paweld/lazarus
1
0
Fork 0
mirror of https://gitlab.com/freepascal.org/lazarus/lazarus.git synced 2025-04-20 11:59:26 +02:00
Code Issues Packages Projects Releases Wiki Activity
t-fixes-1_8
lazarus/languages/lazaruside.he.po
maxim 81ea720fa1 IDE: regenerated translations and updated Russian translation 
git-svn-id: trunk@54567 -
2017-04-07 22:00:09 +00:00

22692 lines
691 KiB
Plaintext
Raw Permalink Blame History

This file contains ambiguous Unicode characters

This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

msgid ""
msgstr ""
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Mime-Version: 1.0Last-Translator: Ido Kanner <idokan@gmail.com>\n"
"Last-Translator: shulamy <shulamy@regba.org.il>\n"
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2011-04-02 22:25+0200\n"
"Language-Team: American English <kde-i18n-doc@kde.org>\n"
"MIME-Version: 1.0\n"
"X-Generator: Lokalize 1.0\n"
"Plural-Forms: nplurals=2; plural=(n != 1);\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr ""
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr ""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "השתמש בסכמה מוגדרת מראש"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "אתחל את כל ההגדרות"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "אתחל את כל הגדרות קווי העזר"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "אתחל את כל ההגדרות הטקסט"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "הדבק"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "דף זה לא מציג את הגדרותיך הנוכחיות. ראה דף - מתקדם. השתמש בדף זה כדי לאתחל איזה שהם שינויים מתקדמים"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "כללי"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
#, fuzzy
#| msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "סטנדרטי, כל הפעולות (נקודת עצירה, קיפול) כשלחצן העכבר לחוץ"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
#, fuzzy
#| msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "מורחב, פעולות (נקודת עצירה, קפול) כשלחצן העכבר למעלה.בחירה כשלחצן העכבר לחוץ והעכבר זז"
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "קו עזר"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "עכבר ימני כולל תנועה מושמטת"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "טקסט"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
#, fuzzy
#| msgid "Drag Selection (copy/paste)"
msgid "Drag selection (copy/paste)"
msgstr "גרור לבחירה (העתק/הדבק)"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "כפול "
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "מרובע"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "משולש"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "לחצן אמצעי"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "תוספות 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "תוספות 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "ימין"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "יש לך שינויים לא שמורים. שימוש בעמוד זה יבטל את השינויים שנעשו בדף הבא"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr ""
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr ""
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "<כלום>"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "קריאה בלבד"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "אותיות קטנות, אות ראשונה למעלה"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr ""
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "הוסף אופרטור הצבה :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "סוגריים מודגשים"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "עץ קוד מקופל"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "טקסט ברירת המחדל"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "בטל נקודת עצירה"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "הפעל נקודת עצירה"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "שורת שגיאה"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "נקודת הביצוע"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "סמן של קוד מקופל"
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "גלובלי"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "קו עזר"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "אם מוגדר"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "שורה"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "עריכה מתוזמנת"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "עריכת תבנית"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "טקסט"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "קו עזר מפריד"
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "הגדל אחרים"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "הדגש שורה נוכחית"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "חיפוש מתקדם"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "נקודת עצירה בלתי אפשרית"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "שורה נוכחית מודגשת"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "מספר שורה"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "שורה ששונתה"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "קישור לעכבר"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "אזור שנבחר"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "התא הפעיל"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "תאים אחרים"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "תאים מתוזמנים"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "התא הפעיל"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "תאים אחרים"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "תאים מתוזמנים"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "בלוק של טקסט"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "נקודת עצירה לא ידועה"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "סוגרי מילה"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr ""
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "הוסף נקודה פסיק"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "התאם את הקו העליון להערות בהתחלה"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "לפי סדר א' ב'"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "הסמן תמיד גלוי"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "פעולת קובץ רב משמעית:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "אזהרה בזמן הידור"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr ""
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr ""
#: lazarusidestrconsts.dlgapplicationsettings
#, fuzzy
#| msgid "Application Settings"
msgid "Application settings"
msgstr "הגדרות יישום"
#: lazarusidestrconsts.dlgassertcode
#, fuzzy
#| msgid "Include Assertion Code"
msgid "Include assertion code"
msgstr "כלול קוד הפרה"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "צור טפסים אוטומטית:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr ""
#: lazarusidestrconsts.dlgautocreatenewforms
#, fuzzy
#| msgid "When creating new forms, add them to auto-created forms"
msgid "Auto-create new forms"
msgstr "בזמן יצירת טפסים חדשים הוסף אותם לטפסים הנוצרים אוטומטית."
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "מחק קובץ אוטומטית"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr ""
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "הסתר סמן עכבר בזמן הקלדה"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "זיהוי אוטומטי"
#: lazarusidestrconsts.dlgautoindentlink
#, fuzzy
#| msgid "(Setup smart indent)"
msgid "(Set up smart indent)"
msgstr "(הפעל זיהוי חכם)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "זיהוי אוטומטי"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "הסר אוטומטית מתודות ריקות"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "שנה אוטומטית שם קובץ לאותיות קטנות"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr ""
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end\n"
msgstr ""
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "טפסים זמינים"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr ""
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "רקע"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(ללא תת ספרייה)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "שם זהה (בתיקיית משנה)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "מאחרי המתודות"
#: lazarusidestrconsts.dlgblockgroupoptions
#, fuzzy
#| msgid "Selection:"
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "בחירה:"
#: lazarusidestrconsts.dlgblockindent
#, fuzzy
#| msgid "Block indent"
msgid "Block indent (spaces)"
msgstr "זהות הבלוק"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "רווח/טאב כשורה קודמת"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "מיקום בלבד"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "רווחים"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr ""
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr ""
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr ""
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "סוגריים מודגשים"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "זוגות סוגריים תואמים"
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr ""
#: lazarusidestrconsts.dlgcasesensitive
#, fuzzy
#| msgid "&Case Sensitive"
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "תלוי ברי&שיות"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "בודק את אפשרויות המהדר"
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr ""
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "תוצאות"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "בדיקה"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "בדיקה: בודק מהדר ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "בדיקה: בודק תצורת מהדר ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "בדיקה: בודק תאריך מהדר ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "בדיקה: מהדר קובץ ריק ..."
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "בדיקה: ppu חסר של fpc ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "בדיקה: בודק מקורות בנתיבי החיפוש של ppu של fpc ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "בדיקה: מהדר קובץ ריק ..."
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr ""
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "סדר המחלקות"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "אחרון"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "אותיות קטנות"
#: lazarusidestrconsts.dlgcdtpreview
#, fuzzy
#| msgid "Preview (Max line length = 1)"
msgid "Preview (max line length = 1)"
msgstr "תצוגה מקדימה (אורך שורה מקסימלי = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "קרא קידומת"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "סיומת מאוחסנת"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "אותיות רישיות"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "קידומת משתנה"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "קידומת כתיבה"
#: lazarusidestrconsts.dlgcentercursorline
#, fuzzy
#| msgid "Center Cursor Line"
msgid "Center cursor line"
msgstr "מרכז את שורת הסמן"
#: lazarusidestrconsts.dlgcharcasefileact
#, fuzzy
#| msgid "Save As - auto rename pascal files lower case"
msgid "Save As - auto rename Pascal files lower case"
msgstr "שמור כ - שנה אוטומטית שמות של קבצי פסקל לאותיות קטנות"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr ""
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "בדוק חבילות בזמן יצירת טופס"
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr ""
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "בחר קובץ תבנית לקוד (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "הראה את כפתור הסגירה בפנקס"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "סכמת צבעים"
#: lazarusidestrconsts.dlgcmacro
#, fuzzy
#| msgid "C Style Macros (global)"
msgid "C style macros (global)"
msgstr "מקרו בסגנון שפת c (גלובלי)"
#: lazarusidestrconsts.dlgcoansistr
#, fuzzy
#| msgid "Use ansi strings"
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "השתמש במחרוזת ansi"
#: lazarusidestrconsts.dlgcoasmstyle
#, fuzzy
#| msgid "Assembler style:"
msgid "Assembler style"
msgstr "סגנון אסמבלר:"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "הודעות"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr ""
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr ""
#: lazarusidestrconsts.dlgcocops
#, fuzzy
#| msgid "C Style Operators (*=, +=, /= and -=)"
msgid "C style operators (*=, +=, /= and -=)"
msgstr "אופרטורים בסגנון שפת c (=*,=+,=/,=-)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "צור makefile"
#: lazarusidestrconsts.dlgcodebugging
#, fuzzy
#| msgid "Debugging info"
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "מנפה שגיאות:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "תוספת נתיב למנפה השגיאות (none):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "יצירת קוד"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "שניהם"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "קפל"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "הסתר"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "הפוך סדר קיפול בתפריט קופץ"
#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate Debugging Info For GDB (Slower / Increases exe-size)"
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "צור מידע ניפוי שגיאות עבור GDB (מאט את ההידור)"
#: lazarusidestrconsts.dlgcoheaptrc
#, fuzzy
#| msgid "Use Heaptrc Unit (check for mem-leaks)"
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "השתמש ביחידת heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
#, fuzzy
#| msgid "Include Files (-Fi):"
msgid "Include files (-Fi):"
msgstr "כלול קבצים (-FI):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr ""
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "תיקיות (-FI):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "קישור"
#: lazarusidestrconsts.dlgcoloadsavehint
#, fuzzy
#| msgid "Load/Save"
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "טען/שמור"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "צבע"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(ערוך צבע)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "לא השתנה"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "צבעים"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "פרמטרים של שורת הפקודה (ללא שם היישום)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr ""
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr ""
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr ""
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr ""
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr ""
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr ""
#: lazarusidestrconsts.dlgcompilermessage
#, fuzzy
#| msgid "Compiler Messages"
msgid "Compiler messages"
msgstr "הודעות מהדר"
#: lazarusidestrconsts.dlgcompilermessages
#, fuzzy
#| msgid "Compiler messages language file"
msgid "Compiler messages language file (*.msg)"
msgstr "קובץ שפת הודעות מהדר"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "אפשרויות מהדר"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "השלם מאפיינים"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr ""
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr ""
#: lazarusidestrconsts.dlgconfigfiles
#, fuzzy
#| msgid "Config Files:"
msgid "Config files"
msgstr "קבצי תצורה:"
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr ""
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "גלישה"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "מפרש"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "העתק/הדבק עם מידע קפול"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "העתק מילה בהעתקת כלום"
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "טווח"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr ""
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr ""
#: lazarusidestrconsts.dlgcoshowerr
#, fuzzy
#| msgid "Show Errors"
msgid "Show errors"
msgstr "הראה שגיאות"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "הראה אפשרויות"
#: lazarusidestrconsts.dlgcosmartlinkable
#, fuzzy
#| msgid "Smart Linkable"
msgid "Smart linkable"
msgstr "מיזוגיות חכמה"
#: lazarusidestrconsts.dlgcosources
#, fuzzy
#| msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "מקורות אחרים ( קבצי pp/.pas. בשימוש IDE בלבד ולא ע\"י המהדר)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "מחסנית"
#: lazarusidestrconsts.dlgcostrip
#, fuzzy
#| msgid "Strip Symbols From Executable"
msgid "Strip symbols from executable"
msgstr "הסר סמלים מקובץ ריצה"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "אוטומטי"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr ""
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr ""
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr ""
#: lazarusidestrconsts.dlgcounitstyle
#, fuzzy
#| msgid "Unit Style"
msgid "Unit style"
msgstr "סגנון היחידה:"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "צור קוד עבור valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "קולניות"
#: lazarusidestrconsts.dlgcppinline
#, fuzzy
#| msgid "C++ Styled INLINE"
msgid "C++ styled INLINE"
msgstr "פנימי בסגנון ++C"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "מקש Ctrl+לחצן אמצעי על לשונית סוגר את כל הלשוניות האחרות"
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr ""
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "סמן לאחר סיום השורה"
#: lazarusidestrconsts.dlgcursorgroupoptions
#, fuzzy
#| msgid "Cursor:"
msgid "Cursor"
msgstr "סמן:"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "הסמן מדלג על בחירה"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "סמן מדלג על טאבים"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "הרחבה של המשתמש (pp.xxx.)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr ""
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "נתיב העורך"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "סוג מנפה השגיאות והנתיב אליו"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "גופן ברירת מחדל של העורך"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "ערך ברירת מחדל"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "מחק תבנית"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "לחצנים -"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "טיפים"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "תפריטים -"
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr ""
#: lazarusidestrconsts.dlgdesktopsexported
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdesktopsimported
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr ""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "כיוון"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "בטל החלקת תצוגה"
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr ""
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "השתמש בצבע שוליים ימניים"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "שרטט רמת הפרדה"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "צבע שורה מקונן"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "צבע שורה"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "התחלה/סוף"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "פרוצדורה/פונקציה"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "מחלקה/מבנה נתונים"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "מחלקה/מבנה נתונים (מקומי)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "נסה/קבל"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "קטעי יחידה"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "משתמש בפיסקה"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "משתנה/סוג"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "משתנה/סוג (מקומי)"
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr ""
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "אחורה"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "מודגש"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "תת תיקייה"
#: lazarusidestrconsts.dlgedcodetempl
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "תבניות קוד"
#: lazarusidestrconsts.dlgedcompleteblocks
#, fuzzy
#| msgid "Add close statement for pascal blocks"
msgid "Add close statement for Pascal blocks"
msgstr "הוסף קוד סגירה לבלוקים של פסקל"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "הרחבה מוגדרת ע\"י המשתמש"
#: lazarusidestrconsts.dlgeddelayinsec
#, fuzzy,badformat
msgid "(%s sec delay)"
msgstr "(השהייה של s% שניות)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "הצג"
#: lazarusidestrconsts.dlgedfiles
#, fuzzy
#| msgid "Editor files"
msgid "Editor Files"
