶ci klas"
#: lazarusidestrconsts:liskmclassic
msgid "Classic"
msgstr ""
#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr ""
#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Czy¶æ ¼ród³a Lazarusa (clean)"
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr "Czy¶æ wszystko"
#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory ..."
msgstr "Czy¶æ katalogi ..."
#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Czy¶æ podkatalogi"
#: lazarusidestrconsts:liscleanupunitpath
msgid "Clean up unit path?"
msgstr ""
#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Czy¶æ i buduj"
#: lazarusidestrconsts:lisuidclear
msgid "Clear"
msgstr "Czy¶æ"
#: lazarusidestrconsts:liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr ""
#: lazarusidestrconsts:lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr ""
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kliknij na jeden z powy¿szych elementów aby zobaczyæ diff"
#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Zamknij"
#: lazarusidestrconsts:liskmcloseall
msgid "Close All"
msgstr ""
#: lazarusidestrconsts:lismenucloseproject
msgid "Close Project"
msgstr ""
#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Zamknij wszystkie pliki w edytorze"
#: lazarusidestrconsts:lissrclosepage
msgid "Close page"
msgstr ""
#: lazarusidestrconsts:liskmcloseproject
msgid "Close project"
msgstr ""
#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr "Kod"
#: lazarusidestrconsts:lismenuviewcodebrowser
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr "Tworzenie ¼ród³a"
#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr "Przegl±darka ¼róde³"
#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates ..."
msgstr " ..."
#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr "Narzêdzia ¼róde³"
#: lazarusidestrconsts:liscodebrowser
msgid "Code browser"
msgstr ""
#: lazarusidestrconsts:dlgusecodefolding
msgid "Code folding"
msgstr ""
#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr "Parametry kodu"
#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr "Dokañczenie szablonu kodu"
#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Szablony ¼róde³"
#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr ""
#: lazarusidestrconsts:liscodetools
msgid "CodeTools"
msgstr ""
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Podgl±d dyrektyw CodeTools"
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Warto¶ci katalogu Code Tools"
#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr " ..."
#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeTools"
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Edytor definicji CodeTools ..."
#: lazarusidestrconsts:liskmcodetoolsoptions
msgid "CodeTools options"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr ""
#: lazarusidestrconsts:liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts:liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts:liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Dwukropek"
#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Kolor"
#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme"
msgstr ""
#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Kolory"
#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr "Tryb wyboru kolumn"
#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Kropka"
#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr ""
#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr ""
#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Polecenie po module publikacji"
#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Sterowanie"
#: lazarusidestrconsts:dlgcommandlineparameters
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametry linii poleceñ (bez nazwy pliku)"
#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametry wiersza poleceñ programu"
#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Polecenie:"
#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Oznacz jako komentarz"
#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Komentarz:"
#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr "Kompilacja"
#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Kompiluj"
#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Kompiluj IDE (bez linkowania)"
#: lazarusidestrconsts:lisinfobuildcaption
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Chcesz kompilowaæ wszystko?"
#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompiluj pakiet"
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "dodatek ¦cie¿ka¬ród³owaKompilatora"
#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr ""
#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr "Opcje kompilatora"
#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Opcje kompilatora ..."
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opcje kompilatora dla pakietu %s"
#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Opcje kompilatora dla projektu: %s"
#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr "B³±d kompilatora"
#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr "Nazwa pliku kompilatora"
#: lazarusidestrconsts:liskmcompileroptions
msgid "Compiler options"
msgstr ""
#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr ""
#: lazarusidestrconsts:lisinfobuildcomplile
msgid "Compiling..."
msgstr ""
#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Uzupe³nij kod"
#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr ""
#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr "Uzupe³niaj w³a¶ciwo¶ci"
#: lazarusidestrconsts:liscomponent
msgid "Component"
msgstr ""
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Klasa komponentu %s%s%s ju¿ zosta³a zdefiniowana"
#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Jako nazwy komponentu %s%s%s próbujesz u¿yæ s³owa kluczowego"
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Nazwa komponentu %s%s%s nie jest prawid³owym identyfikatorem"
#: lazarusidestrconsts:lisfpcomponents
msgid "Components"
msgstr ""
#: lazarusidestrconsts:liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts:rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts:liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""
#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr "Pliki konfiguracyjne:"
#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Konfiguruj %sBuduj Lazarusa%s"
#: lazarusidestrconsts:lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr ""
#: lazarusidestrconsts:liskmconfigurehelp
msgid "Configure Help"
msgstr ""
#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help ..."
msgstr " ..."
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr ""
#: lazarusidestrconsts:liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr ""
#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfiguruj dodatkowe komponenty ..."
#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr "Konfiguruj zewnêtrzne narzêdzia"
#: lazarusidestrconsts:liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr ""
#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr " ..."
#: lazarusidestrconsts:lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr ""
#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr ""
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potwierd¼ usuniêcie zale¿no¶ci"
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Potwierd¼ usuniêcie pliku"
#: lazarusidestrconsts:liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr "Konflikt "
#: lazarusidestrconsts:lispeconflictfound
msgid "Conflict found"
msgstr ""
#: lazarusidestrconsts:lisconsoleapplication
msgid "Console application"
msgstr ""
#: lazarusidestrconsts:lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Konstruktor musi nazywaæ siê 'init' (destruktor - 'done')"
#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr "Zawarto¶æ"
#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""
#: lazarusidestrconsts:liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr ""
#: lazarusidestrconsts:liscontinue
msgid "Continue"
msgstr ""
#: lazarusidestrconsts:liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr ""
#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr ""
#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr ""
#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opcje konwersji"
#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr ""
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "Importuj formularz Delphi ..."
#: lazarusidestrconsts:lispwconvertproject
msgid "Convert Delphi Project"
msgstr ""
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr " ..."
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr " ..."
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Importuj modu³ Delphi ..."
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konwertuj"
#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Zamieñ znaki tabulacji na spacje w zaznaczonym tek¶cie"
#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Kopiuj"
#: lazarusidestrconsts:liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr ""
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr ""
#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr ""
#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr "B³±d kopiowania"
#: lazarusidestrconsts:uemcopyfilename
msgid "Copy filename"
msgstr ""
#: lazarusidestrconsts:lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr ""
#: lazarusidestrconsts:lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopiuj wybrane komponenty do schowka"
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr ""
#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Skopiuj zaznaczenie do schowka"
#: lazarusidestrconsts:lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Kopiuj s³owo je¶li nic nie wybrano"
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr ""
#: lazarusidestrconsts:rscopyright
msgid "Copyright:"
msgstr ""
#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Licznik (.pp;1)"
#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr ""
#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr ""
#: lazarusidestrconsts:dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Utwórz 'Defines' dla %s katalogu"
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Utwórz 'Defines' dla projektu %s"
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Utwórz 'Defines' dla Free Pascal Compiler"
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Utwórz 'Defines' dla katalogu Lazarusa"
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Utwórz makra FPC i ¶cie¿ki dla katalogu z projektem fpc"
#: lazarusidestrconsts:lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""
#: lazarusidestrconsts:dlgcocreatemakefile
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Utwórz podmenu"
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr "Utwórz now± aplikacjê cgi. %s Plik jest utrzymywany przez Lazarusa."
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Utwórz nowy plik edytora.%sWybierz typ."
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Utwórz nowy pusty plik tekstowy."
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Utwórz now± aplikacjê graficzn±.%sPlik programu jest utrzymywany przez Lazarusa."
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Utwórz nowy modu³ pascala."
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Utwórz nowy program."
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Utwórz nowy program.%sPlik programu jest utrzymywany przez Lazarusa."
#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Utwórz nowy projekt.%sWybierz typ."
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Utwórz standardowy pakiet.%sPakiet jest zbiorem modu³ów i komponentów."
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Utwórz nowy modu³ z formularzem LCL."
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Utwórz nowy modu³ z modu³em danych."
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame"
msgstr ""
#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Najpierw utwórz projekt!"
#: lazarusidestrconsts:liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts:liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts:liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts:rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr ""
#: lazarusidestrconsts:liscreatenewproject
msgid "Create new project"
msgstr ""
#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Tworzenie"
#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts:liscurrent
msgid "Current"
msgstr ""
#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr "Bie¿±cy projekt"
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Katalog bie¿±cego projektu"
#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Bie¿±ca data i czas"
#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Nazwa u¿ytkownika"
#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kursor poza koñcem linii"
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Kolumna w miejscu kursora"
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Poruszanie kursorem"
#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Wiersz w miejscu kursora"
#: lazarusidestrconsts:dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr "Dodatkowe"
#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr ""
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr ""
#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr "Polecenia u¿ytkownika"
#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identyfikator u¿ytkownika"
#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr ""
#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr "Inna pozycja"
#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr "Narzêdzie u¿ytkownika %d"
#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Wytnij"
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Wytnij wybrane komponenty do schowka"
#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Wytnij zaznaczenie i umie¶æ w schowku"
#: lazarusidestrconsts:liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr ""
#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr ""
#: lazarusidestrconsts:liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Odpluskwanie"
#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr "Wyj¶cie odpluskwiacza"
#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr "Okno odpluskwiacza"
#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Ustawienia odpluskwiacza ..."
#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr "B³±d odpluskwiacza"
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "B³±d odpluskwiacza%sOoops, odpluskwiacz wszed³ w stan b³êdu%sZapisz teraz swoj± pracê !%sWci¶nij zatrzymaj, i miejmy nadziejê ¿e wszystko bêdzie dobrze."
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr ""
#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""
#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr ""
#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr "Rodzaj i ¶cie¿ka do odpluskwiacza"
#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr "Odpluskwianie:"
#: lazarusidestrconsts:lisdecimal
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts:dlgassemblerdefault
msgid "Default"
msgstr "Domy¶lnie"
#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Domy¶lna czcionka edytora"
#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Domy¶lne rozszerzenie pascala"
#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr "\"Define\""
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Rekursywne \"Define\""
#: lazarusidestrconsts:lisctdefdefinetemplates
msgid "Define templates"
msgstr ""
#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Opó¼nienie"
#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr "Usuñ"
#: lazarusidestrconsts:lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Skasuj z szablonu"
#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Skasuj element"
#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Usuñ ostatni znak"
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Chcesz usun±æ stary plik pakietu?"
#: lazarusidestrconsts:lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr ""
#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Chcesz usun±æ niejasny plik?"
#: lazarusidestrconsts:lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Usuñ znak przy kursorze"
#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr "Usuñ bie¿±cy wiersz"
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Chcesz usun±æ zale¿no¶æ od %s?"
#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr "B³±d podczas usuwania"
#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr "Nie mo¿na usun±æ pliku"
#: lazarusidestrconsts:liskmdeletelastchar
msgid "Delete last char"
msgstr ""
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Usuñ element"
#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Chcesz usun±æ poprzedni plik %s%s%s?"
#: lazarusidestrconsts:lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Chcesz usun±æ stary plik pakietu %s%s%s?"
#: lazarusidestrconsts:lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Usuñ zaznaczenie"
#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr "Usuñ szablon "
#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Usuñ do pocz±tku wiersza"
#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Usuñ do koñca wiersza"
#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Usuñ do koñca s³owa"
#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Usuñ do pocz±tku s³owa"
#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr "Usuñ ca³y tekst"
#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Nie mo¿na usun±æ pliku %s%s%s"
#: lazarusidestrconsts:lisdelphi
msgid "Delphi"
msgstr ""
#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Rozszerzenia Delphi 2"
#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Kompatybilno¶æ z Delphi"
#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr ""
#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr "Zale¿no¶æ"
#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "W³a¶ciwo¶ci zale¿no¶ci"
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Zale¿no¶æ ju¿ istnieje"
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Zale¿no¶æ bez w³a¶ciciela: %s"
#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "Malej±co"
#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Opis"
#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Opis"
#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr "Opis:"
#: lazarusidestrconsts:lisoipdescription
msgid "Description: "
msgstr "Opis: "
#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr "Polecenia projektanta"
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Projektowy i uruchomieniowy"
#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Tylko projektowy"
#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Pulpit"
#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Ustawienia pulpitu"
#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Pakiet docelowy"
#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr ""
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Katalog docelowy %s%s%s ijest niew³a¶ciwy.%sWybierz pe³n± ¶cie¿kê."
#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Diff"
#: lazarusidestrconsts:liskmdiffeditorfiles
msgid "Diff editor files"
msgstr ""
#: lazarusidestrconsts:lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Kierunek"
#: lazarusidestrconsts:lisdirectives
msgid "Directives"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Katalog"
#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Katalog nie istnieje"
#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Katalog do budowania testowych projektów"
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Nie znalaz³em katalogu"
#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Opcje katalogów"
#: lazarusidestrconsts:lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts:lisdisablegroup
msgid "Disable Group"
msgstr ""
#: lazarusidestrconsts:lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts:lisdiscardchanges
msgid "Discard changes"
msgstr ""
#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Ekran"
#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Ekran (nie dotyczy win32), np. 198.112.45.11:0, x.org:1, hydra:0.1"
#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Wy¶wietlaj numery linii w zrzucie b³êdu uruchomieniowego:"
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr ""
#: lazarusidestrconsts:dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr ""
#: lazarusidestrconsts:lisdonotclosetheide
msgid "Do not close the IDE"
msgstr ""
#: lazarusidestrconsts:lisdonotclosetheproject
msgid "Do not close the project"
msgstr ""
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr ""
#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""
#: lazarusidestrconsts:lisuedonotsho
msgid "Do not show this message again."
msgstr ""
#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Nie dziel wiersza przed:"
#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Nie dziel wiersza po:"
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Czy naprawdê chcesz anulowaæ wszystkie zmiany do pakietu %s ponownie wczytaæ go z pliku?"