msgstr "קבצי עורך"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "השלמת מזהה"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "החלף"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "התעלם מנעילות, השתמש בעורך הארוך ביותר שאינו בשימוש"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "התעלם מנעילות, אם העורך הוא הנוכחי"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "התעלם מנעילות, אם העורך נמצא בחלון הנוכחי"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "נעול, אם הטקסט מוצג"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "לא נעול"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "לא נעול, אם הטקסט ממורכז"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "לשונית חדשה, חלון קיים או חדש"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "לשונית חדשה בחלון חדש"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "לשונית חדשה בחלון קיים"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "אפשרות זאת תשתמש בעורך הארוך ביותר שאינו בשימוש בשביל הקובץ, אפילו אם הוא נעול ו/או צריך גלילה. ההחלטה על העורך הארוך ביותר לא מתחשבת בסדר המיקוד של החלונות,אפילו אם הוא מוגדר כ \"אותו קריטריון סדר\". אפשרות זאת תצליח תמיד,אפשרויות נוספות עדיין לא נוסו."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "אפשרות זאת תבדוק אם לעורך הפעיל הנוכחי יש את קובץ המטרה , ואם יש היא תשתמש בעורך הנוכחי, אפילו אם הוא נעול ו/או צריך לגלול."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "אפשרות זאת תבדוק אם יש עורך לקובץ המטרה בחלון הנוכחי , ואם יש היא תשתמש בעורך, אפילו אם הוא נעול ו/או צריך לגלול."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "אפשרות זאת תשתמש בעורך נעול (ונעול בלבד), אשר אינו צריך לגלול כדי להציג את המטרה של נקודת הקפיצה (המטרה של נקודת הקפיצה כבר נראית על המסך)"
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "אפשרות זאת תשתמש בעורך לא נעול כלשהו."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "אפשרות זאת תשתמש בעורך לא נעול, אשר אינו צריך לגלול כדי להציג את המטרה של נקודת הקפיצה (המטרה של נקודת הקפיצה כבר נראית באזור מרכז המסך,חוץ מ 2-5 שורות בחלק העליון או התחתון של המסך."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "אפשרות זאת תפתח לשונית חדשה בחלון חדש או קיים, אם נמצאה לשונית לא נעולה. אפשרות זאת תעבוד תמיד,אפשרויות נוספות עדיין לא נוסו."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "אם לא נמצאה לשונית לא נעולה, אז אפשרות זאת תפתח לשונית חדשה בחלון חדש (אפילו אם אפשר להשתמש בחלון קיים אחר עבור הלשונית החדשה). אפשרות זאת תעבוד תמיד,אפשרויות נוספות עדיין לא נוסו."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "אם לא נמצאה לשונית לא נעולה, אז אפשרות זאת תפתח לשונית חדשה בחלון קיים (ורק בחלון קיים). לשונית נפתחת אם קיים חלון, שעדיין אין לו עורך מתאים לקובץ המטרה."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "כתב נטוי"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr ""
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "אפשרויות עורך"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "סכמת משתנים גלובליים"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "שונות"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "כבוי"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "דלוק"
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr ""
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "קו תחתון"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "תכונות הפריט"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "מקש end קופץ לקצה הקרוב ביותר"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "שאל"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "הערה: קבצי הפרויקט הם כל הקבצים הנמצאים בתיקיית הפרויקט"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "גבוי"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "קבצים"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "רשת"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "שפה"
#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr ""
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "קווים מנחים"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "שונות"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "ללא"
#: lazarusidestrconsts.dlgenvotherfiles
#, fuzzy
#| msgid "Other files"
msgid "Other Files"
msgstr "קבצים אחרים"
#: lazarusidestrconsts.dlgenvproject
#, fuzzy
#| msgid "Project"
msgid "Tabs for project"
msgstr "פרויקט"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "סוג"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "מרווח תו מוגדל"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "מרווח שורה מוגדל"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "השתמש בקובץ סמלים חצוני של מנפה השגיאות gdb"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "הרחבות לקובץ"
#: lazarusidestrconsts.dlgfiles
msgid "%s files"
msgstr ""
#: lazarusidestrconsts.dlgfilterall
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "כל הקבצים"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr ""
#: lazarusidestrconsts.dlgfilterdelphipackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "חבילת דלפי"
#: lazarusidestrconsts.dlgfilterdelphiproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "פרוייקט דלפי"
#: lazarusidestrconsts.dlgfilterdelphiunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "יחידת דלפי"
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr ""
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr ""
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "הגדרות שולחן העבודה של לזארוס"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "סוגי הקבצים של העורך"
#: lazarusidestrconsts.dlgfilterlazarusfile
#, fuzzy
#| msgid "Lazarus File"
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "קובץ לזארוס"
#: lazarusidestrconsts.dlgfilterlazarusform
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "טופס לזארוס"
#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "קובץ \"כלול\" של לזארוס"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazaruspackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "חבילת לזארוס"
#: lazarusidestrconsts.dlgfilterlazarusproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "פרוייקט לזארוס"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "קובץ קוד של פרוייקט לזארוס"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr ""
#: lazarusidestrconsts.dlgfilterlazarusunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "יחידת לזארוס"
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr ""
#: lazarusidestrconsts.dlgfilterprograms
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "תוכנות"
#: lazarusidestrconsts.dlgfilterxml
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "קבצי XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "מצא טקסט במוקום הסמן"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "חלק"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "בחירת חתיכה"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "הערה"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "צומת"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "פריט"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "רשימה<>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "אובייקט (בירושה, פנימי)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "משתנה/סוג (מקומי)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "הערה (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "התחלה/סיום (מקונן)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "הערה { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "מחלקה/עצם"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "צבורי/פרטי"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "קבל/לבסוף"
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "הערה מקוננת"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "התחלה/סיום (של פרוצדורה)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "פרוצדורה"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "תוכנה"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "רשומה"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "חזור"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "הערה //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "נסה"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "יחידה"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "קטע יחידה"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{אזור%}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "משתמש ב"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "משתנה/סוג (גלובלי)"
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "הערה"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "סוג מסמך"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "צומת"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "הוראת עיבוד"
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr ""
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "קידמה"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "מדיניות הזנת פרוצדורה"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "שמור על סדר הפרוצדורות"
#: lazarusidestrconsts.dlgfpcexecutable
msgid "Compiler executable (e.g. %s)"
msgstr ""
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "תיקיית קבצי המקור של FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "צבע הטקסט"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "עורך טפסים"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From Cursor"
msgid "&From cursor"
msgstr "סמן טפסים"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "השג את המיקום"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "גלובלי"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "צור קוד עבור gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "לוכד צבע"
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr ""
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "צבע הרשת"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr ""
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "גודל הרשת בכוון אופקי"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "רווח הרשת בכוון אופקי"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "גודל הרשת בכוון אנכי"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "רווח הרשת בכוון אנכי"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "CodeTools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "מנפה שגיאות"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "עורך"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "סביבה"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "בטל קבוצה"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "הראה קווי עזר"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr ""
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "קווי עזר"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "שקרס"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "צבע קווי עזר"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "צבע הגבול של קווי עזר"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "אידקס קווי עזר מפרידים"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "גלילת חצי דף"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr ""
#: lazarusidestrconsts.dlgheapsize
#, fuzzy
#| msgid "Heap Size"
msgid "Heap size"
msgstr "גודל הערמה"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr ""
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "גובה:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "הסתר את חלונות ה IDE בזמן ריצה"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr ""
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "הסתר לשונית בחלונות חד-עמודיים"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "צבע ההדגשה"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "צכע הגופן המודגש"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "שמאל הסמן"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "ימין הסמן"
#: lazarusidestrconsts.dlghintsparametersendernotused
#, fuzzy
#| msgid "Show Hints for parameter \"Sender\" not used"
msgid "Show hints for parameter \"Sender\" not used"
msgstr "אל תראה טיפים של פרמטר \"sender\" שאינו בשימוש"
#: lazarusidestrconsts.dlghintsunused
#, fuzzy
#| msgid "Show Hints for unused units in main source"
msgid "Show hints for unused units in main"
msgstr "הראה טיפים עבור יחידות שאינן בשימוש בקובץ קוד המקור הראשי"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "מקש home קופץ להתחלה הקרובה ביותר"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "יישום מארח"
#: lazarusidestrconsts.dlgidentifiercompletion
#, fuzzy
#| msgid "Identifier completion"
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "השלמם מזהים"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "מדיניות מזהים"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "אפשרויות IDE"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr ""
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:\n"
msgstr ""
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "כלול משתני מערכת"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr ""
#: lazarusidestrconsts.dlgindentstabsgroupoptions
#, fuzzy
#| msgid "Indent and Tabs"
msgid "Tabs"
msgstr "זיהוי ולשוניות:"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "לפני המתודות"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "שם הבונה חייב להיות init (שם ההורס חייב להיות 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr ""
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "מימוש"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "ממשק"
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr ""
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "הכנס לסעיף \"משתמש ב\""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "הכנס רווח אחרי"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "הכנס רווח לפני"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "מרווח זמן בשניות"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "קפיצה (למשל קפיצה למתודה)"
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "שמור על המיקום האופקי של הסמן"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr ""
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "מפוי מקשים"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "שגיאת מפוי מקשים"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "מדיניות מלות-מפתח"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "אפשר LABEL ו GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "שפה"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "אחרון (כלומר בסוף קוד המקור)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "תיקיית לזארוס (ברירת מחדל לכל הפרויקטים)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "שמאל:"
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "Guid lines Left,Top"
msgid "Guide lines Left,Top"
msgstr "קוים מנחים שמאל, למעלה"
#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "Level 1 (quick and debugger friendly)"
msgid "1 (quick, debugger friendly)"
msgstr "רמה 1 (מהיר ומנפה שגיאות ידידותי)"
#: lazarusidestrconsts.dlglevel2opt
#, fuzzy
#| msgid "2 (quick optimizations)"
msgid "2 (-O1 + quick optimizations)"
msgstr "רמה 2 (רמה 1 + אופטימיזציה מהירה)"
#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "3 (slow optimizations)"
msgid "3 (-O2 + slow optimizations)"
msgstr "רמה 3 (רמה 2 + אופטימיזציה איטית)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr ""
#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "Level 0 (no extra optimizations)"
msgid "0 (no optimization)"
msgstr "רמה 0 (ללא אופטימיזציה נוספת)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "פיצול שורה"
#: lazarusidestrconsts.dlglinksmart
#, fuzzy
#| msgid "Link Smart"
msgid "Link smart"
msgstr "קישור חכם"
#: lazarusidestrconsts.dlglnumsbct
#, fuzzy
#| msgid "Display Line Numbers in Run-time Error Backtraces"
msgid "Display line numbers in run-time error backtraces"
msgstr "הצג מספרי שורות בסוגריים של שגיאות בזמן ריצה"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "תפריט ראשי"
#: lazarusidestrconsts.dlgmainviewforms
#, fuzzy
#| msgid "View project forms"
msgid "View Project Forms"
msgstr "צפה בטפסים בפרויקט"
#: lazarusidestrconsts.dlgmainviewframes
#, fuzzy
#| msgid "View project frames"
msgid "View Project Frames"
msgstr "צפה במסגרות בפרויקט"
#: lazarusidestrconsts.dlgmainviewunits
#, fuzzy
#| msgid "View project units"
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "צפה ביחידות בפרויקט"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr ""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr ""
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "שוליים וקווי עזר"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "צבע הסמן"
#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Word under Caret Highlight"
msgid "Highlight of Word under Caret"
msgstr "הדגשת מילים תחת הסמן"
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "מחק"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "שם"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Word Brackets on caret (global)"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "התאם את תוחמי המילה עד לאורך זה:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
#, fuzzy
#| msgid "Ignore Keywords"
msgid "Ignore keywords"
msgstr "התעלם ממילות-מפתח"
#: lazarusidestrconsts.dlgmarkupwordnotimer
#, fuzzy
#| msgid "Disable Timer for Markup Current Word"
msgid "Disable timer for markup current word"
msgstr "בטל טיימר עבור מלה נוכחית עליונה"
#: lazarusidestrconsts.dlgmarkupwordtrim
#, fuzzy
#| msgid "Trim Spaces (when highlighting current selection)"
msgid "Trim spaces (when highlighting current selection)"
msgstr "צמצם רווחים (כאשר הבחירה הנוכחית מודגשת)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "מונה מקסימלי"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "אורך שורה מירבי:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "מספר מקסימלי של קבצים שנפתחו לאחרונה"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "מספר מקסימלי של קבצי פרוייקט שנפתחו לאחרונה"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "ערבב מתודות ותכונות"
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "יחיד"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "כפול "
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "משולש"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "מרובע"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "כלשהו"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "תוספות 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "תוספות 2"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "שמאל"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "אמצע"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "צור נתוני שחזור"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "ימין"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "תפוס"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "הזז סמן (נוסף)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "פעל כשהעכבר עולה"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "פעולה"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "קליק"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "ערוך עכבר"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "הכפל ערך"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "ערך זה נמצא בסתירה לערך קיים אחר"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "לחצן"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "סמן"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "הקשר"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "קליק"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "פעולה"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "למעלה/למטה"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "אפשרות"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "סדר"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "עדיפות"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "עכבר"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "מתקדם"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "פקודת IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "הכל"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "קוו עזר"
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "קפל עץ"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "מצומצם[+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "פרוש[-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "מספרי שורות"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "טקסט"
#: lazarusidestrconsts.dlgmouseoptnodeselect
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "בחירה"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "פעולה אחרת משתמשת באותו לחצן"
#: lazarusidestrconsts.dlgmouseoptotheracthint
#, fuzzy
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "הם יכולים להתבצע כתלות במקשי השינוי, הגדרות שאריתיות, יחיד/כפול, למעלה/למטה..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "מקשי סינון"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "עדיפות"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "הודעות"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "נפה שגיאות"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "שגיאה"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "טיפ"
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr ""
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "אזהרה"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Multi-caret (column-select) move with cursor"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Multi-caret move with cursor"
msgstr ""
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi caret for column selection"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances
msgid "Multiple Lazarus instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr ""
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr ""
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "בחירה מרובה"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find editor for jump targets"