#: lazarusidestrconsts:lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr ""
#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr "Zadokowany"
#: lazarusidestrconsts:lismvdocking
msgid "Docking"
msgstr ""
#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Edytor dokumentacji"
#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr "Domena"
#: lazarusidestrconsts:listodoldone
msgid "Done"
msgstr ""
#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Podwójne klikniêcie zaznacza wiersz"
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Skok przez podwójne klikniêcie na komunikacie (inaczej - przez pojedyncze)"
#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr "W dó³"
#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr ""
#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr ""
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts:rslanguagedutch
msgid "Dutch"
msgstr ""
#: lazarusidestrconsts:liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "¦&rodowisko"
#: lazarusidestrconsts:lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Zmieñ"
#: lazarusidestrconsts:liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr ""
#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Zmieñ ogólne opcje"
#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Zmieñ klawisze"
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Zmieñ opcje aby kompilowaæ pakiet"
#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr "Narzêdzie edycji"
#: lazarusidestrconsts:lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Edytuj szablon kodu"
#: lazarusidestrconsts:lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr ""
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts:liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""
#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts:lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr ""
#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr "Edytuj..."
#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr "Pliki edytora"
#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Czcionka"
#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Wysoko¶æ czcionki"
#: lazarusidestrconsts:liskmeditoroptions
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options ..."
msgstr "Ustawienia edytora ..."
#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "W³a¶ciwo¶ci edytora"
#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr "Element sk³adni"
#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts:lisemdemtpymethods
msgid "Emtpy Methods"
msgstr ""
#: lazarusidestrconsts:lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts:lisenablegroup
msgid "Enable Group"
msgstr ""
#: lazarusidestrconsts:lisenablemacros
msgid "Enable Macros"
msgstr ""
#: lazarusidestrconsts:rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts:lisenabled
msgid "Enabled"
msgstr ""
#: lazarusidestrconsts:lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr ""
#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr ""
#: lazarusidestrconsts:liskmencloseselection
msgid "Enclose selection"
msgstr ""
#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Otocz zaznaczenie ..."
#: lazarusidestrconsts:uemencoding
msgid "Encoding"
msgstr ""
#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""
#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "English"
#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr "Wprowad¼ dane"
#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Wprowad¼ pwarametry uruchomieniowe"
#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr ""
#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "¦rodowisko"
#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Menu ¶rodowisko"
#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options ..."
msgstr "Ustawienia ¶rodowiska ..."
#: lazarusidestrconsts:lisccoerrorcaption
msgid "Error"
msgstr "B³±d"
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "B³±d przy odczycie pakietu"
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "B³±d przy zapisywaniu pakietu"
#: lazarusidestrconsts:lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr "B³±d przy tworzeniu pliku"
#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "B³±d podczas tworzenia lrs"
#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr "B³±d podczas usuwania pliku"
#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr ""
#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "B³±d w wyra¿eniu regularnym"
#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "B³±d przy inicjowaniu programu%s%s%s%s%sB³±d: %s"
#: lazarusidestrconsts:liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts:lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr ""
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr ""
#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr ""
#: lazarusidestrconsts:lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""
#: lazarusidestrconsts:liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "B³±d odczytu %s%s%s%s%s"
#: lazarusidestrconsts:liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "B³±d odczytu pliku"
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "B³±d podczas odczytu pliku: %s"
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "B³±d odczytu pliku informacji o projekcie %s%s%s%s%s"
#: lazarusidestrconsts:liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr "B³±d w trakcie zmiany nazwy pliku"
#: lazarusidestrconsts:liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "B³±d podczas zapisywania %s%s%s%s%s"
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "B³±d podczas zapisywania informacji o projekcie do %s%s%s%s%s"
#: lazarusidestrconsts:lislazbuilderrorwritingfile
msgid "Error writing file"
msgstr "B³±d podczas zapisu do pliku"
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisinfobuilderror
msgid "Error..."
msgstr ""
#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "B³±d: "
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "B³±d: nieprawid³owy kompilator: %s"
#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "B³êdy"
#: lazarusidestrconsts:lisinfobuilderrors
msgid "Errors:"
msgstr ""
#: lazarusidestrconsts:liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts:liseverynthlinenumber
msgid "Every n-th line number:"
msgstr ""
#: lazarusidestrconsts:liscodehelpexampletag
msgid "Example"
msgstr ""
#: lazarusidestrconsts:lisexamples
msgid "Examples"
msgstr ""
#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr ""
#: lazarusidestrconsts:lisexcludefilter2
msgid "Exclude filter"
msgstr ""
#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr "Wykonaj po"
#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr "Wykonaj przed"
#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr ""
#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command before"
msgstr ""
#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr "Wykonanie przerwane"
#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr ""
#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Wykonanie zatrzymane"
#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Wykonanie zatrzymane%s"
#: lazarusidestrconsts:lispldexists
msgid "Exists"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Wyjd¼"
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Wyjd¼ bez zapisywania"
#: lazarusidestrconsts:lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts:lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts:lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Rozszerzona nazwa bie¿±cego pliku w edytorze"
#: lazarusidestrconsts:lisexport
msgid "Export ..."
msgstr ""
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts:lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr ""
#: lazarusidestrconsts:liswlexpression
msgid "Expression"
msgstr ""
#: lazarusidestrconsts:lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts:lisextendunitpath
msgid "Extend unit path?"
msgstr ""
#: lazarusidestrconsts:liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr "Zewnêtrzne narzêdzie %d"
#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External tools"
msgstr ""
#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr "Ustawienia zewnêtrznych narzêdzi"
#: lazarusidestrconsts:dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dod. odstêp miêdzy wierszami"
#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr ""
#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr ""
#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr "Wyodrêbnij procedurê"
#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure ..."
msgstr "Wyodrêbnij procedurê ..."
#: lazarusidestrconsts:lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr ""
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "B³êdny katalog ¼róde³ FPC"
#: lazarusidestrconsts:lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts:lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Katalog ¼róde³ FPC"
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu ze ¼ród³ami FPC \"%s\"."
#: lazarusidestrconsts:lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts:lismenufpdoceditor
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts:lisfpdoceditor
msgid "FPDoc editor"
msgstr ""
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Nie uda³o siê uruchomiæ narzêdzia"
#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr "Szybki"
#: lazarusidestrconsts:lismenutemplatefile
msgid "File"
msgstr "Plik"
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Plik o nazwie %s%s%s ju¿ nale¿y do projektu."
#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Plik %s%s%s zosta³ zmieniony. Chcesz go zapisaæ?"
#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Plik %s%s%s jest wirtualny."
#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Nie znalaz³em pliku %s%s%s."
#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Nie znalaz³em pliku %s%s%s.%s"
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Nie znalaz³em pliku %s%s%s.%sChcesz go utworzyæ?%s"
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Plik %s%s%s%sdoes nie wygl±da na tekstowy.%sChcesz go otworzyæ go pomimo tego?"
#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr "W³a¶ciwo¶ci plku"
#: lazarusidestrconsts:lisfilesettings
msgid "File Settings ..."
msgstr ""
#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr "Typ pliku"
#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Plik ju¿ istnieje"
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Plik ju¿ nale¿y do pakietu"
#: lazarusidestrconsts:lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts:dlgfileexts
msgid "File extensions"
msgstr ""
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Plik nale¿y do pakietu"
#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Plik nale¿y do projektu"
#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr ""
#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "Plik jest tylko do odczytu"
#: lazarusidestrconsts:lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr "Plik jest w u¿yciu"
#: lazarusidestrconsts:lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr ""
#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Menu plik"
#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr "Nazwa pliku:"
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Plik nie jest wykonywalny"
#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Nie znalaz³em pliku"
#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr "Nazwa pliku nie jest napisana ma³ymi literami"
#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Plik nie zapisany"
#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "To nie jest plik tekstowy"
#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Plik nie jest modu³em"
#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Nazwa pliku"
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nazwa pliku ró¿ni siê od nazwy pakietu"
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Plik jest u¿ywany przez inny pakiet"
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Plik o tej nazwie jest ju¿ u¿ywany w projekcie"
#: lazarusidestrconsts:lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts:lispefilename
msgid "Filename:"
msgstr ""
#: lazarusidestrconsts:lisoipfilename
msgid "Filename: %s"
msgstr "Nazwa pliku: %s"
#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Pliki"
#: lazarusidestrconsts:lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts:lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts:lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Wyszukaj..."
#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Znajd¼ &nastêpny"
#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "Znajd¼ poprze&dni"
#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files ..."
msgstr "Znajd¼ w pl&ikach ..."
#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Znajd¼ deklaracjê przy kursorze"
#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr ""
#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr " ..."
#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr ""
#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr ""
#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr "Znajd¼ drugi koniec bloku"
#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr "Znajd¼ pocz±tek bloku"
#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Znajd¼ pocz±tek bloku"
#: lazarusidestrconsts:liscomppalfindcomponent
msgid "Find component"
msgstr ""
#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Znajd¼ deklaracjê"
#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr ""
#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Znajd¼ w plikach"
#: lazarusidestrconsts:liskmfindincremental
msgid "Find incremental"
msgstr ""
#: lazarusidestrconsts:lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Znajd¼ nastêpne"
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr ""
#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr ""
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Znajd¼ przeciwny koniec bloku"
#: lazarusidestrconsts:lisfpfindpalettecomponent
msgid "Find palette component"
msgstr ""
#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Znajd¼ poprzednie"
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr ""
#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Znajd¼ definicjê procedury"
#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Znajd¼ metodê-procedurê"
#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr "Znajd¼ tekst"
#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Wyszukaj tekst przy kursorze"
#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "Finnish"
#: lazarusidestrconsts:lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr ""
#: lazarusidestrconsts:lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""
#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Uaktywnij edytor ¼ród³a"
#: lazarusidestrconsts:liscefollowcursor
msgid "Follow cursor"
msgstr ""
#: lazarusidestrconsts:lisuefontwith
msgid "Font without UTF-8"
msgstr ""
#: lazarusidestrconsts:lisforcerenaming
msgid "Force renaming"
msgstr ""
#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Kolor tekstu"
#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Edytor formularza"
#: lazarusidestrconsts:rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr ""
#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr "B³±d podczas ³adowania formularza"
#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr "B³±d formatowania"
#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Formularze"
#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Lista formularzy"
#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""
#: lazarusidestrconsts:lisvsrforwardsearch
msgid "Forward Search"
msgstr ""
#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr ""
#: lazarusidestrconsts:lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""
#: lazarusidestrconsts:lisfreepascal
msgid "Free Pascal"
msgstr ""
#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Katalog ze ¼ród³ami Freepascala"
#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "French"
#: lazarusidestrconsts:lisfunction
msgid "Function"
msgstr ""
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkcja: do³±cz rozgranicznik ¶cie¿ki"
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funkcja: wytnij rozgranicznik ¶cie¿ki"
#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkcja: wyodrêbnij rozszerzenie pliku"
#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkcja: wyodrêbnij sam± nazwê pliku"
#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkcja: wyodrêbnij nazwê pliku + rozszerzenie"
#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkcja: wyodrêbnij ¶cie¿kê pliku"
#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Kompatybilno¶æ z GPC (GNU Pascal Compiler)"
#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Informacja o licencji GPL"
#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Ogólne"
#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr "Opcje ogólne"
#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr "Ogólne opcje ¶rodowiska"
#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Twórz informacjê odpluskwiacza dla DBX (zwalnia kompilacjê)"
#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Twórz informacjê odpluskwiacza dla GDB (zwalnia kompilacjê)"
#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr "Twórz kod dla gprof"
#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""
#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr "Kod:"
#: lazarusidestrconsts:rslanguagegerman
msgid "German"
msgstr ""
#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Pobierz pozycjê"
#: lazarusidestrconsts:lispldglobal
msgid "Global"
msgstr ""
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Globalny dodatek do ¶cie¿ki ¼ród³ówej"
#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Przejd¼ do znacznika %d"
#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Przejd¼ do edytora %d"
#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Przejd¼ do linii numer..."
#: lazarusidestrconsts:liskmgotomarker0
msgid "Go to marker 0"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker1
msgid "Go to marker 1"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker2
msgid "Go to marker 2"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker3
msgid "Go to marker 3"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker4
msgid "Go to marker 4"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker5
msgid "Go to marker 5"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker6
msgid "Go to marker 6"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker7
msgid "Go to marker 7"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker8
msgid "Go to marker 8"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker9
msgid "Go to marker 9"
msgstr ""
#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Przejd¼ do pasuj±cego nawiasu"
#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Przejd¼ do nastêpnego edytora"
#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Przejd¼ do poprzedniego edytora"
#: lazarusidestrconsts:liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Przejd¼ do $include dla wstawionego pliku"
#: lazarusidestrconsts:listodogoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr "Id¼ do XY"
#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Id¼ do dyrektywy include"
#: lazarusidestrconsts:lismenugotoline
msgid "Goto line ..."
msgstr "Id¼ do wiersza ..."
#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Id¼ do wiersza :"
#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""
#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""
#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Przejd¼ do zaznaczonej linii ¼ród³a"
#: lazarusidestrconsts:srkmgrabkey
msgid "Grab key"
msgstr ""
#: lazarusidestrconsts:srkmgrabsecondkey
msgid "Grab second key"
msgstr ""
#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Kolor paska ikon"
#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Siatka"
#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Kolor siatki"
#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Rozmiar siatki X"
#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Rozmiar siatki Y"
#: lazarusidestrconsts:lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts:dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts:lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Znajd¼ b³êdnie umieszczone $IFDEF"
#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Znajd¼ b³êdne IFDEF/ENDIF"
#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Znajd¼ niedomkniêty blok"
#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Linie naprowadzaj±ce"
#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Kolor paska ikon"
#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Szeroko¶æ paska ikon"
#: lazarusidestrconsts:lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr ""
#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Ma procedurê Register"
#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr ""
#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr "Rozmiar stosu"
#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr ""
#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Wysoko¶æ"
#: lazarusidestrconsts:lispckedithelp
msgid "Help"
msgstr "Help"
#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr ""
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr ""
#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Menu pomoc"
#: lazarusidestrconsts:lishelpselectordialog
msgid "Help selector"
msgstr ""
#: lazarusidestrconsts:lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Ukryj okna IDE przy uruchomieniu"
#: lazarusidestrconsts:uemhighlighter
msgid "Highlighter"
msgstr ""
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Wskazówka: funkcja Utwórz napis zasobów oczekuje sta³ej napisowej%sWybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Porada: Funkcja Make Resourcestring wymaga sta³ej napisowej.%sWybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Porada: kliknij na poleceniu które chcesz edytowaæ"
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Porada: mo¿esz ustawiæ ¶cie¿kê kompilatora w ¦rodowisko->Opcje ¶rodowiska->Pliki->¦cie¿ka kompilatora"
#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Podpowiedzi dla palety komponentów"
#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Podpowiedzi dla g³ównych przycisków (otwórz, zapisz, ...)"
#: lazarusidestrconsts:lisinfobuildhint
msgid "Hints:"
msgstr ""
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr ""
#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr ""
#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Odstêpy poziome siatki"
#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr "G³ówna aplikacja"
#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Ostrzega³em: Jeszcze nie zaimplementowane"
#: lazarusidestrconsts:lisdebugoptionsfrmid
msgid "ID"
msgstr ""
#: lazarusidestrconsts:liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integracja z IDE"
#: lazarusidestrconsts:lisideintf
msgid "IDE Interface"
msgstr ""
#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr "IDE Options:"
#: lazarusidestrconsts:lismenuideinternals
msgid "IDE internals"
msgstr ""
#: lazarusidestrconsts:lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts:uepins
msgid "INS"
msgstr "WST"
#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Identyfikator"
#: lazarusidestrconsts:lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Uzupe³niaj identyfikatory"
#: lazarusidestrconsts:lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "D³ugo¶æ identyfikatora:"
#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Identyfikatorów"
#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Przedrostek identyfikatora:"
#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Je¶li mo¿esz nam pomóc zrealizowaæ t± funkcje, napisz pod adres lazarus@miraclec.com"
#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Ignoruj"
#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Ignoruj odstêpy"
#: lazarusidestrconsts:lisignoreall
msgid "Ignore all"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignoruj ilo¶æ znaków odstêpu"
#: lazarusidestrconsts:lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr ""
#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignoruj ró¿ne znaki koñca wiersza (np. #10 = #13#10)"
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignoruj zmiany na dysku"
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignoruj dodane lub usuniête puste linie"
#: lazarusidestrconsts:lisignoremissingfile
msgid "Ignore missing file"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignoruj odstêpy (ale nie znaki koñca linii)"
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignoruj spacje na koñcu wiersza"
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignoruj spacje na pocz±tku wiersza"
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr ""
#: lazarusidestrconsts:lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""
#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr ""
#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr "Przed metodami"
#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr "Do³±cz"
#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr "Do³±cz kod zabezpieczaj±cy"
#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr ""
#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr ""
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr "Plik do³±czany (include)"
#: lazarusidestrconsts:lisincludepaths
msgid "Include paths"
msgstr ""
#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Dodaj podkatalogi"
#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr "Do³±cz zmienne systemowe"
#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr "Do³±czane przez:"
#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Wyszukiwanie przyrostowe"
#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr "Zwiêksz wciêcie bloku"
#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr "Wetnij kod do"
#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Zwiêksz wciêcie zaznaczenia"
#: lazarusidestrconsts:lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts:rslanguageindonesian
msgid "Indonesian"
msgstr ""
#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Informacja o %s"
#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""
#: lazarusidestrconsts:liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr "Inherited"
#: lazarusidestrconsts:lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolinsert
msgid "Insert"
msgstr "Insert"
#: lazarusidestrconsts:liskminsertifdef
msgid "Insert $IFDEF"
msgstr ""
#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr ""
#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Wstaw s³owo kluczowe CVS: Author"
#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Wstaw s³owo kluczowe CVS: Date"
#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Wstaw s³owo kluczowe CVS: Header"
#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Wstaw s³owo kluczowe CVS: ID"
#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Wstaw s³owo kluczowe CVS: Log"
#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Wstaw s³owo kluczowe CVS: Name"
#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Wstaw s³owo kluczowe CVS: Revision"
#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Wstaw s³owo kluczowe CVS: Source"
#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Wstaw element ChangeLog'u"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Kompilator Delphi 5"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Katalog Delphi 5"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Projekt Delphi 5"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Kompilator Delphi 6"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Katalog Delphi 6"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Projekt Delphi 6"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Wstaw szablon kompilatora dla Delphi 7"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Wstaw szablon katalogów dla Delhi 7"
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Wstaw szablon projektu Delphi 7"
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Free Pascal Compiler"
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Projekt Free Pascal"
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Wstaw z szablonu"
#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Wstaw informacjê o licencji GPL"
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Wstaw szablon kompilatora dla Kylix 3"
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Wstaw szablon katalogu Kylix 3"
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Wstaw szablon projektu Kylix 3"
#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Wstaw informacjê o licencji LGPL"
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Katalog Lazarus"
#: lazarusidestrconsts:lisctinsertmacro
msgid "Insert Macro"
msgstr ""
#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr "Tryb wstawiania"
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Wstaw nowy element (poni¿ej)"
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Wstaw nowy element (powy¿ej)"
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Wstaw szablon"
#: lazarusidestrconsts:listddinserttodo
msgid "Insert ToDo"
msgstr ""
#: lazarusidestrconsts:ueminserttodo
msgid "Insert Todo"
msgstr ""
#: lazarusidestrconsts:srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts:liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Wstaw alfabetycznie"
#: lazarusidestrconsts:liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts:liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Wstaw z uwzglêdnieniem kontekstu"
#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Wstaw bie¿±c± datê i czas"
#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr "Wstaw bie¿±c± nazwê u¿ytkownika"
#: lazarusidestrconsts:liskminsertdateandtime
msgid "Insert date and time"
msgstr ""
#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Wstaw z tablicy znaków..."
#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Wstaw z tablicy znaków"
#: lazarusidestrconsts:liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr ""
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Wstaw jako potomny"
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Wstaw poni¿ej"
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts:liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr ""
#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Wstaw odstêp po"
#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Wstaw odstêp przed"
#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Wstaw tekst"
#: lazarusidestrconsts:liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr ""
#: lazarusidestrconsts:liskminsertusername
msgid "Insert username"
msgstr ""
#: lazarusidestrconsts:liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr ""
#: lazarusidestrconsts:liskminspect
msgid "Inspect"
msgstr ""
#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr ""
#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Zainstaluj"
#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Zainstaluj przy nastêpnym uruchomieniu"
#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Zainstaluj pakiet w IDE"
#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr ""
#: lazarusidestrconsts:lisinstallationfailed
msgid "Installation failed"
msgstr ""
#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr "Zainstalowany"
#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrminterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts:listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr ""
#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr "Odstêp w sekundach"
#: lazarusidestrconsts:lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts:lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Nieprawid³owy typ przodka"
#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Niedopuszczalne zapêtlenie"
#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nieprawid³owa nazwa klasy"
#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "B³êdny filtr Exclude"
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr ""
#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""
#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "B³êdny filtr Include"
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "B³êdna wersja Min-Max"
#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "B³êdny pakiet"
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Nieprawid³owy identyfikator pascala"
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "B³êdna sekcja Resourcestring"
#: lazarusidestrconsts:lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "B³êdna nazwa modu³u"
#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "B³êdna nazwa modu³u: %s"
#: lazarusidestrconsts:lisinvalidcircle
msgid "Invalid circle"
msgstr ""
#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr "B³êdne polecenie"
#: lazarusidestrconsts:lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "B³êdna nazwa pliku kompilatora"
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Nieprawid³owa klasa komponentu"
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "B³êdna nazwa pliku odpluskwiacza"
#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr ""
#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "B³êdny katalog docelowy"
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "B³êdne wyra¿enie.%sWskazówka: funkcja Utwórz napis zasobów oczekuje sta³ej napisowej w pojedyñczym pliku. Wybierz wyra¿enie i spróbuj ponownie."
#: lazarusidestrconsts:lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr "Nieprawid³owy plik"
#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "B³êdne rozszerzenie pliku"
#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "B³êdna nazwa pliku"
#: lazarusidestrconsts:lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr ""
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "B³êdny maksymalny numer wersji"
#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "B³êdny minimalny numer wersji"
#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""
#: lazarusidestrconsts:liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr ""
#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "B³êdny identyfikator pakietu: %s%s%s"
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Nieprawid³owe rozszerzenie nazwy pakietu"
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "B³êdna nazwa pakietu"
#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nieprawid³owa nazwa pakietu"
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Nieprawid³owy typ pakietu"
#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "B³êdna nazwa pakietu"
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "B³êdny rodzic"
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "B³êdny element rodzica"
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "B³êdna nazwa modu³u pascala"
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "B³±dny poprzedni element"
#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr ""
#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "B³êdny nazwa pliku projektu."
#: lazarusidestrconsts:lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts:lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr ""
#: lazarusidestrconsts:lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr ""
#: lazarusidestrconsts:lispeinvalidunitname
msgid "Invalid unitname"
msgstr ""
#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "B³êdna nazwa zmiennej"
#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Nieodpowiednia wersja"
#: lazarusidestrconsts:dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr ""
#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "Italian"
#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Pochy³y"
#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Wysoko¶æ elementu"
#: lazarusidestrconsts:lisjitform
msgid "JIT Form"
msgstr ""
#: lazarusidestrconsts:rslanguagejapanese
msgid "Japanese"
msgstr ""
#: lazarusidestrconsts:lisplistjumptoselection
msgid "Jump To Selection"
msgstr ""
#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Przeskocz do ty³u"
#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Przeskocz do przodu"
#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr ""
#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr ""
#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr ""
#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr ""
#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr ""
#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skoki (np. skoki do metod)"
#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Zachowaj wszystkie pliki tekstowe"
#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Przechowuj istotne zmienne w rejestrach"
#: lazarusidestrconsts:dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Zachowaj wybrane pliki"
#: lazarusidestrconsts:liskeepname
msgid "Keep name"
msgstr ""
#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Zachowaj kolejno¶æ procedur"
#: lazarusidestrconsts:liskeepthemandcontinue
msgid "Keep them and continue"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr "Klawisz"
#: lazarusidestrconsts:liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts:srkmkey
msgid "Key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Schemat klawiszy skrótu"
#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Klawisze skrótu"
#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "B³êdne klawisze skrótu"
#: lazarusidestrconsts:liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr "S³owo kluczowe"
#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr "S³ów kluczowych"
#: lazarusidestrconsts:lislcl
msgid "LCL"
msgstr ""
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opcje interfejsu LCL:"
#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr "Typ widgetu LCL"
#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr "Interfejs LCL"
#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "brakuje ¶cie¿ki modu³u LCL"
#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - formularz Lazarusa jako tekst"
#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "plik LFM"
#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""
#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr ""
#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Informacja o licencji LGPL"
#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - zasoby Lazarusa"
#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Jêzyk"
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr ""
#: lazarusidestrconsts:rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts:rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr "Na koñcu"
#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr "Na koñcu (np. na koñcu ¼ród³a)"
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr ""
#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""
#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr "Linia poleceñ uruchamianego programu"
#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr ""
#: lazarusidestrconsts:lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""
#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Katalog z konfiguracj± Lazarusa"
#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr "Katalog Lazarusa"
#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Katalog Lazarusa (domy¶lny dla wszystkich projektów)"
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu Lazarusa \"%s\"."