msgid "Find Editor for Jump Targets"
msgstr "מצא עורך למטרות הקפיצה:"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "סדר השימוש בעורכים המתאימים לאותו קריטריון"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "העורך שמוקד אחרון לקובץ זה"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "עורך (לקובץ) בחלון שמוקד אחרון"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "רשימת עדיפות לקריטריונים לבחירת עורך:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "עמודים וחלונות"
#: lazarusidestrconsts.dlgmultiwintabgroup
#, fuzzy
#| msgid "Notebook Tabs:"
msgid "Notebook Tabs"
msgstr "לשוניות פנקס:"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "מתן שם"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr ""
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "ללא מתן שמות אוטומטי"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr ""
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "ללא הדגשה"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "מקור מיקום לשוניות הפנקס"
#: lazarusidestrconsts.dlgnotsplitlineafter
#, fuzzy
#| msgid "Do not split line after:"
msgid "Do not split line after"
msgstr "אל תחצה את השורה אחרי:"
#: lazarusidestrconsts.dlgnotsplitlinefront
#, fuzzy
#| msgid "Do not split line In front of:"
msgid "Do not split line in front of"
msgstr "אל תחצה את השורה לפני:"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "מפקח עצמים"
#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "גובה הפריט"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "שונות"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "הגדרות מהירות"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "השתמש בהגדרות המחדל של דלפי"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "השתמש בהגדרות המחדל של לזארוס"
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr ""
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr ""
#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgid "Other unit files (-Fu):"
msgstr "קבצי יחידה אחרים (-Fu) (המפריד הוא פסיק):"
#: lazarusidestrconsts.dlgoverwriteblock
#, fuzzy
#| msgid "Overwrite Block"
msgid "Overwrite block"
msgstr "כתוב על הבלוק הקיים"
#: lazarusidestrconsts.dlgoverwritedesktop
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n"
msgstr ""
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "טיפים ללוח הרכיבים"
#: lazarusidestrconsts.dlgpasext
#, fuzzy
#| msgid "Default pascal extension"
msgid "Default Pascal extension"
msgstr "הרחבות ברירת מחדל של פסקל"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "הדגש משפטי בקרה כמילות מפתח"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
#, fuzzy
#| msgid "Extended Pascal keyword options"
msgid "Extended Pascal Keyword Options"
msgstr "פרוש את אפשרויות המקלדת של פסקל"
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr ""
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
#, fuzzy
#| msgid "Pass options to linker (delimiter is space)"
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "העבר אפשרויות למקשר (המפריד הוא רווח)"
#: lazarusidestrconsts.dlgpasstringkeywords
#, fuzzy
#| msgid "Highlight String keyword(s)"
msgid "Highlight \"String\" keyword(s)"
msgstr "הדגש מחרוזת מילת/ות מפתח"
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "ברירת מחדל"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "ללא"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "רק \"מחרוזת\""
#: lazarusidestrconsts.dlgpersistentblock
#, fuzzy
#| msgid "Persistent Block"
msgid "Persistent block"
msgstr "בלוק מתמשך"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "סמן קבוע"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "יישום"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr ""
#: lazarusidestrconsts.dlgpoclearicon
#, fuzzy
#| msgid "Clear Icon"
msgid "&Clear Icon"
msgstr "נקה סמל"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "צור חבילת יישום"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr ""
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr ""
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "טפסים"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr ""
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "סמל:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(גודל: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(ללא)"
#: lazarusidestrconsts.dlgpoloadicon
#, fuzzy
#| msgid "Load Icon"
msgid "&Load Icon"
msgstr "טען סמל"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "שונות"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr ""
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr ""
#: lazarusidestrconsts.dlgposaveicon
#, fuzzy
#| msgid "Save Icon"
msgid "&Save Icon"
msgstr "שמור סמל"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "הפעלה"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "כותרת:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr ""
#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
msgid "Use Application Bundle for running and debugging"
msgstr "השתמש בחבורת היישום להרצה ולניפוי שגיאות (darwin בלבד)"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr ""
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "השתמש בקובץ הרשימות לאפשר ערכות נושא (חלונות בלבד)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr ""
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr ""
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "אפשרויות פרויקט"
#: lazarusidestrconsts.dlgprojectoptionsfor
#, fuzzy,badformat
msgid "Options for Project: %s"
msgstr "אפשרויות לפרוייקט: s%"
#: lazarusidestrconsts.dlgprojfiles
#, fuzzy
#| msgid "Project files"
msgid "Project Files"
msgstr "קבצי הפרויקט"
#: lazarusidestrconsts.dlgpromptonreplace
#, fuzzy
#| msgid "&Prompt On Replace"
msgid "&Prompt on replace"
msgstr "שאל על הח&לפה"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "השלמת תכונות"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "שם התכונה"
#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "פתח את הפרויקט האחרון בהתחלה"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "הראה את ריווחי הגבול"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "הראה רשת"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "הצמד לקווי הרשת"
#: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?"
msgstr ""
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "מקור"
#: lazarusidestrconsts.dlgregularexpressions
#, fuzzy
#| msgid "Regular E&xpressions"
msgid "Regular e&xpressions"
msgstr "ביטוי רגולרי"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr ""
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "החלף הכל"
#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace With"
msgid "&Replace with"
msgstr "&החלף עם"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "דווח"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "קוים מנחים ימין, למטה"
#: lazarusidestrconsts.dlgrightclickselects
#, fuzzy
#| msgid "Right Click selects"
msgid "Right click selects"
msgstr "לחיצה על לחצן ימני בוחרת"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "שוליים ימניים"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "ספרייה נוכחית"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "בחר נכד"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "יצירת סרגל גמיש"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "בחירת סרגל גמיש"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s\n"
msgstr ""
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr ""
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "תצוגה (לא עבור win32, למשל 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "סביבה"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "מקומי"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "משתני מערכת"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "השתמש בצג"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "העמסה של משתמש"
#: lazarusidestrconsts.dlgrunparameters
#, fuzzy
#| msgid "Run parameters"
msgid "Run Parameters"
msgstr "הרץ פרמטרים"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr ""
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "שורה שמורה"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "שמור מידע עורך עבור קבצים סגורים"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr ""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "שמור מידע עורך עבור קבצי הפרוייקט בלבד"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr ""
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "גלול אחד פחות"
#: lazarusidestrconsts.dlgscrollgroupoptions
#, fuzzy
#| msgid "Scrolling:"
msgid "Scrolling"
msgstr "גלילה:"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "הראה טיפים לגלילה"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "גלול עד לסוף הקובץ"
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "סמן אחרי סוף השורה"
#: lazarusidestrconsts.dlgseachdirectorynotfound
#, fuzzy,badformat
msgid "Search directory \"%s\" not found."
msgstr "התקייה המבוקשת \"s%\" לא נמצאה."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "החיפוש בוטל על ידי המשתמש."
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "מחפש ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "נתיבים"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr ""
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr ""
#: lazarusidestrconsts.dlgselectedtext
#, fuzzy
#| msgid "&Selected Text"
msgid "&Selected text"
msgstr "ה&טקסט שנבחר"
#: lazarusidestrconsts.dlgsetactivedesktop
msgid "Set active"
msgstr ""
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "קבע את כל האלמנטים לברירת המחדל"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "קבע אלמנט לברירת המחדל"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "קבע את משתנה התכונות"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr ""
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr ""
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr ""
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of non-visual components"
msgstr ""
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "הראה את הפרוצדורה המהודרת"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "הראה מספרי שורה"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "הראה מותנים"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "הראה מידע ניפוי שגיאות"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr ""
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr ""
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "הראה הכל"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "הראה מידע קובץ ריצה (win32 בלבד)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "הראה מידע כללי"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "הראה טיפים לקווי עזר"
#: lazarusidestrconsts.dlgshowhint
#, fuzzy
#| msgid "Show Hints"
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "הראה טיפים"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr ""
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "הראה מספרי שורה"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr ""
#: lazarusidestrconsts.dlgshownotes
#, fuzzy
#| msgid "Show Notes"
msgid "Show notes"
msgstr "הראה הערות"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "הראה סיכום"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "הראה את קבצי \"נסה\""
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "הראה קבצים שהשתמשו בהם"
#: lazarusidestrconsts.dlgshowwarnings
#, fuzzy
#| msgid "Show Warnings"
msgid "Show warnings"
msgstr "הראה אזהרות"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "הראה לחצן בודד בפס המשימות"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "דלג קדימה בהצהרות המחלקות"
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr ""
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "לשוניות חכמות"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "סמל אחרי (pp.~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "מונה (pp.~)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "סמל לפני (pp.~)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "הצמד לקווים המנחים"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr ""
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr ""
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "רווח"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "טיפים למקשים המהירים העיקריים (פתח, שמור, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "עורך קוד מקור"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "מקור"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr ""
#: lazarusidestrconsts.dlgstatickeyword
#, fuzzy
#| msgid "Static Keyword in Objects"
msgid "Static keyword in objects"
msgstr "מילת מפתח סטטית באובייקט"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "עצור אחרי מספר שגיאות:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr ""
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr ""
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr ""
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr ""
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "תכונות משנה"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "אפשרויות תחביר"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "טאב מזיח בלוקים"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "הראה מספרי לשונית בפנקס"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "הפוך טאבים לרווחים"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "רוחב הטאב"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "משפחת המעבדים שאליה מתאימה התוכנית"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "מערכת ההפעלה שאליה מתאימה התוכנית"
#: lazarusidestrconsts.dlgtargetplatform
#, fuzzy
#| msgid "Target Platform"
msgid "Target platform"
msgstr "מערכת המחשב שאליה מתאימה התוכנית"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "המעבד שאליו מתאימה התוכנית"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr ""
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "תיקייה לבניית פרוייקטים לנסיון"
#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to Find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "טקסט לחיפוש"
#: lazarusidestrconsts.dlgtoggledebugdesktop
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
msgid "Toggle as debug desktop"
msgstr ""
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "פסגה:"
#: lazarusidestrconsts.dlgtrimspacetypecaption
#, fuzzy
#| msgid "Trim Spaces Style"
msgid "Trim spaces style"
msgstr "אופן צמצום רווחים"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "סמן או עריכה"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "שורה שנערכה"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "עזוב את השורה"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "מיקום בלבד"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "צמצם רווחים עוקבים"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "בטל שינויים אחרי שמירה"
#: lazarusidestrconsts.dlgundogroupoptions
#, fuzzy
#| msgid "Undo / Redo:"
msgid "Undo / Redo"
msgstr "בטל/בצע מחדש:"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "בטל גבול"
#: lazarusidestrconsts.dlgunitdepcaption
#, fuzzy
#| msgid "Unit dependencies"
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "תלויות היחידה"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "לרענן"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "התיקייה שאליה כותבת היחידה (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "שורה לא שמורה"
#: lazarusidestrconsts.dlgusecodefolding
#, fuzzy
#| msgid "Code folding"
msgid "Code Folding"
msgstr "קיפול קוד"
#: lazarusidestrconsts.dlgusecustomconfig
#, fuzzy
#| msgid "Use additional Compiler Config File"
msgid "Use additional compiler config file"
msgstr "השתמש בקובץ נוסף של הגדרות המהדר "
#: lazarusidestrconsts.dlgusedividerdraw
#, fuzzy
#| msgid "Divider drawing"
msgid "Divider Drawing"
msgstr "שרטוט מפריד"
#: lazarusidestrconsts.dlgusefpccfg
#, fuzzy
#| msgid "Use standard Compiler Config File (fpc.cfg)"
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "השתמש בקובץ ההגדרות הסטנדרטי של המהדר (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "השתמש ביישום משגר"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr ""
#: lazarusidestrconsts.dlguserschemeerror
#, fuzzy,badformat
msgid "Failed to load user-scheme file %s"
msgstr "נכשל בטעינת קובץ סכמת משתמש s%"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "השתמש (וערוך) בהגדרות סכמה גלובליות"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "השתמש בסכמת הגדרות מקומית"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "השתמש בהדגשת תחביר"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "השתמש בהסטוריית לשוניות בזמן סגירת לשוניות"
#: lazarusidestrconsts.dlguseunitcaption
#, fuzzy
#| msgid "Use a unit from this project"
msgid "Add unit to Uses section"
msgstr "השתמש ביחידה מפרוייקט זה"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "ערך"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "הרחב מידע בזמן הידור:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "קו עזר גלוי"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "שוליים ימניים גלויים"
#: lazarusidestrconsts.dlgwholewordsonly
#, fuzzy
#| msgid "&Whole Words Only"
msgid "&Whole words only"
msgstr "&מילים שלמות בלבד"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "רוחב:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "יישום גרפי ל Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "חלון"
#: lazarusidestrconsts.dlgwinpos
#, fuzzy
#| msgid "Window Positions"
msgid "Window positions"
msgstr "מיקום חלונות"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr ""
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "מילים"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "תצוגה מקדימה"
#: lazarusidestrconsts.dlgwritefpclogo
#, fuzzy
#| msgid "Write an FPC logo"
msgid "Write FPC logo"
msgstr "כתוב לוגו של FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "כמה רכיבים שנבחרו יחד מוכרחים להיות של טופס יחיד"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "מחק את הבחירה"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "ראי אופקי"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "ראי אנכי"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "אחד אחורה"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "אחד קדימה"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "לך לאחור"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "לך לחזית"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr ""
#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as XML"
msgid "Save Form as XML"
msgstr "שמור טופס כ XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "קנה מידה"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "בחר הכל"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "גודל"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "אפשרות: הצמד לרשת"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "אפשרות: הצמד לקווים המנחים"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "סדר - יורד"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "בשני הצדדים"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "לא = 0, שרטט קווי חלוקה רק עבור הרמה העליונה = 1, שרטט קווים לשתי הרמות הראשונות - 2, ..."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "הוסף קבצים"
#: lazarusidestrconsts.lisa2paddfilestopackage
#, fuzzy
#| msgid "Add files to package"
msgid "Add Files to Package"
msgstr "הוסף קבצים לחבילה"
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "הוסף לחבילה"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "טיפוס הירוש הוא רב משמעי"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "שם המחלקה רב משמעי"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "שם יחידה רב משמעי"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "סוג קדום"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "תלויות שבורות"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "שם מחלקה כבר קיים"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr ""
#: lazarusidestrconsts.lisa2pcreatenewfile
#, fuzzy
#| msgid "Create new file"
msgid "Create New File"
msgstr "צור קובץ חדש"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr ""
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "תלות"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "הקובץ כבר קיים"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr ""
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "קובץ בשימוש"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "שם קובץ"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "הקובץ אינו יחידה"
#: lazarusidestrconsts.lisa2piconandsize
msgid "Icon (maximum 24x24):"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "סוג קדום לא מוכר"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr ""
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "שם מחלקה שגוי"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "קובץ שגוי"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "שם קובץ שגוי"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "שם יחידה שגוי"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, fuzzy,badformat
#| msgid "%s%s%s is not a valid unit name."
msgid "\"%s\" is not a valid unit name."
msgstr "%s%s%s אינו שם תקין ליחידה."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "שם המחלקה החדשה:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "רכיב חדש"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "קובץ חדש"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, fuzzy,badformat
#| msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "לא נמצאה חבילה עבור התלות s%.s%s%s%. בחר חבילה קיימת."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr ""
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "שם הדף ארוך מידי"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "עמוד לוח:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "דו-שיח שמירת קובץ"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "כווץ או הארך שם קובץ"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "הצג הכל"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "החלף נתיבים"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, fuzzy,badformat
#| msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "לסוג הקדום s%s%s% יש אותו שם כמו ליחידה s%s%s%."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, fuzzy,badformat
#| msgid "The ancestor type %s%s%s is not a valid Pascal identifier."
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "הסוג הקדום s%s%s% אינו מזהה חוקי של פסקל"
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, fuzzy
#| msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "הסוג הקדום s%s%s% ושם המחלקה s%s%s% זהים"
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, fuzzy,badformat
#| msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "שם המחלקה s%s%s% כבר קיים בחבילה s%s% בקובץ: s%s%s%"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, fuzzy,badformat
#| msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "שם המחלקה s%s%s% זהה ליחידה s%s%s%."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, fuzzy,badformat
#| msgid "The class name %s%s%s is not a valid Pascal identifier."
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "שם המחלקה s%s%s% אינו מזהה חוקי של פסקל."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, fuzzy
#| msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "הקובץ s%s%s% הוא חלק מהפרוייקט הנוכחי. זה רעיון גרוע לשתף קבצים בין פרוייקטים וחבילות."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, fuzzy
#| msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "שם הקובץ s%s%s% הוא רב משמעי, בגלל שלחבילה אין עדיין תיקיית ברירת מחדל. ציין שם קובץ עם הנתיב המלא."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
#, fuzzy,badformat
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "הגרסה המרבית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "הגרסה המקסימאלית נמוכה מהגרסה המינימאלית."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
#, fuzzy,badformat
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "הגרסה המינימלית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, fuzzy,badformat
#| msgid "The package already has a dependency on the package %s%s%s."
msgid "The package already has a dependency on the package \"%s\"."
msgstr "לחבילה יש כבר תלות בחבילה s%s%s%."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, fuzzy,badformat
#| msgid "The page name %s%s%s is too long (max 100 chars)."
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "שם העמוד s%s%s% ארוך מדי (עד 100 תוים)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, fuzzy,badformat
#| msgid "The unitname %s%s%s already exists in the package:%s%s"
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "שם היחידה s%s%s% כבר קיים בחבילה: s%s%"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, fuzzy,badformat
#| msgid "The unitname %s%s%s already exists in this package."
msgid "The unitname \"%s\" already exists in this package."
msgstr "שם הקובץ s%s%s% כבר קיים בחבילה."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, fuzzy,badformat
#| msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "שם היחידה s%s%s% ושם הקובץ s%s%s% שונים."
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
#, fuzzy,badformat
#| msgid "The unit name %s%s%s does not correspond to the filename."
msgid "The unit name \"%s\" does not correspond to the filename."
msgstr "שם היחידה s%s%s% לא מתאים לשם הקובץ."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy
#| msgid "The unit name %s%s%s is the same as a registered component.%sUsing this can cause strange error messages."
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "שם היחידה s%s%s% הוא שם של רכיב רשום. השמוש בו עלול לגרום להודעות שגיאה מוזרות."
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "שם קובץ היחידה:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "שם היחידה:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "שם היחידה כבר קיים"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "שם היחידה שגוי"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "לזנוח שינויים ?"
#: lazarusidestrconsts.lisabort
#, fuzzy
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "בטל"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "בטל הכל"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "בטל את כל הטעינות"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr ""
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "בטל את טעינת הפרויקט"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "בטל את כל הטעינה"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr ""
#: lazarusidestrconsts.lisabout2
msgid "About %s"
msgstr ""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "תיעוד:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "אודות IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "אודות לזרוס"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy,badformat
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "רשיון: GPL/GPL%s לזארוס הוא IDE ליצירת יישומים (גרפיים או למסוף) בשפת free pascal. free pascal היא מהדר פסקל ופסקל מונחה עצמים ברשיון GPL/LGPL שרץ על חלונות, ליבוקס, מאק - גרסה 10, FreeBSD ועוד. לזארוס הוא החלק החסר בפאזל שמאפשר לך לפתח תוכנות לכל מערכות ההפעלה האלו בסביבה דמויית דלפי. ה IDE הוא כלי RAD הכולל מעצב טפסים. ככל שלזארוס גדלה אנו זקוקים ליותר מפתחים.ראה במקורות של לזארוס ו Free Pascal את פרטי הרשיון."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "לא יכול למצוא את רשימת התורמים."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "רשמי:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, fuzzy,badformat
#| msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr "ה s% אינו יכול להכיל TControls. אתה יכול לשים עליו רק רכיבים בלתי נראים."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "הכרה"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "פעולה:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "פעולות:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr ""
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "הפעל תחביר של ביטויים רגולרים עבור טקסט והחלפה (דומה לפרל)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr ""
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "פעיל"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "מסנן פעיל"
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "הוסף"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr ""
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr ""
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr ""
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr ""
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr ""
#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr ""
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr ""
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr ""
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr ""
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr ""
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr ""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "הוספת אופן בנייה, מעתיק הגדרות מ \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "הוסף מאקרו חדש"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "הוסף קבוצה חדשה"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "הוסף דרישות חבילה?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr ""
#: lazarusidestrconsts.lisaddpackagetoproject
#, fuzzy,badformat
msgid "Add package %s to project?"
msgstr "הוסף חבילה s% לפרוייקט?"
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "הוסף חבילה לפרוייקט"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "הוסף סוגריים של פרמטר"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "להוסיף את %s לפרויקט ?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr ""
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "הוסף ממשקי יחידה"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "הוסף יחידה (לא מומלץ)"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "הוסף ערך למאקרו %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
#, fuzzy
#| msgid "Add file to a package"
msgid "Add File to Package"
msgstr "הוסף קובץ לחבילה"
#: lazarusidestrconsts.lisaf2pdestinationpackage
#, fuzzy
#| msgid "Destination Package"
msgid "Destination package"
msgstr "חבילת היעד"
#: lazarusidestrconsts.lisaf2pfiletype
#, fuzzy
#| msgid "File Type"
msgid "File type"
msgstr "סוג הקובץ"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "חבילה שגויה"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, fuzzy,badformat
#| msgid "Invalid package ID: %s%s%s"
msgid "Invalid package ID: \"%s\""
msgstr "זהוי חבילה שגוי: s%s%s%"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "החבילה היא לקריאה בלבד"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, fuzzy,badformat
#| msgid "Package %s%s%s not found."
msgid "Package \"%s\" not found."
msgstr "החבילה %s%s%s לא נמצאה."
#: lazarusidestrconsts.lisaf2pshowall
#, fuzzy
#| msgid "Show All"
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "הצג הכל"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, fuzzy,badformat
msgid "The package %s is read only."
msgstr "החבילה s% היא לקריאה בלבד."
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
#, fuzzy,badformat
#| msgid "A file %s%s%s already exists.%sReplace it?"
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "הקובץ %s%s%s כבר קיים.%sהאם להחליפו?"
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
msgid "A filter with the name \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr ""
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "יישור"
#: lazarusidestrconsts.lisallblockslooksok
#, fuzzy
#| msgid "All blocks looks ok."
msgid "All blocks look ok."
msgstr "כל הבלוקים נראים תקינים."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr ""
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "כל האפשרויות שעברו בהורשה"
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr ""
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "אפשר קריאות של פונקציות"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "אפשר חיפוש בשורות מרובות"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, fuzzy,badformat
#| msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "כל השינויים שלך של %s%s%s%sיאבדו והקובץ יפתח מחדש."
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr ""
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "מקש חלופי"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "מקש חלופי (או רצף של 2 מקשים)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "תמיד"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr ""
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr ""
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "התעלם תמיד"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr ""
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "קובץ רב משמעי נמצא"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, fuzzy,badformat
#| msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "נמצא קובץ רב משמעי: s%s%s% יכול להיות שהוא נלקח בטעות במקום s%s%s%s%s%. האם למחוק אותו?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "נמצא קובץ רב משמעי"
#: lazarusidestrconsts.lisambiguousunitfound
#, fuzzy
#| msgid "Ambiguous Unit found"
msgid "Ambiguous unit found"
msgstr "נמצאה יחידה רב משמעית"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "עגן עורך - לא נבחרו פקדים"
#: lazarusidestrconsts.lisanchorenabledhint
#, fuzzy,badformat
msgid "Enabled = Include %s in Anchors"
msgstr "אפשר = כלול s% בעוגנים"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanchorsof
msgid "Anchors of %s"
msgstr ""
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "עיגון של הפקדים שנבחרו"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
#, fuzzy
#| msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "ארעה שגיאה באיתחול האחרון בזמן טעינת s!%s%s%. האם לטעון את הפרוייקט שוב?"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "שם המחלקה של היישום"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr ""
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "יישם"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "השתמש בדגלי בניה (B-) גם לתלויות"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "יישם את ההסכמות"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "יחידה של פרוייקט אינה יכולה לשמש לפרוייקט או חבילה אחרים"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "רווח מסביב לפקד. שאר ארבעת הרווחים מתוספים אליו."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "שאל לפני החלפה של כל מופע של הטקסט שנמצא"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr ""
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
#, fuzzy
#| msgid "Ask for component name after putting it on a designer form"
msgid "Ask for component name after putting it on a designer form."
msgstr "בקש את שם הרכיב אחרי שתכניס אותו לטופס המעצב"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "בקש את שם הקובץ בפתיחת קובץ חדש"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "בקש שם ב יצירה"
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr ""
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr ""
#: lazarusidestrconsts.lisautocheckmodifiedfiles
msgid "Automatically check (select) modified files"
msgstr ""
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "השלמה אוטומטית: כבה"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "השלמה אוטומטית: הדלק"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "המשך אוטומטית אחרי:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "אוטומטי"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "הפעל אוטומטית אחרי נקודה"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "שבירת שורה"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "רווח"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "סוף מילה"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "אל תוסיף תו"
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr ""
#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "תכונות אוטומטיות"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "הצגה אוטומטית"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr ""
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr ""
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "צור גיבוי לקבצים ששונו"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "קובץ הגיבוי נכשל"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "יוצר תיקיית גיבוי בתוך תיקיית הפרוייקט"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "שינוי שם חבילה או גרסה שובר את התלויות. האם לשנות את התלויות בנוסף?%sבחר \"כן\" לשנות את כל התלויות הרשומות.%sבחר \"התעלם\" לשבור את התלויות ולהמשיך."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "מתחיל"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "מאחורי הקשורים"
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr ""
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr ""
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr ""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
#, fuzzy
#| msgid "Always Build before Run"
msgid "Always build before run"
msgstr "תמיד בנה לפני ריצה"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "פקודת בנייה"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "בצע בניית קובץ במקום בניית פרוייקט"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "בצע הרצת קובץ במקום הרצת פרוייקט"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "הרץ פקודה"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
#, fuzzy
#| msgid "When this file is active in source editor ..."
msgid "When this file is active in source editor"
msgstr "כאשר קובץ זה פעיל בעורך הקוד ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
#, fuzzy
#| msgid "Working directory (Leave empty for file path)"
msgid "Working directory (leave empty for file path)"
msgstr "ספריית עבודה (השאר ריק לנתיב הקובץ)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "הדגש (bold) ערכים שאינם ברירת מחדל"
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "מרווח גבול"
#: lazarusidestrconsts.lisbottom
#, fuzzy
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "תחתית"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "רווח תחתון. רווח זה מתווסף לרווח הבסיסי של הפקד."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "עיגון לתחתית"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "תחתיות"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "זהו פקד \"אח\" אליו מוצמד הצד התחתון. השאר ריק בשביל הורה."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "רווח שווה בתחתית"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "שבור"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "תכונות נקודת עצירה"
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "הו&סף"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "ס&גור"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "מ&חק"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr ""
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "החלף&"
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "מאופשר"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "חפש"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "צא"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "הס&ר"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "החלף"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "בנה"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "בנה את כל הקבצים של פרוייקט/חבילה/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "בנה"
#: lazarusidestrconsts.lisbuildfollowingmodes
msgid "Build the following modes"
msgstr ""
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "בנה את ה IDE עם חבילות"
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "בניית לזארוס נכשלה"
#: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "הבדלים בין אופני בניה"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
#, fuzzy
#| msgid "Differences to other build modes"
msgid "Differences from other build modes"
msgstr "הבדלים מאופני בנייה אחרים"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "אופן:"
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "אופני בנייה"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "בנה פרויקט חדש"
#: lazarusidestrconsts.lisbuildnumber
#, fuzzy
#| msgid "Build Number"
msgid "Build number"
msgstr "מספר הבניה"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "בנה"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr ""
#: lazarusidestrconsts.lisbyte
msgid "%s byte"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
#, fuzzy,badformat
msgid "Calling %s to create Makefile from %s failed."
msgstr "קריאת s% ליצירת makefile מ s% נכשלה."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "בטל"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "בטל טעינת הרכיב"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "בטל את טעינת היחידה"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "בטל את שינוי השם"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "לא יכול להדר את הפרוייקט"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
#, fuzzy
#| msgid "Can not copy top level component."
msgid "Cannot copy top level component."
msgstr "לא יכול להעתיק רכיב של הרמה העליונה."