#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr ""
#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr ""
#: lazarusidestrconsts:lislazarusinclude
msgid "Lazarus include file"
msgstr ""
#: lazarusidestrconsts:lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr ""
#: lazarusidestrconsts:lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr ""
#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr ""
#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""
#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr ""
#: lazarusidestrconsts:lisleft
msgid "Left"
msgstr "W lewo"
#: lazarusidestrconsts:lisleftgroupboxcaption
msgid "Left anchoring"
msgstr ""
#: lazarusidestrconsts:lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""
#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr ""
#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr ""
#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Od lewej:"
#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr ""
#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr ""
#: lazarusidestrconsts:lislevels
msgid "Levels"
msgstr ""
#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""
#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Biblioteka"
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Licencja:"
#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr ""
#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Wiersz"
#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Dzielenie linii"
#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr "Tryb wyboru linii"
#: lazarusidestrconsts:lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Wiersza"
#: lazarusidestrconsts:lisinfobuildlines
msgid "Lines:"
msgstr ""
#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr "£±cz sprytnie"
#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr ""
#: lazarusidestrconsts:lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts:lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr "Linker"
#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr "£±czenie"
#: lazarusidestrconsts:liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts:rslanguagelithuanian
msgid "Lithuanian"
msgstr ""
#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Odczytaj z pliku"
#: lazarusidestrconsts:lisiecoloadfromfile
msgid "Load from file"
msgstr ""
#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr "Za³aduj/Zapisz"
#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Za³adowane pakiety:"
#: lazarusidestrconsts:lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Za³adowanie pakietu %s spowoduje zast±pienie pakietu %s%sz pliku %s.%sPoprzedni pakiet by³ zmieniany.%s%sZapisaæ poprzedni pakiet %s?"
#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Lokalne"
#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Zmienne lokalne"
#: lazarusidestrconsts:lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts:lislogo
msgid "Logo"
msgstr ""
#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Zaznaczenie ma³ymi literami"
#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Ma³ymi Literami, Pierwsza Du¿a"
#: lazarusidestrconsts:liskmmacosx
msgid "Mac OS X"
msgstr ""
#: lazarusidestrconsts:lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr "Makra"
#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Menu g³ówne"
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr ""
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr ""
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr ""
#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""
#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr "Major"
#: lazarusidestrconsts:rsmajorrevision
msgid "Major revision:"
msgstr ""
#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr "Utwórz plik wykonywalny"
#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Utwórz napis w zasobach ..."
#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr "Utwórz ResourceString"
#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr ""
#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr ""
#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr ""
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Rêczna kompilacja (nigdy automatyczna)"
#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Margines i pasek ikon"
#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Kolor zaznaczenia"
#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr ""
#: lazarusidestrconsts:lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "Maks. d³ugo¶æ wiersza:"
#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Liczba niedawno otartych plików"
#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Liczba niedawno otartych projektów"
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Osi±gniêto maksymaln± liczbê narzêdzi"
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maksymalny numer wersji (opcjonalny):"
#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maksymalny nr wersji:"
#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Maksymalny licznik"
#: lazarusidestrconsts:lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Edytor Menu"
#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Komunikaty"
#: lazarusidestrconsts:lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Zasady wstawiania metod"
#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Minimalizuj wszystkie okna razem z g³ównym"
#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimalny numer wersji (opcjonalny):"
#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimalny nr wersji:"
#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr "Minor"
#: lazarusidestrconsts:rsminorrevision
msgid "Minor revision:"
msgstr ""
#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Poziome odbicie lustrzane"
#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Pionowe odbicie lustrzane"
#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Pozosta³e"
#: lazarusidestrconsts:lismissingevents
msgid "Missing Events"
msgstr ""
#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr ""
#: lazarusidestrconsts:lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts:lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mieszanie metod i w³a¶ciwo¶ci"
#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Zmienione"
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""
#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr "Zmieniony: %s"
#: lazarusidestrconsts:listodolfile
msgid "Module"
msgstr ""
#: lazarusidestrconsts:lismore
msgid "More"
msgstr ""
#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Wiêcej ..."
#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Powi±zania myszy"
#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr ""
#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Przesuñ zak³adkê w lewo"
#: lazarusidestrconsts:uemmoveeditorleftmost
msgid "Move Editor Leftmost"
msgstr ""
#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Przesuñ zak³adkê w prawo"
#: lazarusidestrconsts:uemmoveeditorrightmost
msgid "Move Editor Rightmost"
msgstr ""
#: lazarusidestrconsts:lismovepage
msgid "Move Page ..."
msgstr ""
#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr ""
#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr ""
#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr ""
#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr "Przesuñ kursor o 1 stronê"
#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr "Przesuñ kursor w lewo o 1 stronê"
#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr "Przesuñ kursor w prawo o 1 stronê"
#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Przesuñ kursor na pocz±tek"
#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Przesuñ kursor na koniec"
#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Przesuñ kursor na dó³ strony"
#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Przesuñ kursor na koniec wiersza"
#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Przesuñ kursor na pocz±tek wiersza"
#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Przesuñ kursor na górê strony"
#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr "Przesuñ kursor o stronê wy¿ej"
#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr "Przesuñ kursor o s³owo w lewo"
#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr "Przesuñ kursor o s³owo w prawo"
#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Przesuñ zale¿no¶æ w dó³"
#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Przesuñ zale¿no¶æ w górê"
#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts:lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts:lispemovefiledown
msgid "Move file down"
msgstr ""
#: lazarusidestrconsts:lispemovefileup
msgid "Move file up"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Przesuñ w dó³"
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Przesuñ o poziom ni¿ej"
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Przesuñ o poziom wy¿ej"
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Przesuñ w górê"
#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr "Przesuñ ¶cie¿kê w dó³"
#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr "Przesuñ ¶cie¿kê w górê"
#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr ""
#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr ""
#: lazarusidestrconsts:dlgmultiselect
msgid "Multi Select"
msgstr ""
#: lazarusidestrconsts:fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Wybrane komponenty musz± byæ na tym samym formularzu"
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "UWAGA: Nie mog³em utworzyæ szablonu define dla ¼róde³ Free Pascala"
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "UWAGA: Nie mog³em utworzyæ szablonu define dla ¼róde³ Lazarusa"
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "UWAGA: brak plik konfiguracji codetools - u¿yjê opcji domy¶lnych"
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "UWAGA: ³adujê stary plik opcji codetools"
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmname
msgid "Name"
msgstr ""
#: lazarusidestrconsts:lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Nazwa:"
#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Nazewnictwo"
#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""
#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr "Nowy"
#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Nowy ..."
#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr ""
#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr ""
#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr "Nowy komponent"
#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr ""
#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Nowy formularz"
#: lazarusidestrconsts:lispwnewproject
msgid "New Project"
msgstr ""
#: lazarusidestrconsts:lismenunewproject
msgid "New Project ..."
msgstr "Nowy projekt ..."
#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nowy projekt z pliku ..."
#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nowy wymóg"
#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "[?] Nowy opis szablonu..."
#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Nowy modu³"
#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr "Nazwa nowej klasy:"
#: lazarusidestrconsts:liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts:lismenunewpackage
msgid "New package ..."
msgstr ""
#: lazarusidestrconsts:liskmnewproject
msgid "New project"
msgstr ""
#: lazarusidestrconsts:liskmnewprojectfromfile
msgid "New project from file"
msgstr ""
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nowy modu³u jest poza ¶cie¿k± do modu³ów"
#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nowy element"
#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nowy Pakiet"
#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nowa linia"
#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""
#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nie znalaz³em sekcji ResourceString."
#: lazarusidestrconsts:lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts:lisnobackupfiles
msgid "No backup files"
msgstr ""
#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr ""
#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr ""
#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr ""
#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr "Nie znalaz³em b³êdnych klawiszy skrótu."
#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nie wybrano elementu"
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Nie znalaz³em pakietu dla zale¿no¶ci %s%s%s.%sWybierz _istniej±cy_ pakiet."
#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr "Brak wybranego pakietu"
#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Nie znalaz³em pliku z programem %s%s%s."
#: lazarusidestrconsts:lisnostringconstantfound
msgid "No string constant found"
msgstr "Nie znalaz³em sta³ej napisowej"
#: lazarusidestrconsts:lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Element i potomne s± prawid³owe tylko dla tego projektu"
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Element tylko do odczytu"
#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr "Brak"
#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr ""
#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normalny tryb wyboru"
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""
#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr ""
#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr ""
#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Nie znalaz³em"
#: lazarusidestrconsts:lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr "Jeszcze nie zaimplementowane"
#: lazarusidestrconsts:lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""
#: lazarusidestrconsts:lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr "Nie teraz"
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr ""
#: lazarusidestrconsts:lisinfobuildnote
msgid "Notes:"
msgstr ""
#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Informacja: Plikami projektu s± wszystkie pliki w jego katalogu"
#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Liczba"
#: lazarusidestrconsts:lisifdok
msgid "OK"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr "NAD"
#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr "Obiekt"
#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Inspektor obiektów"
#: lazarusidestrconsts:liskeycatobjinspector
msgid "Object Inspector commands"
msgstr ""
#: lazarusidestrconsts:lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts:dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts:lisokbtn
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr ""
#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr ""
#: lazarusidestrconsts:dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr ""
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr ""
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Pomoc sieciowa jeszcze nie dzia³a"
#: lazarusidestrconsts:lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""
#: lazarusidestrconsts:lisemdonlypublished
msgid "Only published"
msgstr ""
#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Tylko zaznaczenie"
#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Tylko pliki tekstowe"
#: lazarusidestrconsts:lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr "Otwórz ..."
#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr ""
#: lazarusidestrconsts:lismenuopen
msgid "Open ..."
msgstr "Otwórz ..."
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Otwórz Diff w edytorze"
#: lazarusidestrconsts:lisopenfile2
msgid "Open File ..."
msgstr ""
#: lazarusidestrconsts:liscpopenpackage
msgid "Open Package %s"
msgstr ""
#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr ""
#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr "Chcesz otworzyæ pakiet?"
#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr "Poka¿ podgl±d"
#: lazarusidestrconsts:lispwopenproject
msgid "Open Project"
msgstr ""
#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project ..."
msgstr "Otwórz projekt ..."
#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr "Otwórz projekt"
#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Chcesz otworzyæ projekt?"
#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Otwórz poprzedni"
#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent ..."
msgstr "Otwórz poprzedni ..."
#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Otwórz poprzedni projekt ..."
#: lazarusidestrconsts:liscpopenunit
msgid "Open Unit %s"
msgstr ""
#: lazarusidestrconsts:lisopenasxmlfile
msgid "Open as XML file"
msgstr ""
#: lazarusidestrconsts:lisopenexistingfile
msgid "Open existing file"
msgstr ""
#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Otwórz plik"
#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Otwórz plik przy kursorze"
#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Otwórz plik przy kursorze"
#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Otwieraj poprzedni projekt po uruchomieniu"
#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Otwórz za³adowany pakiet"
#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Otwórz za³adowany pakiet ..."
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr ""
#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Otwórz pakiet..."
#: lazarusidestrconsts:lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts:liskmopenpackagefile
msgid "Open package file"
msgstr ""
#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr ""
#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr ""
#: lazarusidestrconsts:lisopenproject2
msgid "Open project"
msgstr ""
#: lazarusidestrconsts:lisopenprojectagain
msgid "Open project again"
msgstr ""
#: lazarusidestrconsts:lisiecoopenrecent
msgid "Open recent"
msgstr ""
#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Otwórz poprzedni pakiet ..."
#: lazarusidestrconsts:lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts:lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts:lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr ""
#: lazarusidestrconsts:lisopenthepackage
msgid "Open the package %s?"
msgstr ""
#: lazarusidestrconsts:lisopentheproject
msgid "Open the project %s?"
msgstr ""
#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Otwórz modu³"
#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr "Optymalizacje:"
#: lazarusidestrconsts:liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts:liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opcja: Równaj do siatki"
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opcja: Równaj do linii naprowadzaj±cych"
#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Opcje"
#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr "Opcje:"
#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr "Opcje: "
#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr ""
#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr "Rozpocznij"
#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr "Inne"
#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""
#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr ""
#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Inne pliki"
#: lazarusidestrconsts:rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Ustawienia wyj¶cia"
#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Katalog wyj¶ciowy"
#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr "Przepe³nienie"
#: lazarusidestrconsts:lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts:lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""
#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Przedefiniuj zmienn± systemow±"
#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Tryb nadpisywania"
#: lazarusidestrconsts:lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr ""
#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Zast±piæ plik?"
#: lazarusidestrconsts:listodolowner
msgid "Owner"
msgstr ""
#: lazarusidestrconsts:rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr ""
#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Pakiet %s"
#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Nie znalaz³em pakietu %s"
#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Pakiet %s%s%s zosta³ zmieniny. Chcia³by¶ go zapisaæ?"
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Pakiet %s%s%s zosta³ zmieniony.%sChcesz go zapisaæ?"
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Pakiet %s%s%s nie ma prawid³owego katalogu wyj¶ciowego:%s%s%s%s"
#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Nie znalaz³em pakietu %s%s%s."
#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph ..."
msgstr "Lista pakietów ..."