#: lazarusidestrconsts.liscannotcreatefile
#, fuzzy,badformat
#| msgid "Cannot create file %s%s%s"
msgid "Cannot create file \"%s\""
msgstr "לא יכול לצור את הקובץ s%s%s%"
#: lazarusidestrconsts.liscannotexecute
msgid "cannot execute \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfind
msgid "Cannot find %s"
msgstr ""
#: lazarusidestrconsts.liscannotfindexecutable
msgid "cannot find executable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, fuzzy,badformat
#| msgid "Cannot find lazarus starter:%s%s"
msgid "Cannot find Lazarus starter:%s%s"
msgstr "לא יכול למצוא את מאתחל לזארוס: s%s%"
#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr ""
#: lazarusidestrconsts.liscannotopenform
msgid "Cannot open form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsaveform
msgid "Cannot save form \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannotsubstitutemacros
msgid "Cannot substitute macro \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr ""
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "יכול רק לשנות את המחלקה של TCcomponent.."
#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr ""
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr ""
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "שנה את המחלקה של %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "אין מחלקה"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "המהדר רב משמעי"
#: lazarusidestrconsts.lisccochecktestdir
#, fuzzy
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "אנא בדוק את ספריית הבדיקות תחת %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
#: lazarusidestrconsts.lisccocompilernotanexe
#, fuzzy,badformat
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "המהדר s% אינו קובץ ריצה. s% פרטים: s%"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "מכיל"
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "העתק פלט ללוח הגזירים"
#: lazarusidestrconsts.lisccodatesdiffer
#, fuzzy,badformat
#| msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "הזמנים של קבצי ppu. של FPC שונים ביותר משעה. יכול להיות שזה אומר שהם שייכים לשתי התקנות שונות. קובץ 1:s%s% קובץ 2 s%"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "שגיאה"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "שגיאה:"
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "נתיב יחידה של FPC מכיל מקור:"
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "סמלי שורה חדשים"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "טיפ:"
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "מהדר שגוי"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "נתיב חיפוש שגוי"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "ספריית בדיקות שגויה"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "יחידה חסרה"
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "לא נמצאה היחידה המהודרת של FPC: %s.ppu"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "נמצאו מספר קבצי הגדרה למהדר"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "לא נמצא הקובץ fpc.cfg"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "לא ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "קובץ ה ppu קיים פעמיים: %s, %s"
#: lazarusidestrconsts.lisccoppunotfounddetailed
#, fuzzy,badformat
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "היחידה s%.ppu המהודרת של FPC לא נמצאה. בדרך כלל זה אומר שיש באג בקובץ fpc.cfg, או שההתקנה של FPC שבורה."
#: lazarusidestrconsts.lisccoppuolderthancompiler
#, fuzzy,badformat
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "יש קובץ ppu. ישן יותר מהמהדר עצמו:s%s%"
#: lazarusidestrconsts.lisccoseveralcompilers
#, fuzzy,badformat
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "יש כמה מהדרי fpc בנתיב שלך.s%s%s% אולי שכחת למחוק מהדר ישן?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "דלג"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "תווים מיוחדים"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "כל הבדיקות צלחו."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "לא ניתן ליצור קובץ בדיקה"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, fuzzy
#| msgid "Unable to create Test pascal file \"%s\"."
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "לא ניתן ליצור את קובץ הבדיקה לפסקל \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "תוווים מיוחדים"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "אזהרה"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "אזהרה:"
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "מפריד הנתיב שגוי"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "קטגוריות"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "סיבוכיות"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "קבועים"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "בלוקים ריקים"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "קטעי מחלקות ריקים"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "הגדרת יוצרים ריקה"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "פרוצדורות ריקות"
#: lazarusidestrconsts.liscefilter
#, fuzzy
#| msgid "(Filter)"
msgid "(filter)"
msgstr "(סנן)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "עקוב אחר סמן העכבר"
#: lazarusidestrconsts.liscein
msgid "%s in %s"
msgstr "%s ב %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "הוא בשליטה של ה root"
#: lazarusidestrconsts.liscelongparamlistcount
#, fuzzy
#| msgid "Parameters count treating as \"many\""
msgid "Parameters count treated as \"many\""
msgstr "מספר הפרמטרים מטופל כ many"
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "פרוצדורות ארוכות"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "מספר שורות הפרוצדורה מטופל כ long"
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "פרוצדורות מקוננות רבות"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "פרמטרים רבים"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "הצג קטגוריות"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "הראה צמתי קוד המקור"
#: lazarusidestrconsts.liscenestedproccount
#, fuzzy
#| msgid "Nested procedures count treating as \"many\""
msgid "Nested procedures count treated as \"many\""
msgstr "מספר הפרוצדורות המקוננות מטופל כ many"
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr ""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
#, fuzzy
#| msgid "Center control horizontally relative to the given sibling"
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "מרכז את הפקד בצורה אופקית יחסית לאח שנבחר"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
#, fuzzy
#| msgid "Center control vertically relative to the given sibling"
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "מרכז את הפקד בצורה אנכית יחסית לאח שנבחר"
#: lazarusidestrconsts.liscenterform
#, fuzzy
#| msgid "Center form"
msgid "Center Form"
msgstr "מרכז טופס"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "מרכז בחלון"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "מרכז"
#: lazarusidestrconsts.lisceomode
#, fuzzy
#| msgid "Preferred Exhibition Mode"
msgid "Preferred exhibition mode"
msgstr "תצורת החשיפה הרצויה"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "קטגוריה"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "מקור"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "לעולם לא, רק ידני"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "נמצא בשימוש רק במצב של קטגוריות"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "בהמתנה"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "ריענון אוטומטי"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "אחר"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "עדכן"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "כאשר מחליפים קובץ בעורך הקוד"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "פרוצדורות"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "תכונות"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "תכונות שפורסמו ללא ברירת מחדל"
#: lazarusidestrconsts.lisceshowcodeobserver
#, fuzzy
#| msgid "Show observerations about"
msgid "Show observations about"
msgstr "הראה תצפית על"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "סגנון"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "לעשות"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "סוגים"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "קבועים ללא שם"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "חברים לא מסודרים"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "תצוגה לא מסודרת"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "משתמש ב"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "משתנים"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "הזחה שגויה"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "קרתה חריגה בזמן הסרת %s\"%s:%s\"%s%s"
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "בטל טעינת משאב זה"
#: lazarusidestrconsts.liscfeclassnotfound
#, fuzzy,badformat
msgid "%s%sClass \"%s\" not found."
msgstr "המחלקה \"%s\" לא נמצאה."
#: lazarusidestrconsts.liscfecomponent
#, fuzzy,badformat
msgid "%s%sComponent: %s:%s"
msgstr "רכיב: %s:%s"
#: lazarusidestrconsts.liscfecomponentclass
#, fuzzy,badformat
msgid "%s%sComponent Class: %s"
msgstr "מחלקת רכיבים: %s"
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "ממשיך בטעינה"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "לא יודע איך להעתיק את עריכת הטפסים הנבחרת"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "לא יודע איך לגזור את עריכת הטפסים הנבחרת"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "לא יודע איך למחוק את עריכת הטפסים הנבחרת"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "שגיאה ביצירת רכיב"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "שגיאה ביצירת רכיב: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "שגיאה בהריסת רכיב"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "שגיאה בהריסת רכיב מסוג %s של יחידה %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "שגיאה בהריסת מתווך"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "שגיאה בהריסת מתווך %s של יחידה %s:%s%s"
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "שגיאה בקריאת %s"
#: lazarusidestrconsts.liscfeinfile
#, fuzzy,badformat
#| msgid "%sIn file %s%s"
msgid "In file %s"
msgstr "בקובץ %s%s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "הבעלים של הרכיב אינו חוקי"
#: lazarusidestrconsts.liscferoot
#, fuzzy,badformat
msgid "%sRoot=%s:%s"
msgstr "רוט= %s:%s"
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "עצור את כל הטעינות"
#: lazarusidestrconsts.liscfestream
#, fuzzy,badformat
msgid "%sStream=%s"
msgstr "זרם= %s"
#: lazarusidestrconsts.liscfestreamposition
#, fuzzy,badformat
msgid "%s%sStream position: %s"
msgstr "מיקום הזרם: %s"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "כבר קיים TCustomFormEditor.CreateNonFormForm"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, fuzzy,badformat
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "סוג לא ידוע TCustomFormEditor.CreateNonFormForm"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, fuzzy,badformat
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "כבר רשום: TCustomFormEditor.RegisterDesignerMediator"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "עורך הרכיבים של המחלקה \"%s\" גרם לשגיאה: %s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "הרכיב מסוג %s נכשל בקביעת הבעלים להיות %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, fuzzy,badformat
msgid "Unable to clear the form editing selection%s%s"
msgstr "לא יכול לנקות את בחירת עורך הטפסים"
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "שנה"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "שנה את אופן הבנייה"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "שנה את המחלקה"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr ""
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "שנה קידוד"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "שנה קובץ"
#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change Parent..."
msgid "Change Parent"
msgstr "שנה הורה..."
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr ""
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "תו"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "מפת תווים"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr ""
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr ""
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ""
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ""
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
#, fuzzy
#| msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\""
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "בדוק אם הסימן הבא בקוד הוא הוא :סוף\" ואם לא החזר linend +end; "
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "בדוק אפשרויות"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ""
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, fuzzy,badformat
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "בדוק את היעד (OS, CPU, LCL widget type). יתכן שתצטרך להדר את החבילה מחדש עבור יעד זה או לקבוע יעד אחר לפרוייקט."
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr ""
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "בחר בשם אחר"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr ""
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "בחר קישור ל FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "בחר מקשר ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr ""
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr ""
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr ""
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
#, fuzzy
#| msgid "Choose a pascal file for indentation examples"
msgid "Choose a Pascal file for indentation examples"
msgstr "בחר קובץ פסקל עבור דוגמאות זיהוי"
#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr ""
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "בחר קובץ להודעות מהדר"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr ""
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "בחר חבילת דלפי (dpk.*)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "בחר פרוייקט דלפי חדש (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "בחר יחידת דלפי (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "בחר ספרייה"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr ""
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "בחר את ספריית קוד המקור של FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "בחר את ספריית לזרוס"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr ""
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "בחר שם"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "בחר את אחד מהפריטים ליצירת קובץ חדש"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "בחר את אחד מהפריטים ליצירת חבילה חדשה"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "בחר אחד מהפריטים ליצירת פרויקט חדש"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "בחר את אחד הפריטים בשביל לרשת מפריט קיים"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "בחר בקוד המקור של התוכנה (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "בחר מבנה נתונים לעטיפת הבחירה"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "בחר את התיקיה עבור בדיקות"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr ""
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "השלמת מחלקה"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "המחלקה והתכונות קיימות. הערכים לא בדוקים."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, fuzzy
#| msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "המחלקה s%s%s% אינה מחלקה רשומה. לא מצליח להדביק."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "המחלקה לא נמצאה"
#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr ""
#: lazarusidestrconsts.lisclassofmethodnotfound
#, fuzzy
#| msgid "Class %s%s%s of method %s%s%s not found."