#: lazarusidestrconsts:lispackageinfo
msgid "Package Info"
msgstr ""
#: lazarusidestrconsts:lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Nazwa pakietu"
#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr "Nazwa pakietu:"
#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr "Opcje pakietu"
#: lazarusidestrconsts:lispkgreg
msgid "Package Registration"
msgstr ""
#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Znacznik katalogu ¼róde³ pakietu"
#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Pakiet jest w konflikcie"
#: lazarusidestrconsts:lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr ""
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Nie znalaz³em pliku pakietu"
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""
#: lazarusidestrconsts:liskmpackagegraph
msgid "Package graph"
msgstr ""
#: lazarusidestrconsts:dlgpldpackagegroup
msgid "Package group"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Paskiet nie jest typu projektowego"
#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pakiet jest dostêpny tylko do odczytu"
#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pakiet jest wymagany"
#: lazarusidestrconsts:lismenupackagelinks
msgid "Package links ..."
msgstr ""
#: lazarusidestrconsts:srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Pakiet o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts:lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr ""
#: lazarusidestrconsts:lispackagenamecontains
msgid "Package name contains ..."
msgstr ""
#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""
#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Nie znalaz³em pakiet"
#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr "Pakiet: %s"
#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr "Typ pakietu"
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pakiety musz± mieæ rozszerzenie .lpk"
#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr ""
#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nazwa zak³adki jest zbyt d³uga"
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr ""
#: lazarusidestrconsts:liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr "Zak³adka palet:"
#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Akapity"
#: lazarusidestrconsts:liscmparameter
msgid "Parameter"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametry:"
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Rodzic nie mo¿e zawieraæ elementów"
#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr "Analiza"
#: lazarusidestrconsts:lislazbuildabopart
msgid "Part"
msgstr ""
#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr ""
#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr ""
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Modu³y pascala musz± mieæ rozszerzenie .pp lub .pas"
#: lazarusidestrconsts:lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Prze¶lij opcje do linkera (oddzielone spacj±)"
#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Wklej"
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr ""
#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Wklej tutaj"
#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Wklej wybrane komponenty ze schowka"
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr "Szablony ¶cie¿ek"
#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr ""
#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr "¦cie¿ki"
#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "¦cie¿ki (tylko do odczytu)"
#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr "Wstrzymaj"
#: lazarusidestrconsts:liskmpauseprogram
msgid "Pause program"
msgstr ""
#: lazarusidestrconsts:dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts:lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts:lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr "Sprawd¼ nazwê pliku kompilatora"
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Sprawd¼ katalog ¼róde³ FPC"
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Proszê otworzyæ modu³ przed uruchomieniem."
#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr "Wci¶nij klawisz ..."
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Zapisz plik przed dodaniem go do pakietu."
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""
#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr "[wybierz pakiet]"
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Wybierz pakiet który chcesz otworzyæ"
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Najpierw wybierz element."
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr "Punkt"
#: lazarusidestrconsts:lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr ""
#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr ""
#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr ""
#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr ""
#: lazarusidestrconsts:lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""
#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Podgl±d"
#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Podgl±d (maks. d³ugo¶æ wiersza = 1)"
#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Poprzedni element nie mo¿e zawieraæ potomnych"
#: lazarusidestrconsts:lisprint
msgid "Print"
msgstr "Drukuj"
#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr "Drukuj listê"
#: lazarusidestrconsts:listodolpriority
msgid "Priority"
msgstr ""
#: lazarusidestrconsts:lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr ""
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""
#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr ""
#: lazarusidestrconsts:uemprocedurejump
msgid "Procedure Jump"
msgstr ""
#: lazarusidestrconsts:srkmecprocedurelist
msgid "Procedure List ..."
msgstr " ..."
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Zasady wstawiania procedur"
#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr ""
#: lazarusidestrconsts:lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
msgid "Process"
msgstr ""
#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nazwa pliku programu:"
#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Wykry³em program"
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Plik ¼ród³owy powinien mieæ odpowiednie rozszerzenie, jak .pas, .pp lub .lpr"
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts:lisexeprograms
msgid "Programs"
msgstr ""
#: lazarusidestrconsts:lispdprogress
msgid "Progress"
msgstr ""
#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr "Projekt"
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Projekt %s%s%s poprawnie zbudowany. :)"
#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "cie¿ka plików do³±czanych projektu"
#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr "¦cie¿ka do³±czanych plików projektu"
#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr ""
#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor projektu"
#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspektor projektu- %s"
#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Opcje projektu"
#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opcje projektu ..."
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""
#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr "¦cie¿ka ¼róde³ projektu"
#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Scie¿ka ¼róde³ projektu"
#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr "¦cie¿ka do modu³ów projektu"
#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "¦ciezka modu³ów projektu"
#: lazarusidestrconsts:lisprojectwizard
msgid "Project Wizard"
msgstr ""
#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Projekt zmieniony"
#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr "Katalog projektu"
#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr "Nazwa pliku projektu"
#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Pliki projektu"
#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Wykry³em plik z informacj± o projekcie"
#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr ""
#: lazarusidestrconsts:lisprojectmacroproperties
msgid "Project macro properties"
msgstr ""
#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Menu projekt"
#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"
#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr "Spytaj o warto¶æ"
#: lazarusidestrconsts:lisceproperties
msgid "Properties"
msgstr ""
#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr ""
#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr "Uzupe³nianie w³a¶ciwo¶ci"
#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr ""
#: lazarusidestrconsts:lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr ""
#: lazarusidestrconsts:lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts:lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr ""
#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikuj pakiet..."
#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikuj projekt ..."
#: lazarusidestrconsts:liskmpublishproject
msgid "Publish project"
msgstr ""
#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr "Publikuj katalog projektu"
#: lazarusidestrconsts:lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr ""
#: lazarusidestrconsts:lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr ""
#: lazarusidestrconsts:lismenuquickcompile
msgid "Quick compile"
msgstr ""
#: lazarusidestrconsts:liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Szybkie sprawdzanie sk³adni"
#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "Zakoñcz"
#: lazarusidestrconsts:lisquitlazarus
msgid "Quit Lazarus"
msgstr ""
#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr "Zakres"
#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Powtórnie dodaj zale¿no¶æ"
#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr "Dodaj powtórnie plik"
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Czy prrzekompilowaæ ten i wszystkie wymagane pakiety?"
#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "B³±d odczytu"
#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Tylko do odczytu"
#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Tylko do odczytu: %s"
#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""
#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr "Przedrostek odczytu"
#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Tylko do odczytu"
#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Czy przebudowaæ Lazarusa?"
#: lazarusidestrconsts:lisiecorecentfiles
msgid "Recent files"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Przekompiluj wszystkie wymagane"
#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Przekompiluj po wyczyszczeniu"
#: lazarusidestrconsts:lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Przywróæ"
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr ""
#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr ""
#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr ""
#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Od¶wie¿"
#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""
#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Od¶wie¿ zawarto¶æ"
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "procedura rejestracji jest pusta"
#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr "Zarejestruj modu³"
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RejestrujModu³ by³o wzywane, ale ¿aden pakiet nie jest rejestrowany."
#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Zarejestrowane wtyczki"
#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr "B³±d rejestracji"
#: lazarusidestrconsts:lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts:lisrelativepaths
msgid "Relative paths"
msgstr ""
#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr "Release"
#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr ""
#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Usuñ"
#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Chcesz usun±æ zale¿no¶æ?"
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr ""
#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Usuñ wszystkie nieprawid³owe w³a¶ciwo¶ci"
#: lazarusidestrconsts:liskmremovebreakpoint
msgid "Remove break point"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Usuñ zale¿no¶æ"
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "chcesz usun±æ zale¿no¶æ %s%s%s%sz pakietu %s%s%s?"
#: lazarusidestrconsts:srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr ""
#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Usuñ plik"
#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Chcesz usun±æ plik %s z projektu?"
#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Chcesz usun±æ plik %s%s%s%sz pakietu %s%s%s?"
#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Chcesz usun±æ plik?"
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Usuñ wyselekcjonowane pliki"
#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Usuñ z projektu ..."
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""
#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr ""
#: lazarusidestrconsts:lisemdremovemethods
msgid "Remove methods"
msgstr ""
#: lazarusidestrconsts:liscodehelpdeletepathbutton
msgid "Remove path"
msgstr ""
#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Usuñ wybrany element"
#: lazarusidestrconsts:lisremovethem
msgid "Remove them"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Usuniête pliki (te pozycje nie zostan± zapisane do pliku lpk)"
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Usuniête wymagane pakiety"
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Usuniête wymagania (te pozycje nie zostan± zapisane do pliku lpk)"
#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr ""
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Zmianiæ litery w nazwie pliku na ma³e?"
#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr ""
#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr " ..."
#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr ""
#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr "Nie mo¿na zmieniæ nazwy pliku"
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Chcesz zmieniæ nazwê pliku w pakiecie?"
#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Chcesz zmieniæ nazwê pliku?"
#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr ""
#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr ""
#: lazarusidestrconsts:lisrenametolowercase
msgid "Rename to lowercase"
msgstr ""
#: lazarusidestrconsts:lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""
#: lazarusidestrconsts:lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Zast±p..."
#: lazarusidestrconsts:dlgreplaceall
msgid "Replace &All"
msgstr ""
#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr "Nadpisz plik"
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Chcesz nadpisaæ istniej±cy plik %s%s%s?"
#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr "Zast±p tekst"
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Zast±piæ to wyst±pienie %s%s%s%s przez %s%s%s%s"
#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""
#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr "Raport"
#: lazarusidestrconsts:lismenureportingbug
msgid "Reporting a bug..."
msgstr ""
#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Wymagane pakiety"
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Skanuj ponownie katalog ¼róde³ FPC"
#: lazarusidestrconsts:lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""
#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr "Zresetuj odpluskwiacz"
#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Nie mo¿na za³adowaæ zasobów"
#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr "Nie mo¿na zapisaæ zasobów"
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring ju¿ istnieje"
#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sekcja Resourcestring:"
#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr ""
#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr ""
#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Przywróæ po³o¿enie okna"
#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Przywraca rozmiar okna"
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts:dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresume
msgid "Resume"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr ""
#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Cofnij"
#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr "Przywrócenie nie uda³o siê"
#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Chcesz przywróciæ pakiet?"
#: lazarusidestrconsts:lisright
msgid "Right"
msgstr "W prawo"
#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr ""
#: lazarusidestrconsts:lisrightanchoring
msgid "Right anchoring"
msgstr ""
#: lazarusidestrconsts:lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Klikniêcie prawym przyciskiem na drzewie pozycji wy¶wietli menu podrêczne z wszystkimi dostêpnymi funkcjami."
#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "po³o¿enie marginesu"
#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Kolor prawego marginesu"
#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves cursor"
msgstr ""
#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr ""
#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr ""
#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr "Obwódka do rozci±gania"
#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Uruchom"
#: lazarusidestrconsts:lisbfruncommand
msgid "Run Command"
msgstr ""
#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr "Uruchom plik"
#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Parametry uruchamiania"
#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Menu uruchom"
#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Parametry uruchomienia"
#: lazarusidestrconsts:liskmrunprogram
msgid "Run program"
msgstr ""
#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr "Dojd¼ do kursora"
#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr "Id¼-do nie zadzia³a³o"
#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Tylko uruchomieniowy"
#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "Russian"
#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr ""
#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Taka sama nazwa (w podkatalogu)"
#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Zapisz"
#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Zapisz"
#: lazarusidestrconsts:lissave
msgid "Save ..."
msgstr ""
#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Zapisz wszystkie"
#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr "Zapisz jako..."
#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr ""
#: lazarusidestrconsts:lismenusaveas
msgid "Save As ..."
msgstr "Zapisz jako ..."
#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Zapisz jako szablon ..."
#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Chcesz zapisaæ zmiany?"
#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Zapisz pakiet %s (*.lpk)"
#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr "Chcesz zapisaæ pakiet?"
#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Zapisz projekt"
#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Zapisz projekt %s (*.lpi)"
#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Zapisz projekt jako ..."
#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr ""
#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr ""
#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Zapisz i wyjd¼"
#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr ""
#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr ""
#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Chcesz zapisaæ zmiany w projekcie %s?"
#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr ""
#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Zapisz do pliku"
#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Zapisuj informacjê edytora dla zamykanych plików"
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""
#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Zapisuj informacjê edytora tylko dla plików projektu"
#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lissavefileas
msgid "Save file as"
msgstr ""
#: lazarusidestrconsts:lisa2psavefiledialog
msgid "Save file dialog"
msgstr ""
#: lazarusidestrconsts:fdmsaveformasxml
msgid "Save form as xml"
msgstr ""
#: lazarusidestrconsts:lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ""
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ""
#: lazarusidestrconsts:lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr ""
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""
#: lazarusidestrconsts:lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr ""
#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr "Zapisz pakiet"
#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr ""
#: lazarusidestrconsts:liskmsaveproject
msgid "Save project"
msgstr ""
#: lazarusidestrconsts:liskmsaveprojectas
msgid "Save project as"
msgstr ""
#: lazarusidestrconsts:lisposavesessioninformationin
msgid "Save session information in"
msgstr ""
#: lazarusidestrconsts:lislazbuildsavesettings
msgid "Save settings"
msgstr ""
#: lazarusidestrconsts:lisiecosavetofile
msgid "Save to file"
msgstr ""
#: lazarusidestrconsts:lisiecosavetorecent
msgid "Save to recent"
msgstr ""
#: lazarusidestrconsts:liskmsaveall
msgid "SaveAll"
msgstr ""
#: lazarusidestrconsts:liskmsaveas
msgid "SaveAs"
msgstr ""
#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Skala"
#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr ""
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Przeskanuj modu³ w poszukiwaniu nazwy i procedury Register"
#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Szukaj komunikatów FPC"
#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Szukaj komunikatów Make"
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Przeszukuj wyj¶cie komunikatów Free Pascal Compiler"
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Przeszukuj wyj¶cie komunikatów make"
#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Zasiêg"
#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""
#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr "Przewiñ w dó³ o jedn± liniê"
#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr "Przewiñ w lewo o jeden znak"
#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr ""
#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr ""
#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr "Przewiñ w prawo o jeden znak"
#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr "Przewiñ w górê o jedn± liniê"
#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr ""
#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Wyniki wyszukiwania"
#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr ""
#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr ""
#: lazarusidestrconsts:lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
msgid "Search or Filter Phrases In List"
msgstr ""
#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr "¦cie¿ki poszukiwañ"
#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Nie znalaz³em wyra¿enia '%s' !"