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "המחלקה s%s%s% של מתודה s%s%s% לא נמצאה."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr ""
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "נקה ספרייה"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "נקה את תתי הספריות"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "שמור את כל קבצי הטקסט"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "שמור קבצים המתאימים למסנן"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "מחק קבצים המתאימים למסנן"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "תחביר פשוט (כלומר * במקום .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr ""
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "נקה את קוד המקור של לזרוס"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr ""
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "האם לנקות את נתיב היחידה?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "נקה"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "האם לנקות את הספרייה?"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr ""
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "לחץ כאן בשביל לצפות בקובץ"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr ""
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr ""
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr ""
#: lazarusidestrconsts.lisclose
#, fuzzy
#| msgid "&Close"
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "ס&גור"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "סגור הכל"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr ""
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "סגור קבצים"
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "הסתר חלון"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "סוגר את חלון עורך הקוד. האם אתה מעוניין לסגור את כל הקבצים או להחביא את החלון ?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "סגור את חלון עורך הקוד"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "אפשרויות ספציפיות עבור ממשקי LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "פרמטר"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "רכיבים"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "ירושה"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "רשימה"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "לוח"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr ""
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr ""
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "קובץ הגדרות המהדר שנוסף אינו חד משמעי"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "קרא ל:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, fuzzy,badformat
#| msgid "%s%sClick OK if you are sure to do that."
msgid "%s%sClick OK if you definitely want to do that."
msgstr "לחץ על OK אם אתה בטוח שברצונך לעשות זאת."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "פקודה:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "קוד"
#: lazarusidestrconsts.liscodebrowser
#, fuzzy
#| msgid "Code browser"
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "דפדפן הקוד"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr ""
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "אפשרויות יצירת קוד"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "הוסף נתיב"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "דפדף"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "אשר החלפה"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "צור פריט עזרה"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "הסר נתיב"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "תאור"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "שגיאות"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "דוגמה"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr ""
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "הכנס תגית של טקסט מודגש"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "הכנס תגית של קוד"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "הכנס תגית של טקסט נטוי"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "הכנס תגית של הערה"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "הכנס תגית של טקסט עם קו תחתון"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "הכנס תגית של משתנה"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "מורש"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "הוסף קישור ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "הכנס תגית של סעיף"
#: lazarusidestrconsts.liscodehelpmainformcaption
#, fuzzy
#| msgid "FPDoc editor"
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "עורך FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(לא נמצא תאור מורש)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<ללא>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "ראה גם"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "תאור קצר של"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "קצר"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "התעלם מקבועים בפונקציות הבאות"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "חפש קבועים מסוג תו ללא שם"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "צופה הקוד"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "התעלם מהקבועים חסרי השם הבאים"
#: lazarusidestrconsts.liscodetempladd
#, fuzzy
#| msgid "Add"
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "הוסף"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "הוסף תבנית קוד"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
#, fuzzy,badformat
#| msgid " A token %s%s%s already exists! "
msgid " A token \"%s\" already exists! "
msgstr "סמל s%s%s% כבר קיים!"
#: lazarusidestrconsts.liscodetemplautocompleteon
#, fuzzy
#| msgid "Auto complete on ..."
msgid "Auto complete on"
msgstr "השלמה אוטומטית ב"
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "שנה"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "הערה"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "ערוך תבנית קוד"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "שגיאה"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "סמל:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "פעולה: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, fuzzy,badformat
#| msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "אי אםשר לערוך צמתים שנוצרו אוטומטית, ולא יכול להיות שיש להן צמתים בנות, שלא נוצרו אוטומטית."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, fuzzy,badformat
msgid "%s, auto generated"
msgstr "נוצר אוטומטית"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
#, fuzzy
#| msgid "Auto generated nodes can not be edited."
msgid "Auto generated nodes cannot be edited."
msgstr "אי אםשר לערוך צמתים שנוצרו אוטומטית,"
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "בלוק"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "הגדרת עורכים ע\"י CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "נתיב המהדר"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "המר צומת"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, fuzzy,badformat
msgid "Create Defines for %s Directory"
msgstr "צור מגדירים לתקיית s%"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "צור מגדירים למהדר fpc"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "צור מגדירים למקורות SVN של מהדר fpc"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, fuzzy,badformat
msgid "Create Defines for %s Project"
msgstr "צור מגדירים לפרוייקט s%"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "צור מאקרו ונתיבים של fpc עבור תקיית פרוייקט fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "הגדר"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "הגדר משאב"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "מחק צומת"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד. למשל: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד, אשר בשמוש בפרוייקט זה. למשל: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "תאור:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "ספרייה %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "אחרת"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "אחרת אם"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "צא בלי לשמור"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "תיקיית הקוד של FPC SVN"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "אם "
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "אם מוגדר"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "אם לא מוגדר"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "תיקייה"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "הכנס תבנית של המהדר fpc"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "הכנס תבנית של פרוייקט fpc"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "הכנס תבנית קוד של FPC SVN"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "הכנס תבנית של המהדר 3 Kylix"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "הכנס תבנית של תיקיית 3 Kylix"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "הכנס תבנית של פרוייקט 3 Kylix"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "הכנס צומת כצומת בת"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "הכנס צומת מתחת"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "הכנס תבנית"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "הורה פגום"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "צומת הורה פגומה"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "צומת קודמת פגומה"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד. למשל: home/user/kylix%s/"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד, אשר בשמוש בפרוייקט זה. למשל: home/user/kylix%s/"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "הזז צומת למטה"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "הזז צומת רמה אחת למטה"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "הזז צומת רמה אחת למעלה"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "הזז צומת למעלה"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "שם:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "צומת חדשה"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "הצומת במצב של קריאה בלבד"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "ללא בחירה"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
#, fuzzy
#| msgid "Parent node can not contain child nodes."
msgid "Parent node cannot contain child nodes."
msgstr " צומת אם לא יכולה להכיל צמתי בנות"
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "הצומת הקודמת אינה יכולה להכיל צמתים בתור ילדים"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "תיקיית הפרוייקט"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, fuzzy,badformat
msgid "%s project directory"
msgstr "תיקיית הפרוייקט s%"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "שגיאת קריאה"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "שמור וצא"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "צומת נבחרת:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "תיקיית קוד המקור של FPC SVN. לא נדרשת. זה ישפר את ניפוי השגיאות ואת חיפוש ההצהרות."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "תיקיית הפרוייקטים של fpc."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "תיקיית קוד המקור של FPC SVN."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy,badformat
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "הנתיב למהדר fpc. למשל/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s/."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "הנתיב למהדר fpc עבור פרוייקט זה. דרוש רק אם הגדרת את קבצי קוד המקור של FPC SVN שלהלן. משמש ליצירה אוטומטית של מאקרו."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, fuzzy,badformat
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "תיקיית הפרוייקט s%, שמכילה את קבצי dpr .dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "בטל הגדרה"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "בטל את כל ההגדרות"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "בטל הגדרת משאב"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "ערך כנתיבי קובץ"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "ערך כטקסט"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "משתנה:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "שגיאת כתיבה"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "ב"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "סוגרים"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr ""
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "נקודותיים"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "פסיק"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "מזהה"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "מלת מפתח"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "שורה חדשה"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "ללא"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "מספר"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "נקודה"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "נקודה פסיק"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "רווח"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "קבוע מסוג מחרוזת"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "סמל"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "בצע אחרי"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "בצע לפני"
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr ""
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr ""
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr ""
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "צמצם את כל המחלקות"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "צמצם את כל החבילות"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "צמצם את כל היחידות"
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr ""
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr ""
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "פקודה אחרי"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "פקודה שאחרי לא חוקית"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "פקודה אחרי פרסום מודול"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "פרמטרים של שורת הפקודה"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "פרמטרים של שורת הפקודה של התוכנה"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "הדר"
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr ""
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "מהדר"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "מהדר \"%s\" לא תומך ביעד %s-%s"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, fuzzy,badformat
msgid "Error: invalid compiler: %s"
msgstr "שגיאה: מהדר s% לא חוקי"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "שם הקובץ של המהדר"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "טיפ: אתה יכול להגדיר את נתיב המהדר ב Environment->Environment options->Files->Compiler Path"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr ""
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "הערה: קובץ ההגדרה של CodeTools לא נמצא - משתמש בברירת המחדל"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "הערה: טוען את קובץ אפשרויות CodeTools הישן"
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "הדר"
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr ""
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (מהדר ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "הראה טיפים לשורה ארוכה"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "הרחב לקצה השמאלי"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "הרחב קצת שמאלה"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "אף פעם"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "הרחב ימינה בלבד"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
#, fuzzy
#| msgid "Component name \"%s\" is a pascal keyword."
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "שם הרכיב \"%s\" הוא מילת מפתח של פסקל"
#: lazarusidestrconsts.liscomponentnameiskeyword
#, fuzzy,badformat
#| msgid "Component name %s%s%s is keyword"
msgid "Component name \"%s\" is keyword"
msgstr "שם הרכיב s%s%s% הוא מלת מפתח"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
#, fuzzy,badformat
#| msgid "Component name %s%s%s is not a valid identifier"
msgid "Component name \"%s\" is not a valid identifier"
msgstr "שם הרכיב s%s%s% אינו מזהה חוקי"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr ""
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "פתח חבילה"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "פתח יחידה"
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "בדוק"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "מצב"
#: lazarusidestrconsts.lisconditionals
#, fuzzy
#| msgid "Conditionals:"
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "התניות"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "ספריית הגדרות לזרוס"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr ""
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "מגדיר את הבנייה של %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
#, fuzzy
#| msgid "Configure %sBuild Lazarus%s"
msgid "Configure \"Build Lazarus\""
msgstr "הגדר ובנה את לזארוס"
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr ""
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr ""
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr ""
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr ""
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "לזארוס ייבנה עם הפרופיל הבא:%s להמשיך?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "אשר שינויים"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "וודא מחיקה"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy,badformat
#| msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "האם ברצונך לבנות מחדש את לזרוס?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "אשר חבילה חדשה עבור הIDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "פעולה"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "קבוצת חבילות חדשה"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "קבוצת חבילות ישנה"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr ""
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr ""
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "יישום מסוף"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr ""
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "קוד הפונקציה הבונה"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "מכיל"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "תלוי בהקשר"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "המשך"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "המשך ואל תשאל שוב"
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "המשך ללא טעינת הטופס"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "תורמים"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "הפקד חייב הורה"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr ""
#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr ""
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr ""
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr ""
#: lazarusidestrconsts.lisconvconvertedfrom
msgid " { *Converted from %s* }"
msgstr ""
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "התווסף אופסט לקואורדינטה העליונה של פקדים בתוך המיכלים הנראים"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "אופסט לקואורדינטות"
#: lazarusidestrconsts.lisconvdeletedfile
msgid "Deleted file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
msgid "Added unit \"%s\" to uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "כל תתי התיקיות ייסרקו למציאת קבצי יחידות"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "נכשל BeginCodeTools"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "קטגוריות:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "ההמרה נפסקה"
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "ההמרה מוכנה"
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "המר חבילת דלפי"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "המר פרוייקט דלפי"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "המר יחידת דלפי"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "שגיאה=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "לא הצליח להמיר יחידה "
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, fuzzy,badformat
#| msgid "Failed to convert unit%s%s%s"
msgid "Failed to convert unit \"%s\""
msgstr "לא הצליח להמיר יחידה %s%s%s"
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "תוקנה ראשיות התוים ביחידה \"%s\" ל \"%s\"."
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "פונקציית דלפי"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "חסר קובץ \"כלול\" %s(%s,%s)"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "שם של דלפי"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "שם החבילה קיים"
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "הושמטה יחידה %s מהפרוייקט"
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
msgid "Removed unit \"%s\" from uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
#, fuzzy
#| msgid "*** Repairing form files ... ***"
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** מתקן מקבצים... ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "הוחלפה יחידה \"%s\" ביחידה \"%s\" שנמצאת בסעיף \"משתמש ב\""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "יש כבר יחידה עם השם \"%s\"%s, סגור חבילה זאת קודם."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "יחידות להחלפה ב %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr ""
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "שגיאת המרה"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "המר"
#: lazarusidestrconsts.lisconvertencoding
#, fuzzy
#| msgid "Convert encoding"
msgid "Convert Encoding"
msgstr "המר קידוד"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "המר את קידוד הפרויקט/חבילה"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr ""
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "המר פרויקט או חבילה"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr ""
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr ""
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "הממיר מוסיף הידור מותנה כדי לתמוך ביעדים שונים"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "השתמש באותו DFM מהקובץ"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "אותו קובץ DFM עבור לזארוס ודלפי במקום להעתיק אותו ל LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "תומך בדלפי"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "השתמש בהידור מותנה לתמיכה בדלפי"
#: lazarusidestrconsts.lisconvfixedunitname
msgid "Fixed unit name from %s to %s."
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "החלפת פונקציות"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "פונקציות דלפי מסוימות ניתנות להחלפה בפונקציות LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "פונקציות/פרוצדורות להחליף"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "אופסט שמאלי"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "שם חדש"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "מיכל הורה"
#: lazarusidestrconsts.lisconvproblemsfindingallunits
msgid "Problems when trying to find all units from project file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
msgid "Problems when fixing include files in file %s"
msgstr ""
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr ""
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr ""
#: lazarusidestrconsts.lisconvreplacedcall
msgid "Replaced call %s with %s"
msgstr ""
#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr ""
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr ""
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr ""
#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "אופסט עליון"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "החלפת סוג משתנה"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "סוגים לא מוכרים בקובץ הטופס (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "סוג משתנה להחלפה"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "החלפת יחידות"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "שמות היחידות בסעיף \"משתמש ב\" של יחידת הקוד"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "יחידות להחלפה"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "תכונות לא ידועות"
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""
#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "ללא"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "יחיד"
#: lazarusidestrconsts.liscoolbarcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"
#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
#| msgid "Code templates"
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "תבניות קוד"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr ""
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "כפול "
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""
#: lazarusidestrconsts.liscoolbargrabstyleitem5
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "לחצן"
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""
#: lazarusidestrconsts.liscoolbarmessages
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "הודעות"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""
#: lazarusidestrconsts.liscoolbarsourceeditor
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "עורך קוד מקור"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr ""
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "העתק"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "העתק הכל"
#: lazarusidestrconsts.liscopyallitemstoclipboard
#, fuzzy
#| msgid "Copy all items to clipboard"
msgid "Copy All Items to Clipboard"
msgstr "העתק את כל הפריטים ללוח הזמני"
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "העתק את כל הפלט ללוח הזמני"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
#, fuzzy
#| msgid "Copy all shown messages to clipboard"
msgid "Copy All Shown Messages to Clipboard"
msgstr "העתק את כל ההודעות ללוח הזמני"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "העתק תיאור ללוח הזמני"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "שגיאת העתקה"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "שגיאת העתקה"
#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr ""
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr ""
#: lazarusidestrconsts.liscopyidentifier
#, fuzzy,badformat
#| msgid "Copy %s%s%s to clipboard"
msgid "Copy \"%s\" to clipboard"
msgstr "העתק את s%s%s% ללוח הזמני"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "העתקת טופס שלם לא מומשה"
#: lazarusidestrconsts.liscopyitemtoclipboard
#, fuzzy
#| msgid "Copy item to clipboard"
msgid "Copy Item to Clipboard"
msgstr "העתק פריט ללוח הזמני"
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr ""
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
#, fuzzy
#| msgid "Copy selected items to clipboard"
msgid "Copy Selected Items to Clipboard"
msgstr "העתק את הפריטים שנבחרו ללוח הזמני"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
#, fuzzy
#| msgid "Copy selected messages to clipboard"
msgid "Copy Selected Messages to Clipboard"
msgstr "העתק את ההודעות הנבחרות ללוח הגזירים"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "סרוק הודעות של FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "סרוק הודעות של Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "סורק עבור הודעות:"
#: lazarusidestrconsts.liscoskipcallingcompiler
#, fuzzy
#| msgid "Skip calling Compiler"
msgid "Skip calling compiler"
msgstr "דלג על קריאה למהדר"
#: lazarusidestrconsts.liscouldnotadditomainsource
#, fuzzy,badformat
#| msgid "Could not add %s{$I %s%s} to main source!"
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "לא יכול להוסיף את %s{$I %s%s} לקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
#, fuzzy,badformat
#| msgid "Could not add %s{$R %s%s} to main source!"
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "לא יכול להוסיף את %s{$R %s%s} לקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
#, fuzzy,badformat
#| msgid "Could not add %s%s%s to main source!"
msgid "Could not add \"%s\" to main source!"
msgstr "לא יכול להוסיף את %s%s%s לקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
#, fuzzy,badformat
#| msgid "Could not remove %s%s%s from main source!"
msgid "Could not remove \"%s\" from main source!"
msgstr "לא יכול להסיר את %s%s%s מקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
#, fuzzy,badformat
#| msgid "Could not remove %s{$I %s%s} from main source!"
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "לא יכול להסיר את %s{$I %s%s} מקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
#, fuzzy,badformat
#| msgid "Could not remove %s{$R %s%s} from main source!"
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "לא יכול להסיר את %s{$R %s%s} מקובץ הקוד הראשי!"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "אזהרה: קובץ ההגדרות הנוספים למהדר הוא בעל אותו השם, כמו של אחד מקבצי ההגדרות הסטנדרטיים ש FreePascal מחפש. שימוש בקובץ כזה יגרום לתוצאה בה הקובץ הנוסף יפורש, והמהדר ידלג על הקובץ הגדרות הראשי."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "פתח חבילה %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "פתח יחידה %s"
#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ""
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "צור קודם פרויקט!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr ""
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "ליצור ספרייה?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr ""
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "צור פונקציה"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "צור צומת עזרה"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "צור זאת"
#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr ""
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr ""
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "צור פרוייקט"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "צור/עדכן קובץ po. כאשר אתה שומר את קובץ lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, fuzzy,badformat
msgid "Creating file index of FPC sources %s ..."
msgstr "יוצר אינדקס לקובץ קוד של FPC "
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "תחתית"
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "פסגה"
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "בחר ספרייה"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "ערכי תיקיית CodeTools"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "הגדר תבניות"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<לא נבחרו משתנים>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "פתח תצוגה מקדימה"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "כלים"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "משתנה: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "שם משתנה"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "תבניות"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr ""
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr ""
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "אנא בחר במקרו"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "בחר תבנית קוד"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "נוכחי"
#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr ""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr ""
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "העמודה בה נמצא הסמן בעורך הנוכחי"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "השורה בה נמצא הסמן בעורך הנוכחי"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "אפשרויות מותאמות אישית"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "אפשרויות מותאמות אישית"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr ""
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "תכנית של המשתמש"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr ""
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "חתוך"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr ""
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr ""
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr ""
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr ""
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "מודול תאריך"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "תאריך"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "מחק הכל"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "מחק הכל"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "נטרל הכל"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "נטרל הכל"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "אפשר הכל"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "אפשר הכל"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
#, fuzzy
#| msgid "Copy to clipboard"
msgid "Copy to Clipboard"
msgstr "העתק ללוח הזמני"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "מחק"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "נטרל"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "נטרל"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "אפשר"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "אפשר"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "לא צויין מנפה שגיאות"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "הגדר את נקודת העצירה בכל זאת"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, fuzzy,badformat
#| msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "לא צוין מנפה שגיאות. אין השפעה להגדרת נקודות עצירה עד שתגדיר מנפה שגיאות בדיאלוג מנפי השגיאות שבתפריט."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "מופעל/מופסק"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "נטרל/אפשר עידכון של כל החלון"
#: lazarusidestrconsts.lisdebug
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "נפה שגיאות"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "מנפה שגיאות"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, fuzzy,badformat
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "שגיאת מנפה שגיאות s% אופס, המנפה נכנס למצב של שגיאה. שמור את עבודתך כעת! הקש על עצור, וקווה לטוב, אנחנו שולפיים את התקע."
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "מנפה שגיאות לא תקין"
#: lazarusidestrconsts.lisdebugging
#, fuzzy,badformat
msgid "%s (debugging ...)"
msgstr "(ניפוי שגיאות)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "הוסף חריגה"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "נתיב חיפוש נוסף"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "נקודת עצירה"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "נקה את היומן בזמן ריצה"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "מנפה שגיאות"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "הגדרות ניפוי שגיאות כלליות"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "אפשרות תלויית מנפה (תלויה בסוג מנפה השגיאות)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "שם כפול של חריגה "
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "הכנס את שם החריגה"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "דו\"ח אירועים"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "מטופל ע\"י"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "מטופל ע\"י מנפה השגיאות"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "מטופל ע\"י התכנית"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "התעלם מחריגות אלו"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "חריגות שפה"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "הגבל את מספור השורות ל"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "מודול"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "הודע על חריגות לזארוס"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "חריגות מערכת הפעלה"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "פלט"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "תהליך"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "המשך"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "המשך במטופל"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "המשך בלא מטופל"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "הראה הודעה בעצירה"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "אותות"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "תהליך"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "לא ניתן לטעון קובץ"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, fuzzy,badformat
#| msgid "Unable to load file %s%s%s."
msgid "Unable to load file \"%s\"."
msgstr "לא ניתן לטעון את הקובץ %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "עשרוני"
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "ברירת מחדל"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr ""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr ""
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "השהייה עבור טיפים ארוכים בתיבת ההשלמה"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "השהייה לטיפים ותיבת השלמה"
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "מחק"
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr ""
#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "מחק& הכל"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "מחק את כל נקודות העצירה?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
#, fuzzy,badformat
#| msgid "Delete all breakpoints in file %s%s%s?"
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "מחק את כל נקודות העצירה בקובץ s%s%s%?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "מחק הכל באותו קובץ מקור"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "מחק את כל נקודות העצירה שנבחרו?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "למחוק את כל הקבצים?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "מחק קובץ רב משמעי?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "מחק נקודת עצירה"
#: lazarusidestrconsts.lisdeletebreakpointatline
#, fuzzy,badformat
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "מחק נקודת עצירה ב s%s% בשורה d%?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "מחיקת קובץ נכשלה"
#: lazarusidestrconsts.lisdeletemacro
#, fuzzy
#| msgid "Delete macro %s%s%s?"
msgid "Delete macro \"%s\"?"
msgstr "מחק מאקרו %s"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "מחק אופן \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
#, fuzzy,badformat
#| msgid "Delete old file %s%s%s?"
msgid "Delete old file \"%s\"?"
msgstr "האם למחוק קובץ ישן s%s%s%?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "למחוק קובץ ישן ?"
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "מחק את הקבצים שנבחרו"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr ""
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr ""
#: lazarusidestrconsts.lisdeletevalue
#, fuzzy,badformat
#| msgid "Delete value %s%s%s"
msgid "Delete value \"%s\"?"
msgstr "מחק ערך s%s%s%"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "מחק ערך %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
#, fuzzy,badformat
#| msgid "Deleting of file %s%s%s failed."
msgid "Deleting of file \"%s\" failed."
msgstr "מחיקת הקובץ s%s%s% נכשלה."
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr ""
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr ""
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr ""
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr ""
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "תיקיית היעד"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "קוד הפונקציה ההורסת"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "בלתי תלוי ברישיות"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr ""
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "התעלם אם נוספו או הוסרו שורות ריקות"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "התעלם מהשוני של סוף שורה (כלומר #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "התעלם מכמות תווי הרווחים"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "התעלם מרווחים ( התוים של שורה חדשה לא כלולים)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "התעלם מרווחים בסוף שורה"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "התעלם מרווחים בהתחלת שורה"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "רק בחירה"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
#, fuzzy
#| msgid "Open Diff in editor"
msgid "Open difference in editor"
msgstr "פתח Diff בעורך"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "ספרות:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "הנחיות"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "הוראות ליחידה חדשה"
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr ""
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
#, fuzzy,badformat
#| msgid "Directory %s%s%s not found."
msgid "Directory \"%s\" not found."
msgstr "תיקייה s%s%s% לא נמצאה."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "אי אפשר לכתוב לתיקייה"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "התיקייה שבה ה IDE שם את קבצי po."
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "נטרל הכל באותו קובץ מקור"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "נטרל נקודת עצירה"
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "מבוטל"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "נטרל I18N עבור LFM"
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr ""
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr ""
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lisdisassgotoaddress
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "לך לכתובת"
#: lazarusidestrconsts.lisdisassgotoaddresshint
#, fuzzy
#| msgid "Goto address"
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "לך לכתובת"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "לך לכתובת נוכחית"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
#, fuzzy
#| msgid "Goto current address"
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "לך לכתובת נוכחית"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "בטל שינויים"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "בטל את כל השינויים"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr ""
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "לחץ על אחד הפריטים שלמעלה כדי לצפות ב diff"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, fuzzy,badformat
msgid "Error reading file: %s"
msgstr "שגיאה בקריאת קובץ: s%"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "מספר קבצים השתנו בדיסק:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "הבחן בין אותיות גדולות וקטנות למשל A ו a"
#: lazarusidestrconsts.lisdlgadd
#, fuzzy
#| msgid "Add..."
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "הוסף ..."
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr ""
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr ""
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr ""
#: lazarusidestrconsts.lisdlgedit
#, fuzzy
#| msgid "Edit..."
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "עריכה ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "ייצא ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr ""
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr ""
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "פתח..."
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "שמור ..."
#: lazarusidestrconsts.lisdoesnotexists
#, fuzzy
#| msgid "%s does not exists: %s"
msgid "%s does not exist: %s"
msgstr "%s לא קיים: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "%sDo not check if another IDE instance is already running"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "אל תסגור את הפרוייקט"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "אל תהדר תלויות"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "אל תציג מצג פתיחה"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "אל תראה דיאלוג עבור פרוייקט זה"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "אל תראה הודעה זאת שוב"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "למטה"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr ""
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr ""
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr ""
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "שרטט קווי רשת"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr ""
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "העתק את הרכיבים הנבחרים ללוח הזמני"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "העבר את הרכיבים שנבחרו ללוח הזמני"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "הזז רכיב אחד לאחור"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "הזז רכיב אחד לפנים"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "הזז רכיב אחד אחורה"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "הזז רכיב אחד לחזית"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "בחר את הרכיבים שנבחרו מהלוח הזמני"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "בחר רכיב הורה"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr ""
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr ""
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatefoundofvalue
#, fuzzy,badformat
#| msgid "Duplicate found of value %s%s%s."
msgid "Duplicate found of value \"%s\"."
msgstr "נמצאה כפילות בערך s%s%s%."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr ""
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, fuzzy
#| msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "כפילות בשם: רכיב בשם s%s%s% כבר קיים ברכיב המורש s%"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "קבצי ppu כפולים.מחק אחד או שתבדוק שכל נתיבי החיפוש הם בסדר הנכון (טיפ: FPC משתמש קודם בנתיב האחרון). "
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "מסלול חיפוש כפול"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "מקורות כפולים.מחק אחד או שתבדוק שכל נתיבי החיפוש הם בסדר הנכון (טיפ: FPC משתמש קודם בנתיב האחרון). "
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr ""
#: lazarusidestrconsts.lisduplicateunitin
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "עריכה"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "ערוך עזרה תלויית הקשר"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr ""
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr ""
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr ""
#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr ""
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr ""
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr ""
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr ""
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "כל החבילות"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "הפרויקט הנוכחי"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "כל הפרויקטים"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "הגדר מצב FPC לדלפי"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "הגדר מצב FPC ל FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "הגדר מצב FPC ל GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "הגדר מצב FPC ל MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "הגדר מצב FPC ל TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "הפעל בדיקות קלט/פלט"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "הפעל בדיקת גלישה"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "הפעל בדיקת טווח"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr " השתמש ביחידה HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "השתמש ביחידה LineInfo"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "כלי חוקי צריך לפחות כותרת ושם קובץ."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "ערוך כלי"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "מפתח"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "מאקרויים"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "פרמטרים:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "שם התוכנית:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "סרוק פלט להודעות מהדר של Free Pascal "
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "סרוק פלט להודעות make"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "כותרת ושם קובץ נדרשים"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "ספריית העבודה:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr ""
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "הכל"
#: lazarusidestrconsts.lisemdemptymethods
#, fuzzy
#| msgid "Emtpy Methods"
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "מתודות ריקות"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "נמצאה מתודה ריקה:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "אין מחלקה"
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "אין מחלקה ב %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "רק published"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "ציבורי"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "מחק מתודות"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "חפש בחלקי מחלקה אלו:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "לא יכול להציג מתודות ריקות של המחלקה הנוכחית, בגלל %s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "ריק"
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "אפשר הכל"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "אפשר הכל באותו הקובץ"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "אפשר נקודת עצירה"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "מאופשר"
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr ""
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ""
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "אפשר בינאום ותמיכה בתרגום"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "אפשר מאקרו"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr ""
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "צרף "
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "תחום ב $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
msgid "Number of files failed to convert: %d"
msgstr ""
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, fuzzy,badformat
#| msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "הקידוד של הקובץ s%s%s% בדיסק sהוא %. הקידוד החדש הוא s%. "
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr ""
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr ""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "משתנה סביבה, תן שם כמו לפרמטר"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "תיקייה לא נמצאה"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "שם קובץ לא חוקי של מנפה השגיאות"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, fuzzy,badformat
msgid "The debugger file \"%s\" is not an executable."
msgstr "הקובץ s% של מנפה השגיאות אינו קובץ ריצה."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, fuzzy,badformat
msgid "Test directory \"%s\" not found."
msgstr "תיקיית הבדיקה s% לא נמצאה."