#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Wyszukiwane przerwane przez u¿ytkownika"
#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr ""
#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr ""
#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr ""
#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Wyszukiwanie..."
#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Szukanie: %s"
#: lazarusidestrconsts:liscodehelpseealsotag
msgid "See also"
msgstr ""
#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "Zobacz komunikaty."
#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr "WybWLewo"
#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr "WybWPrawo"
#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Zaznacz"
#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr ""
#: lazarusidestrconsts:lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""
#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Wybierz formularze Delphi (*.dfm)"
#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr "Wybierz w dó³"
#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Wybierz do XY"
#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr "Wybierz do koñca linii"
#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr "Wybierz do pocz±tku linii"
#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Wybierz menu:"
#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Wybierz dó³ strony"
#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr "Wybierz stronê w dó³"
#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr "Wybierz stronê w lewo"
#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr "Wybierz stronê w prawo"
#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr "Wybierz górê strony"
#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr "Wybierz stronê w górê"
#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Wybierz szablon:"
#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr "Wybierz w górê"
#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr "Wybierz s³owo po lewej"
#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr "Wybierz s³owo po prawej"
#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr ""
#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr ""
#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr ""
#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Zaznacz wszystko"
#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr "Zaznacz blok"
#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr "Wybierz katalog"
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr "Wybierz wszystkie wewn."
#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Zaznacz wiersz"
#: lazarusidestrconsts:liskmselectlineend
msgid "Select line end"
msgstr ""
#: lazarusidestrconsts:liskmselectlinestart
msgid "Select line start"
msgstr ""
#: lazarusidestrconsts:lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts:liskmselectpagebottom
msgid "Select page bottom"
msgstr ""
#: lazarusidestrconsts:liskmselectpagetop
msgid "Select page top"
msgstr ""
#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr "Zaznacz akapit"
#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Wybierz komponent-rodzica"
#: lazarusidestrconsts:lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Wybierz do pocz±tku"
#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Wybierz do koñca"
#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr "Zaznacz do nawiasu"
#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr ""
#: lazarusidestrconsts:liskmselectwordleft
msgid "Select word left"
msgstr ""
#: lazarusidestrconsts:liskmselectwordright
msgid "Select word right"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Wybrany element:"
#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr ""
#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Wybór"
#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Zaznaczenie przekracza sta³± napisow±."
#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Narzêdzie zaznaczania"
#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "¦rednik"
#: lazarusidestrconsts:dlgposavesession
msgid "Session"
msgstr ""
#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr "Ustaw znacznik %d"
#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""
#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Domy¶lny wygl±d wszystkich elementów"
#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr "Domy¶lny wygl±d elementu"
#: lazarusidestrconsts:liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker0
msgid "Set marker 0"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker1
msgid "Set marker 1"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker2
msgid "Set marker 2"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker3
msgid "Set marker 3"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker4
msgid "Set marker 4"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker5
msgid "Set marker 5"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker6
msgid "Set marker 6"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker7
msgid "Set marker 7"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker8
msgid "Set marker 8"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker9
msgid "Set marker 9"
msgstr ""
#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Zmiennna w³a¶ciwo¶ci"
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolshift
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr "Shift tab"
#: lazarusidestrconsts:liscodehelpshorttag
msgid "Short"
msgstr ""
#: lazarusidestrconsts:liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts:lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr ""
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Czy litery w nazwie pliku maj± byæ zmienione na ma³e: %s%s%s%s?"
#: lazarusidestrconsts:lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr "Poka¿ wszystkie"
#: lazarusidestrconsts:liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Poka¿ warto¶ci CodeTools"
#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "B³êdy"
#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Poka¿ do linie naprowadzaj±ce"
#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Wskazówki"
#: lazarusidestrconsts:dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr ""
#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Pokazuj wskazówki przy nieu¿ywanych modu³ach w g³ównym ¼ródle"
#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr ""
#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Uwagi"
#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr "Poka¿ opcje"
#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Pokazuj opcje edycji formularzy"
#: lazarusidestrconsts:liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Ostrze¿enia"
#: lazarusidestrconsts:srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""
#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr ""
#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr "Poka¿ wszystkie komunikaty"
#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr "Wszystkie procs przy b³êdzie"
#: lazarusidestrconsts:dlgqshowborderspacing
msgid "Show border spacing"
msgstr ""
#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr ""
#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr ""
#: lazarusidestrconsts:dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr ""
#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""
#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Poka¿ opcje kompilatora"
#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Napisy na komponentach"
#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr ""
#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr ""
#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr ""
#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Podpowiedzi edytora"
#: lazarusidestrconsts:liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr ""
#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr ""
#: lazarusidestrconsts:dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr ""
#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr ""
#: lazarusidestrconsts:lispldshowgloballinks
msgid "Show global links"
msgstr ""
#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Poka¿ siatkê"
#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""
#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr ""
#: lazarusidestrconsts:lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr ""
#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr ""
#: lazarusidestrconsts:lisshowoldtaborder
msgid "Show old tab order"
msgstr ""
#: lazarusidestrconsts:lisshowpackages
msgid "Show packages"
msgstr ""
#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr ""
#: lazarusidestrconsts:lisshowspecialcharacters
msgid "Show special characters"
msgstr ""
#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr ""
#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr ""
#: lazarusidestrconsts:lisshowunits
msgid "Show units"
msgstr ""
#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr ""
#: lazarusidestrconsts:lispldshowuserlinks
msgid "Show user links"
msgstr ""
#: lazarusidestrconsts:lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts:lissibling
msgid "Sibling"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
msgid "Signals"
msgstr ""
#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr ""
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Uproszczona sk³adnia (np. * zamiast .*)"
#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Rozmiar"
#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr ""
#: lazarusidestrconsts:lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Pomiñ wywo³anie kompilatora"
#: lazarusidestrconsts:lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr ""
#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""
#: lazarusidestrconsts:lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts:rslanguageslovak
msgid "Slovak"
msgstr ""
#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr "Ma³y"
#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""
#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr ""
#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Przyci±gaj do linii naprowadzaj±cych"
#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Przyci±gaj do siatki"
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Niektóre pliki na dysku uleg³y zmianie:"
#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Niestety, funkcja jeszcze niedostêpna"
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Przykro mi, ten typ jeszcze nie jest obs³ugiwany"
#: lazarusidestrconsts:lispesortfiles
msgid "Sort files"
msgstr ""
#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr "Posortuj zaznaczenie"
#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection ..."
msgstr "Posortuj zaznaczenie ..."
#: lazarusidestrconsts:lisceomodesource
msgid "Source"
msgstr ""
#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Edytor ¼róde³"
#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Zak³adki edytora ¼róde³"
#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""
#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr ""
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""
#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "¬ród³o zmienione"
#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "¬ród³o zak³adki %s%s%s zosta³o zmienione. Chcesz je zapisaæ?"
#: lazarusidestrconsts:lissourcepaths
msgid "Source paths"
msgstr ""
#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Podgl±d ¼ród³a"
#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Odstêp"
#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr ""
#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "Spanish"
#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr "¬ród³o"
#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr "Stos"
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Standardowe menu Edycja"
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Standardowe menu PLIK"
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Standardowe menu Pomoc"
#: lazarusidestrconsts:lisstartwithanewproject
msgid "Start with a new project"
msgstr ""
#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Stan"
#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "S³owo kluczowe static w obiektach"
#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr ""
#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr ""
#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr "Wejd¼ do"
#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr "Przejd¼ przez"
#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Zatrzymaj"
#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zatrzymaæ odpluskwianie?"
#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zatrzymuj po liczbie b³êdów:"
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr ""
#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr ""
#: lazarusidestrconsts:liskmstopprogram
msgid "Stop program"
msgstr ""
#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zatrzymaæ odpluskwianie?"
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr ""
#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Przyrostek \"zachowany\""
#: lazarusidestrconsts:lisstreamerror
msgid "Stream Error"
msgstr ""
#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr "B³±d strumienia"
#: lazarusidestrconsts:lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Sta³a napisowa"
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Sta³a napisowa w ¼ródle"
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Sta³e napisowe o tej samej warto¶ci:"
#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Wyczy¶æ z symboli plik wykonywalny"
#: lazarusidestrconsts:lisstyle
msgid "Style"
msgstr ""
#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr ""
#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""
#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Podkatalog"
#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr ""
#: lazarusidestrconsts:lissuccess
msgid "Success"
msgstr ""
#: lazarusidestrconsts:lisinfobuildsuccess
msgid "Success..."
msgstr ""
#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Prze³±cz ¶cie¿ki"
#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Prze³±cz pomiêdzy formularzem i kodem"
#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"
#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Przyrostek (.pp~)"
#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Przedrostek (~.pp)"
#: lazarusidestrconsts:lissynedit
msgid "SynEdit"
msgstr ""
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - komponent edycyjny u¿ywany przez Lazarusa. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Sprawdzenie sk³adni"
#: lazarusidestrconsts:lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr ""
#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr "Zmienne systemowe"
#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Kompatybilno¶æ z TP/BP 7.0"
#: lazarusidestrconsts:listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts:listaborderof
msgid "Tab Order of"
msgstr ""
#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr ""
#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr ""
#: lazarusidestrconsts:liseotabwidths
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr ""
#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulacje->odstêpy w zazn."
#: lazarusidestrconsts:lislazbuildqboapplcltarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr "Docelowy procesor"
#: lazarusidestrconsts:lislazbuildtargetcpu
msgid "Target CPU:"
msgstr ""
#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr "Docelowy system operacyjny"
#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Specyficzne opcje docelowego OS"
#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr "Docelowy OS:"
#: lazarusidestrconsts:dlgtargetplatform
msgid "Target Platform:"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Docelowa nazwa pliku"
#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Docelowa nazwa programu + parametry"
#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr "Docelowa nazwa programu"
#: lazarusidestrconsts:dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Podgl±d szablonu"
#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr "Plik szablonu"
#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr ""
#: lazarusidestrconsts:dlgccotest
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr "Katalog testowy"
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Nie znalaz³em katalogu testowego \"%s\"."
#: lazarusidestrconsts:dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr "Tekst"
#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Atrybuty czcionki"
#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Edycja tekstu"
#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Znaczniki"
#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Wyszukiwanie i zastêpowanie"
#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Wybieranie tekstu"
#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Znajd¼:"
#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"
#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s g³ówny katalog ,%sgdzie Borland zainstalowa³ %s wszystkie ¼ród³a,%sktóre s± u¿ywane przez projekt %s.%snp: /home/user/kylix%s"
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "G³ówny katalog %s,%sgdzie Borland instalowa³ %s wszystkie ¼ród³a,%sktóre s± u¿ywane przez projekt %s.%sNa przyk³ad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s katalog g³ówny,%sgdzie Borland Zainstalowa³ wszystkie %s ¼ród³a.%sNp: /home/user/kylix%s"
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Katalog g³ówny %s,%sgdzie Borland instalowa³ wszystkie ¼ród³a %s.%sNa przyk³ad: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Katalog projektu %s, który zawiera plik .dpr, dpk."
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL (Biblioteka Komponentów FreePascala) dostarcza bazowych klas dla object pascala."
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr ""
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Katalog projektu Free Pascal"
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL (Biblioteka Komponentów Lazarusa) zawiera wszystkie bazowe komponenty do tworzenia formularzy."
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Plik LFM (formularz Lazarusa) zawiera nieprawid³owe w³±¶ciwo¶ci, np. mo¿e zawieraæ pewne w³a¶ciwo¶ci lub klasy, których nie ma obecnie w LCL. Zwyczajowo naprawia siê to przezusuniêcie tych w³a¶ciwo¶ci z LFM i rêczne poprawienie kodu w pascalu."
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "G³ówny katalog Lazarusa"
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maksymalny numer wersji %s%s%s jest nieprawid³owy.%sU¿yj formatu: major.minor.release.build%sNp.: 1.0.20.10"
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maksymalny numer wersji jest mniejszy ni¿ minimalny."
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimalny numer wersji %s%s%s jest nieprawid³owy.%sU¿yj formatu: major.minor.release.build%sNp.: 1.0.20.10"
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr ""
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Nie znalaz³em katalogu testowego:%s%s%s%s%s(sprawd¼ w ustawieniach ¶rodowiska)"
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Typ przodka %s%s%s ma tak± sam± nazwê jak%smodu³ %s%s%s."
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Typ przodka %s%s%s nie jest poprawnym identyfikatorem pascala."
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Nazwa klasy %s%s%s i typ przodka %s%s%s s± jednakowe."
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Klasa o nazwie %s%s%s istnieje ju¿ w%spakiecie %s%sPlik: %s%s%s"
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Klasa %s%s%s ma tak± sam± nazwê jak%smodu³ %s%s%s."
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa klasy %s%s%s nie jest prawid³owym identyfikatorem pascala."
#: lazarusidestrconsts:listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Polecenie po %s%s%s nie jest wykonywalne."
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts:lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Plik kompilatora \"%s\" nie jest wykonywalny."
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Plik kompilatora dla pakietu %s nie jest wykonywalny:%s%s"
#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr ""
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Obecna ¶cie¿ka do modu³ów dla pliku %s%s%s%s to%s%s%s%s.%s%sBrakuje ¶cie¿ki do modu³ów LCL %s%s%s.%s%sWskazówka dla pocz±tkuj±cych:%sUtwórz aplikacjê Lazarusa i umie¶æ plik w katalogu projektu."
#: lazarusidestrconsts:lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Plik odpluskwiacza \"%s\" nie jest wykonywalny."
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Nie znalaz³em zale¿no¶ci %s%s%s.%sWybierz istniej±cy pakiet."
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Nie ma katalogu docelowego%s%s%s%s."
#: lazarusidestrconsts:listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr ""
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr ""
#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr "Katalog \""
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr ""
#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "Plik %s%s%s"
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Plik %s%s%s ju¿ nale¿y do pakietu."
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr ""
#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Plik %s%s%s nie jest pakietem Lazarusa."
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Plik %s%s%s nale¿y ju¿ do bie¿±cego projektu.%sDzielenie pliku pomiêdzy projektami i pakietami to nie jest dobry pomys³."
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Plik %s%s%s%sis ju¿ nale¿y do pakietu %s."
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Plik %s%s%s%sis jest poza ¶cie¿k± do modu³ów .%s%sCzy dodaæ %s%s%s do ¶cie¿ki do modu³ów?"
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr ""
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr ""
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Nie znalaz³em pliku %s%s%s%s.%sCzy chcesz zlokalizowaæ go samemu ?%s"
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Nie znalaz³em pliku %s%s%s%s.%sWci¶nij Ignoruj aby dalej ³adowaæ projekt,%sPorzuæ zatrzyma ³adowanie."
#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "Plik \""
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Plik o nazwie %s%s%s jest ju¿ czê¶ci± bie¿±cego projektu.%sProjekt i pakiety nie powinny wspó³dzieliæ plików."
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Plik %s%s%s jest u¿ywany przez%spakiet %s%s%s%sw pliku %s%s%s."
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Nazwa pliku %s%s%s nie odpowiada nazwie pakietu %s%s%s w tym pliku.%sChcesz zmieniæ nazwê pakietu na %s%s%s?"
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr ""
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr ""
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Aplikacja hosta %s%s%s nie jest wykonywalna."
#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Katalog lazarusa \"%s\" wygl±da na niepoprawny. Powinien zawieraæ katalogi jak lcl, debugger, designer, components, ... ."
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maksymalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przyk³ad poprawnego: 1.2.3.4)"
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimalny numer wersji %s%s%s nie jest poprawnym numerem wersji pakietu.%s(przyk³ad poprawnego: 1.2.3.4)"
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa %s%s%s nie jest prawid³owym identyfikatorem w pascalu."
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Nazwa \"%s\" nie jest prawid?owym identyfikatorem pascala."
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Pakiet %s jest tylko pakietem uruchomieniowym.%sTego typu pakiety nie mog± byæ instalowane w IDE"
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Pakiet %s jest dostêpny tylko do odczytu"
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Pakiet %s Jest wymagany przez %s, który zosta³ zaznaczony do instalacji.%sSpójrz na listê pakietów."
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Pakiet %s jest w³a¶cicielem%s%s%s%s.%sCzy chcesz zmieniæ t± nazwê pliku tak¿e w pakiecie?"
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr ""
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Pakiet %s%s%s ma znacznik auto instalacji.%sTo oznacza, ¿e bêdzie ona automatycznie instalowany przez IDE. Instalowane pakiety%smusz± byæ pakietami projektowymi."
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Pakiet %s%s%s zosta zaznaczony do instalacji, ale nie mo¿na go odnale¼æ.%sCzy usun±æ zale¿no¶æ z listy pakietów do instalacji?"
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Pakiet %s%s%s zosta³ zaznaczony do instalacji.%sAktualnie Lazarus obs³uguje tylko statyczne ³±czenie pakietów. Pe³na instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudowaæ Lazarusa?"
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Pakiet %s%s%s zosta³ zaznaczony.%sAktualnie Lazarus obs³uguje tylko statyczne ³±czenie pakietów. Pe³na instalacja wymaga przebudowania i powtórnego uruchomienia Lazarusa.%s%sCzy chcesz teraz przebudowaæ Lazarusa?"
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Nazwa pliku pakietu %s%s%s w%s%s%s%s nie jest prawid³ow± nazw± pakietu Lazarusa."
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Pakiet ma ju¿ zale¿no¶æ od pakietu %s%s%s."
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Pakiet %s%s%s jest nieprawid³owy.%sWybierz istniej±cy pakiet."
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Nazwa pakietu %s%s%s%s jest nieprawid³owa.%sProszê wybraæ istniej±cy pakiet."
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Nazwa pakietu %s%s%s jest nieprawid³owa%sProszê wybraæ inn± nazwê (np. package1.lpk)"
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Nazwa pakietu %s%s%s z%spliku %s%s%s jest nieprawid³owa."
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Nazwa zak³adki %s%s%s jest zbyt d³uga (maks. 100 znaków)."
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Projekt ma ju¿ zale¿no¶æ od pakietu %s%s%s."
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Plik z informacj± o projekcie %s%s%s%s jest taki sam jak g³ówne ¼ród³o projektu!"
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Projekt musi byæ zapisany przed budowaniem%sJe¶li zmienisz \"katalog testowy\" w ustawieniach ¶rodowiska,%sbêdziesz móg³ budowaæ projekty zaraz po utworzeniu.%sChcesz zapisaæ projekt?"
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt wymaga pakkietu,%s%s%s.%sktóry nie zosta³ znaleziony. Spójrz na Projekt->Inspektor projektu. "
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s ju¿ istnieje.%sWybierz inn± nazw±.%sU¿yj Ignoruj aby dodaæ j± pomimo tego."
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Modu³ %s%s%s ju¿ istnieje.%sIgnoruj wymusi zmianê nazwy,%sAnuluj anuluje zapisywanie ¼ród³a%sPorzuæ za¶ porzuci ca³± operacjê zapisywania.."
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr "Nazwa modu³u %s%s%s nie jest napisana ma³ymi literami.%sKompilator FPC 1.0.x wymaga ma³ych liter w nazwach plików. Je¶li nie u¿ywasz FPC 1.0.x do kompilacji tego modu³u, mo¿esz zignorowaæ komunikat.%s%sChcesz zmieniæ nazwê pliku?"
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Modu³ o nazwie %s%s%s ju¿ istnieje w projekcie%sw pliku: %s%s%s."
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Nazwa modu³u %s%s%s ju¿ istnieje w zaznaczeniu%sw pliku: %s%s%s."
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Nazwa modu³u %s%s%s nie odpowiada nazwie pliku."
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Nazwa modu³u %s%s%s nie jest prawid³owym identyfikatorem pascala."
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Nazwa modu³u %s%s%s jest taka sama jak nazwa zainstalowanego komponentu.%sU¿ywanie jej mo¿e spowodowaæ dziwne b³êdy."
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr ""
#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Modu³ o nazwie %s%s%s ju¿ nale¿y do pakietu %s%s."
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "W tym pakiecie jest ju¿ modu³ o nazwie %s%s%s."
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Wiêcej funkcji jest w menu podrêcznym"
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "W katalogu s± inne pliki o tej nazwie,%sktóre ró¿ni± siê tylko wielko¶ci± liter:%s%s%sChcesz je usun±æ?"
#: lazarusidestrconsts:lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Istniej± dwa modu³y z t± sam± nazw±:%s%s1 - %s%s%s w %s%s2 oraz %s%s%s w %s%s%s"
#: lazarusidestrconsts:lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Istnieje modu³ w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s%s"
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Istnieje modu³ w FPC o nazwie takiej samej jak pakiet:%s%s%s%s%s%s w %s%s%s"
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Wyst±pi³o zapêtlenie zale¿no¶ci w wymaganych pakietach. Spójrz na listê pakietów."
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Istnieje plik z tak± sam± nazw± i podobnym rozszerzeniem na dysku%sPlik: %s%sNiejednoznaczny plik: %s%s%sUsun±æ niejednoznaczny plik?"
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Mo¿e byæ maksymalnie %s narzêdzi."
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Modu³ o nazwie %s%s%s jest ju¿ w projekcie.%sWybierz inn± nazwê."
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Istnieje modu³ o nazwie takiej samej jak pakiet:%s%s1. %s%s%s w %s%s2. %s%s%s%s"
#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Ju¿ jest formularz o nazwie %s%s%s"
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Jest ju¿ pakiet %s%s%s za³adowany%sz pliku %s%s%s.%sSpójrz na Komponenty -> Lista pakietów.%sNadpisanie jest niemo¿liwe."
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Istnieje ju¿ inny pakiet o nazwie %s%s%s.%sKonfklikt w: %s%s%s%sPlik: %s%s%s"
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Znalaz³em w¶ród wymaganych pakietów niezapisany pakiet. Spójrz na listê pakietów."
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr ""
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""
#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "To jest automatycznie wygenerowany plik zasobów lazarusa"
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "To jest domy¶lny pakiet, u¿ywany tylko dla komponentów które nie maj± pakietu. Te komponenty s± ju¿ przedawnione."
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr ""
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr ""
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr ""
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr ""
#: lazarusidestrconsts:listhiswillhappencontinue
msgid "This will happen:%s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmthread
msgid "Thread"
msgstr ""
#: lazarusidestrconsts:listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Wymagana nazwa i nazwa pliku"
#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Nazwa:"
#: lazarusidestrconsts:lismenuviewtodolist
msgid "ToDo List"
msgstr "Lista \"Do zrobienia\""
#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr "Opcje..."
#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Prze³±cz pomiêdzy formularzem i unitem"
#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr "Prze³±cz tryb"
#: lazarusidestrconsts:liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Prze³±cz modu³/formularz"
#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr ""
#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr "Narzêdzia"
#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Menu narzêdzia"
#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Rozwijaj warto¶ci w podpowiedziach"
#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Podpowiedzi narzêdzi symbolicznych"
#: lazarusidestrconsts:listop
msgid "Top"
msgstr ""
#: lazarusidestrconsts:listopanchoring
msgid "Top anchoring"
msgstr ""
#: lazarusidestrconsts:listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""
#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr ""
#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Od góry:"
#: lazarusidestrconsts:listops
msgid "Tops"
msgstr ""
#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr ""
#: lazarusidestrconsts:listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts:rslanguageturkish
msgid "Turkish"
msgstr ""
#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"
#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr "Typ:"
#: lazarusidestrconsts:liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "WIELKIMI LITERAMI"
#: lazarusidestrconsts:rslanguageukrainian
msgid "Ukrainian"
msgstr ""
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Nie mo¿na dodaæ %s do projektu, poniewa¿ zawiera on ju¿ modu³ o tej nazwie."
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nie mo¿na dodaæ zasobu T%s:FORMDATA do pliku z zasobami %s%s%s%s.%sPrawdopodobnie b³±d sk³adni."
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nie mo¿na dodaæ komentarza nag³ówka zasobu do pliku zasobów %s%s%s%s.%sPrawdopodobnie b³±d sk³adniowy."
#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Nie mo¿na utworzyæ kopii zapasowej pliku %s%s%s jako %s%s%s!"
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Unable to change the auto create form list in the program source.%sPlease fix errors first."
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Nie mo¿na wyczy¶ciæ %s%s%s.%sSprawd¼ uprawnienia."
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nie mo¿na wyczy¶ciæ katalogu docelowego"
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Nie mo¿na zamieniæ pliku %s%s%s%sB³±d: %s"
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Nie mo¿na zaimportowaæ formularza lfm do lrs lub zapisaæ pliku lrs."
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Nie mo¿na skonwertowaæ pliku z danymi w formie tekstu z pliku%s%s%s%s%sna strumieñ dwójkowy. (%s)"
#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr ""
#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Nie mo¿na skopiowaæ pliku %s%s%s%sdo %s%s%s"
#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Nie mo¿na utworzyæ katalogu z kopi± zapasow± %s%s%s."
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nie mo¿na utworzyæ katalogu"
#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Nie mo¿na utworzyæ katalogu %s%s%s."
#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nie mo¿na utworzyæ pliku"
#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Nie mo¿na utworzyæ pliku %s%s%s"
#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Nie mo¿na utworzyæ pliku%s%s%s%s"
#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Nie mo¿na utworzyæ nowej metody. Popraw b³±d wypisany w oknie komunikatów."
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Nie mo¿na utworzyæ kaalogu wyj¶ciowego %s%s%s%s dla pakietu %s."
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Nie mo¿na utworzyæ katalogu ze ¼ród³ami %s%s%s%sdla pakietu %s."
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Nie mo¿na utworzyæ katalogu docelowego dla Lazarusa:%s%s%s%s.%sTen katalog jest wymagany przez nowe zmienione IDE z dodatkowymi pakietami."
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Nie mo¿na usun±æ niejednoznacznego pliku %s%s%s"
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nie mo¿na usun±æ pliku"
#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Nie mo¿na usun±æ pliku %s%s%s."
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Nie mo¿na usun±æ starego pliku statusu %s%s%s%spakietu %s"
#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Nie znalaz³em sekcji ResourceString. w tym ani ¿adnym z u¿ytych modu³ów."
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Nie znalaz³em pliku %s%s%s."
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Nie mo¿na znale¼æ metody. Popraw b³±d wypisany w oknie komunikatów."
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""
#: lazarusidestrconsts:lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""
#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nie mo¿na za³adowaæ pliku"
#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Nie mo¿na za³adowaæ pliku %s%s%s."
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Nie mo¿na za³±dowaæ poprzedniego pliku zasobów.%sPlik zasobów jest pierwszym plikiem do³±czanym w%s sekcji inicjalizacji.%sNa przyk³ad {$I %s.lrs}.%sPrawdopodobnie b³±d sk³adniowy."
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Nie mo¿na za³±dowaæ pakietu"
#: lazarusidestrconsts:lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""
#: lazarusidestrconsts:lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr ""
#: lazarusidestrconsts:lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nie mo¿na czytaæ pliku"
#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Nie mo¿na czytaæ pliku %s%s%s!"
#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Nie mo¿na odczytaæ pliku %s%s%s%sB³±d: %s"
#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Nie mo¿na czytaæ pliku %s%s%s."
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nie mo¿na odczytaæ pliku statusu %s%s%s%spakietu %s.%sB³±d: %s"
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Nie mo¿na usun±æ starego pliku kopii zapasowej %s%s%s!"
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Nie uda³o siê zmieniæ nazwy niejednoznacznego pliku %s%s%s%sna %s%s%s"
#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Nie uda³o siê zmieniæ nazwy pliku %s%s%s na %s%s%s!"
#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nie uda³o siê zmieniæ nazwy formularza w ¼ródle."
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nie mo¿na zmieniæ nazwy metody. Popraw b³±d wypisany w oknie komunikatów."
#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nie uda³o siê zmieniæ nazwy zmiennej w ¼ródle."
#: lazarusidestrconsts:lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Nie mo¿na uruchomiæ narzêdzia %s%s%s:%s%s"
#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Nie mo¿na zapisaæ pliku %s%s%s"
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Nie mo¿na pokazaæ metody. Popraw b³±d wypisany w oknie komunikatów."
#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nie mo¿na wys³aæ do strumienia %s:T%s."
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nie mo¿na przekszta³ciæ binarnego strumienia komponentu %s:T%s na tekst."
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nie mo¿na uaktualniæ polecenia CreateForm w ¼ródle"
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""
#: lazarusidestrconsts:lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Nie mo¿na pisaæ do pliku %s%s%s%s%s."
#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr "Nie mo¿na pisaæ do pliku"
#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Nie mo¿na zapisaæ do pliku %s%s%s%sB³±d: %s"
#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Nie mo¿na pisaæ do pliku %s%s%s."
#: lazarusidestrconsts:lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Nie mo¿na zapisaæ pakietu %s%s%s%sdo pliku %s%s%s.%sB³±d: %s"
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nie mo¿na zapisaæ pliku statusu %s%s%s%spakietu %s.%sB³±d: %s"
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Nie mo¿na pisaæ do pliku %s%s%s!"
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Inne, mniej wa¿ne optymalizacje"
#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Usuñ oznaczenie komentarza"
#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr "\"Undefine\""
#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "\"Undefine All\""
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Rekursywne \"Undefine\""
#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Podkre¶lony"
#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Cofnij"
#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr "Cofnij po zapisaniu"
#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit"
msgstr ""
#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr "Zmniejsz wciêcie bloku"
#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Zmniêksz wciêcie zaznaczenia"
#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Odinstaluj"
#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Odinstaluj przy nastêpnym uruchomieniu"
#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Chcesz odinstalowaæ pakiet %s?"
#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Chcesz odinstalowaæ pakiet?"
#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr "Modu³"
#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Modu³ %s%s%s zosta³ zmieniony. Chcesz go zapisaæ?"
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Modu³ %s%s%s zosta³ usuniêty z pakietu"
#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr ""
#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Informacja o module"
#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nieprawid³owa nazwa modu³u"
#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr "Nazwa modu³u:"
#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr "Nazwa modu³u:"
#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""
#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr "¦cie¿ka modu³u"
#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr "Rodzaj modu³u:"
#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Zalezno¶ci modu³ów"
#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr "Nazwa pliku modu³u:"
#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identyfikator modu³u istnieje"
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Modu³ o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts:lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr ""
#: lazarusidestrconsts:lisunitnamecontains
msgid "Unit name contains ..."
msgstr ""
#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Nie znalaz³em modu³u: %s%s%s"
#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts:lisunitpaths
msgid "Unit paths"
msgstr ""
#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr ""
#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Modu³ o tej nazwie ju¿ istnieje"
#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Modu³ o tej nazwie jest ju¿ w projekcie"
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts:lispeunitname
msgid "Unitname:"
msgstr ""
#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr ""
#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Lista modu³ów"
#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Niezapisany pakiet"
#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr "W górê"
#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr ""
#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Od¶wie¿/przebuduj"
#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Zaznaczenie wielkimi literami"
#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr "U¿ycie"
#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr "U¿ywaj napisów typu Ansi"
#: lazarusidestrconsts:dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr ""
#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""
#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "U¿yj modu³u Heaptrc"
#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr ""
#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr ""
#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Domy¶lny kolor"
#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr "U¿yj ekranu"
#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr "U¿yj programu ³aduj±cego"
#: lazarusidestrconsts:dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr ""
#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr ""
#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Pod¶wietlaj sk³adniê"
#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr ""
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "U¿yj ustawieñ menad¿era okien"
#: lazarusidestrconsts:lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr "U¿ytkownika najpierw"
#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "Inne rozszerzenie"
#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Inne rozszerzenie (.pp.xxx)"
#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr "Nadpisanie zmiennych"
#: lazarusidestrconsts:lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts:lisceuses
msgid "Uses"
msgstr ""
#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Warto¶æ"
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Warto¶æ jako ¶cie¿ki plików"
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Warto¶æ jako tekst"
#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr "Zmienna"
#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr "Nazwa zmiennej"
#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Przedrostek zmiennej"
#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Zmienna:"
#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr "Zmienna: %s"
#: lazarusidestrconsts:liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""
#: lazarusidestrconsts:lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Wersja"
#: lazarusidestrconsts:versioninfotitle
msgid "Version Info"
msgstr ""
#: lazarusidestrconsts:rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts:rsversion
msgid "Version:"
msgstr ""
#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr ""
#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Odstêpy pionowe siatki"
#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr ""
#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr "Poka¿ stos wywo³añ"
#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Poka¿ eksploratora kodu"
#: lazarusidestrconsts:lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr ""
#: lazarusidestrconsts:srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Poka¿ formularze"
#: lazarusidestrconsts:lismenuviewidespeedbuttons
msgid "View IDE speed buttons"
msgstr ""
#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Poka¿ historê skoków ..."
#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Poka¿ inspektora obiektów"
#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr ""
#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr ""
#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr "Poka¿ wyniki wyszukiwania"
#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr ""
#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Poka¿ edytor ¼róde³"
#: lazarusidestrconsts:lispeviewtodolist
msgid "View ToDo list"
msgstr ""
#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Zale¿no¶ci modu³ów"
#: lazarusidestrconsts:liskmviewunitinfo
msgid "View Unit Info"
msgstr ""
#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr ""
#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Poka¿ modu³y"
#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""
#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Poka¿ pu³apki"
#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr ""
#: lazarusidestrconsts:srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts:srkmectogglecomppalette
msgid "View component palette"
msgstr ""
#: lazarusidestrconsts:srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Poka¿ wyj¶cie debuggera"
#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr ""
#: lazarusidestrconsts:liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr "Poka¿ zmienne lokalne"
#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Menu widok"
#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr "Poka¿ komunikaty"
#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Poka¿ formularze projektu"
#: lazarusidestrconsts:dlgmainviewframes
msgid "View project frames"
msgstr ""
#: lazarusidestrconsts:liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts:liskmviewprojectsource
msgid "View project source"
msgstr ""
#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Poka¿ modu³y projektu"
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts:srkmecviewtodolist
msgid "View todo list"
msgstr ""
#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""
#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr ""
#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr ""
#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr "Poka¿ czujki"
#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Wirtualny modu³"
#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Wirtualny modu³ (brak ¼róde³ w pakiecie)"
#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Pokazuj pasek ikon"
#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Pokazuj margines"
#: lazarusidestrconsts:lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr "Ostrzegaj przed kompilacj±"
#: lazarusidestrconsts:lisccowarningcaption
msgid "Warning"
msgstr ""
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Uwaga: Plik %s%s%s%snale¿y do bie¿±cego projektu."
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Uwaga: znalaz³em niejednoznaczny plik: %s%s%s. Plik ¼ród³owy to: %s%s%s"
#: lazarusidestrconsts:lisinfobuildwarning
msgid "Warnings:"
msgstr ""
#: lazarusidestrconsts:liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts:liswlwatchlist
msgid "Watch list"
msgstr ""
#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr "Czujki"
#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Nowe formularze dodawaj do tworzonych automatycznie"
#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr ""
#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Szukaj"
#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Szeroko¶æ:"
#: lazarusidestrconsts:dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts:dlgwindow
msgid "Window"
msgstr ""
#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Pozycje okien"
#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""
#: lazarusidestrconsts:liswithrequiredpackages
msgid "With required packages"
msgstr ""
#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "S³owo przy kursorze"
#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr "Uzupe³nienie s³owa"
#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Wielko¶æ liter"
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Katalog roboczy:"
#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr "Katalog roboczy"
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts:lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "B³±d zapisu"
#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr ""
#: lazarusidestrconsts:liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Przedrostek zapisu"
#: lazarusidestrconsts:lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr ""
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Nie mo¿esz budowaæ lazarusa w czasie odpluskwiania lub kompilacji programu."
#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" nie istnieje."
#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" nie jest zapisywalny"
#: lazarusidestrconsts:lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""
#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr ""
#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr ""
#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr ""
#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "auto zainstalowany dynamicznie"
#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr "auto zainstalowany statycznie"
#: lazarusidestrconsts:lisbegins
msgid "begins"
msgstr ""
#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr "buduj wszystkie pliki programu/projektu"
#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr ""
#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr "buduj program/projekt"
#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "Kolor lewej i górnej"
#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "Kolor prawej i dolnej"
#: lazarusidestrconsts:lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "¶cie¿ka do kompilatora"
#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr "konfiguruj \"buduj plik\""
#: lazarusidestrconsts:liscontains
msgid "contains"
msgstr ""
#: lazarusidestrconsts:lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr ""
#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr "domy¶lnie (%s)"
#: lazarusidestrconsts:lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""
#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr ""
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""
#: lazarusidestrconsts:lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr ""
#: lazarusidestrconsts:lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts:dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts:rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "w projekcie:"
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""
#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr ""
#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr ""
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""
#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr ""
#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr ""
#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "zainstalowany dynamicznie"
#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr "zainstalowany statycznie"
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr ""
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [options] <project-filename>"
#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr ""
#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "ma³ymi literami"
#: lazarusidestrconsts:lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr ""
#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr "brakuj±cy"
#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr ""
#: lazarusidestrconsts:lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts:lisnew
msgid "new"
msgstr ""
#: lazarusidestrconsts:lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "nie"
#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr ""
#: lazarusidestrconsts:lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts:liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts:lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr "noname"
#: lazarusidestrconsts:lisnone2
msgid "none"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nie wybrano elementu"
#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr ""
#: lazarusidestrconsts:lisold
msgid "old"
msgstr ""
#: lazarusidestrconsts:lisor
msgid "or"
msgstr ""
#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "pakiet %s nie jest zapisany"
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "g³ówny plik ¼ród³owy pakietu"
#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr "przerwij dzia³anie programu"
#: lazarusidestrconsts:lisctpleaseselectamacro
msgid "please select a macro"
msgstr ""
#: lazarusidestrconsts:lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""
#: lazarusidestrconsts:srkmecquickcompile
msgid "quick compile, no linking"
msgstr ""
#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr ""
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""
#: lazarusidestrconsts:lisremove
msgid "remove"
msgstr ""
#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr ""
#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr ""
#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr ""
#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr ""
#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr "uruchom program"
#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr "Zapisz wszystkie zmienione pliki"
#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr "zapisz bie¿±cy plik w edytorze"
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""
#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr "sek"
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "ustaw tryb FPC na DELPHI"
#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "ustaw tryb FPC na GPC"
#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "ustaw tryb FPC na TP"
#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "w³±cz IOCHECKS"
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "w³±cz OVERFLOWCHECKS"
#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "w³±cz RANGECHECKS"
#: lazarusidestrconsts:lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts:lisccospaces
msgid "spaces"
msgstr ""
#: lazarusidestrconsts:lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "plik konfiguracji statycznych pakietów"
#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr "zatrzymaj program"
#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr "ten komunikat pomocy"
#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr ""
#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr "Nieznane polecenie edytora"
#: lazarusidestrconsts:lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr ""
#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "u¿yj modu³u LineInfo"
#: lazarusidestrconsts:lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts:lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "tak"