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "במיקום %d האפשרות לא תקינה: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "אין הרשאה לאפשרות במיקום %d להיות בשימוש עם הארגומנט: %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "האפשרות במיקום %d זקוקה לארגומנט: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "שגיאה:"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "שגיאה ביצירת קובץ"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "שגיאה במחיקת קובץ"
#: lazarusidestrconsts.liserrorin
#, fuzzy,badformat
msgid "Error in %s"
msgstr "שגיאה ב s%"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "שגיאה בשם קובץ המהדר:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "שגיאה באפשרויות מהדר מותאמות אישית (אחר):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
#, fuzzy
#| msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "שגיאה באפשרויות מהדר מותאמות אישית (קישור / העבר אפשרויות למקשר):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr ""
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "שגיאה בנתיב החיפוש עבור קבצי \"כלול\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "שגיאה בנתיב החיפוש עבור ספריות:"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "שגיאה בנתיב החיפוש עבור קבצי Object:"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "שגיאה בנתיב החיפוש עבור מקורות אחרים:"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "שגיאה בנתיב החיפוש עבור קבצי יחידות אחרות:"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "שגיאה בתיקיית הפלט של היחידה:"
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr ""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "שגיאה בטעינת קובץ"
#: lazarusidestrconsts.liserrorloadingfile2
#, fuzzy,badformat
#| msgid "Error loading file \"%s\":%s%s"
msgid "Error loading file \"%s\":"
msgstr "שגיאה בטעינת קובץ \"%s\":%s%s"
#: lazarusidestrconsts.liserrorloadingfrom
#, fuzzy,badformat
msgid "Error loading %s from%s%s%s%s"
msgstr "שגיאה בטעינת s% מ s%s%s%s%"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "שגיאה בהזזת רכיב"
#: lazarusidestrconsts.liserrormovingcomponent2
#, fuzzy,badformat
msgid "Error moving component %s:%s"
msgstr "שגיאה בהזזת רכיב s%: %s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "שגיאה בנתינת שם לרכיב"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "שגיאה בפתיחת רכיב"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr ""
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "שגיאה בפרוש רכיב lfm של הזרימה"
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, fuzzy,badformat
msgid "Error reading package list from file%s%s%s%s"
msgstr "שגיאה בקריאת רשימת חבילות מהקובץ s%s%s%s%"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "שגיאה בקריאת קובץ XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
#, fuzzy,badformat
#| msgid "Error reading xml file %s%s%s%s%s"
msgid "Error reading xml file \"%s\"%s%s"
msgstr "שגיאה בקריאת קובץ xml %s%s%s%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "שגיאה במתן שם לקובץ"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "שגיאות"
#: lazarusidestrconsts.liserrors2
msgid ", Errors: %s"
msgstr ""
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""
#: lazarusidestrconsts.liserrorsavingto
#, fuzzy,badformat
msgid "Error saving %s to%s%s%s%s"
msgstr "שגיאה בשמירת s% ל s%s%s%s%"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, fuzzy,badformat
msgid "Error setting the name of a component %s to %s"
msgstr "שגיאה בהגדרת שם ברכיב s% ל s%"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "שגיאה בקריאת קובץ \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, fuzzy,badformat
msgid "Error writing package list to file%s%s%s%s"
msgstr "שגיאה בכתיבת רשימת חבילות לקובץ s%s%%s%"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "חשב את הביטוי"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "חשב"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number:"
msgid "Every n-th line number"
msgstr "כל שורה שמספרה הוא n:"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "קובץ דוגמה"
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr ""
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, fuzzy,badformat
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "דוגמה: מזהים TMyEnum.Enum \"שם יחידה.מ/nזהה\" \"#שם חבילה.שם יחידה.מזהה\""
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr ""
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "הערת חריגה של מנפה השגיאות"
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr ""
#: lazarusidestrconsts.lisexcludefilter
#, fuzzy
#| msgid "Exclude Filter"
msgid "Exclude filter"
msgstr "אל תכלול מסנן"
#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr ""
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "ביצוע פקודה אחרי"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "ביצוע פקודה לפני"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "הריצה נעצרה"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "יציאה"
#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr ""
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr ""
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "פרוש את כל המחלקות"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "פרוש את כל החבילות"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "פרוש את כל היחידות"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "הרחב את שם הקובץ של הקובץ הנוכחי שנערך"
#: lazarusidestrconsts.lisexport
#, fuzzy
#| msgid "Export ..."
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "ייצא ..."
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr ""
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr ""
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr ""
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr ""
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr ""
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "ייצא רשימה"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr ""
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr ""
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "ביטוי:"
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr ""
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "ייצא את נתיב היחידה"
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "חלץ"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "חלץ פרוצדורה"
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr ""
#: lazarusidestrconsts.lisexttoolexternaltools
#, fuzzy
#| msgid "External tools"
msgid "External Tools"
msgstr "כלים חצוניים"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "הגעת לממספר הכלים המירבי"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "יש מקסימום של %s למספר הכלים"
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
msgid "Failed to add %d not unique resource(s)"
msgstr ""
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "לא מצליח ליצור חבילת יישומים עבור \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "נכשל בטעינת מצב מקופל"
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr ""
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr ""
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr ""
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "צמצם את צביעת המעצב"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
#, fuzzy
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "פריטי מעצב הצבעים מושבתים (צמצם אפשרויות עבור מחשבים איטיים)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "קובץ"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr ""
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
#, fuzzy
#| msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "הקובץ s%s%s%s% לא נראה כמו קובץ טקסט. לפתוח אותו בכל זאת?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "קובץ הרחבה של תכניות"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "מסנן קבצים"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr ""
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr ""
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr ""
#: lazarusidestrconsts.lisfilehaschangedsave
#, fuzzy,badformat
#| msgid "File %s%s%s has changed. Save?"
msgid "File \"%s\" has changed. Save?"
msgstr "הקובץ s%s%s%s% השתנה. לשמור?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "לקובץ אין פרוייקט"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr ""
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr ""
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "הקובץ לא לכתיבה"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "הקובץ הוא קישור סימבולי"
#: lazarusidestrconsts.lisfileisvirtual
#, fuzzy,badformat
#| msgid "File %s%s%s is virtual."
msgid "File \"%s\" is virtual."
msgstr "הקובץ s%s%s%s% הוא וירטואלי"
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "שגיאת קישור לקובץ"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "שם קובץ/כתובת"
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "הקובץ לא נמצא"
#: lazarusidestrconsts.lisfilenotfound2
#, fuzzy,badformat
#| msgid "File %s%s%s not found.%s"
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "הקובץ s%s%s% לא נמצא"
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr ""
#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr ""
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, fuzzy
#| msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "הקובץ s%s%s% לא נמצא. האם אתה רוצה ליצור אותו?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "הקובץ אינו באותיות קטנות"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "הקובץ אינו קובץ טקסט"
#: lazarusidestrconsts.lisfilesettings
#, fuzzy
#| msgid "File Settings ..."
msgid "File Settings"
msgstr "הגדרות קובץ ..."
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr ""
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr ""
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "קבצים בקידוד ASCII או UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr ""
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "קבצים לא בקידוד ASCII ולא UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "הקובץ בו נשמר המידע לניפוי שגיאות. אם אין הגדרה, המידע יכתב על מסך המסוף."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "מסנן"
#: lazarusidestrconsts.lisfilter3
#, fuzzy,badformat
msgid "Filter: %s"
msgstr "מסנן: s%"
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr ""
#: lazarusidestrconsts.lisfilterallmessagesoftype
msgid "Filter all messages of type %s"
msgstr ""
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr ""
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr ""
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr ""
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr ""
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr ""
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "הגדרת מסנן"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr ""
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr ""
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr ""
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr ""
#: lazarusidestrconsts.lisfinddeclarationof
msgid "Find Declaration of %s"
msgstr ""
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr ""
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
#, fuzzy
#| msgid "Include sub directories"
msgid "Include &sub directories"
msgstr "כלול תיקיות משנה"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "דפוס רב שורות"
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "רק קבצי טקסט"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "חפש את כל הקבצים בפרוי&יקט"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "חפש את כל הקבצים הפתוחים&"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr ""
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "חפש בס&פריות"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "מיקום"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "חפש צירופי מקשים"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "חפש יחידות חסרות"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "ראשון"
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr ""
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "תקן קובץ LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "נקודה צפה"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr ""
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "כפה שינוי שם"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr ""
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "טופס"
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr ""
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "שגיאת מבנה"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr ""
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr ""
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr ""
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr ""
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake נכשל"
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr ""
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr ""
#: lazarusidestrconsts.lisfpcresources
#, fuzzy
#| msgid "FPC resources"
msgid "FPC resources (.res)"
msgstr " משאבי FPC"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr ""
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "גירסה ישנה מדי של FPC"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "גירסת FPC:"
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "גירסת FPC (למשל 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
#, fuzzy
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "עורך FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "שגיאה בכתיבת \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "שגיאת תחביר ב FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr ""
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, fuzzy,badformat
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "יש שגיאת תחביר באלמנט של fpdoc"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "מסגרת"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "חפש אחורנית"
#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr ""
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "ספריית קוד המקור של Freepascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "חיפוש קדימה"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "קבצים נוספים לחיפוש (כלומר /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "מצא או שנה שם של מזהה"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "מצא מראי מקום"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "מזהה: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "בכל החבילות והפרוייקטים הפתוחים"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "ביחידה הנוכחית"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "בפרויקט הראשי"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "בפרוייקט/חבילה להם שייכת היחידה"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "מזהה לא חוקי"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "שנה שם של כל מראי המקום"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr ""
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr ""
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "חפש גם בהערות"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr ""
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "פונקציה"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "כללי"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "קח את המילה שבמקום הנוכחי של הסמן"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr ""
#: lazarusidestrconsts.lisgotoline
#, fuzzy
#| msgid "Goto line"
msgid "Goto Line"
msgstr "לך אל שורה"
#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr ""
#: lazarusidestrconsts.lisgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
#| "\n"
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך) של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "קבוצה"
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr ""
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr ""
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr ""
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr ""
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr ""
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr ""
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr ""
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "הגדל לגדול ביותר"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "יש לו עזרה"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr ""
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "הערת כותרת למחלקה"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "עזרה"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "כניסות עזרה"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "בורר העזרה"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "הקסדצימלי"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
#, fuzzy
#| msgid "Help for FreePascal Compiler message"
msgid "Help for Free Pascal Compiler message"
msgstr "עזרה להודעות שגיאה של מהדר FPC"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr ""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr ""
#: lazarusidestrconsts.lishidewindow
#, fuzzy
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "הסתר חלון"
#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr ""
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "טיפ"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "טיפ: ניתן להגדיר ערך ברירת מחדל בהתניות עם:"
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "טיפ: בדוק אם יש שתי חבילות המכילות יחידות עם אותו שם."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr ""
#: lazarusidestrconsts.lishints
msgid ", Hints: %s"
msgstr ""
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "שמור הכל"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "צעד לתוך"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "הרץ עד לחזרה מפונקציה"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "צעד מעבר ל"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, fuzzy,badformat
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "טיפ: הפונקציה \"Make Resourcestring\" מקבלת מחרוזת קבועה. בחר ביטוי ונסה שוב."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "החלף טופס/יחידה"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "הצג טפסים"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "הצג יחידות"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "ספירת טיפים"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "בסיס נתונים"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "אפשרויות עזרה"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "תכונות:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "תצוגות"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "נתיב ל FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "אופקי"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr ""
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr ""
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr ""
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "אפשרויות הבניה של ה IDE "
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr ""
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr ""
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "יוצר Makefile עבור חבילה %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "שגיאה: הרצת כלי \"הדר אחרי\" נכשלה עבור חבילה %s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "מידע על ה IDE"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "אזהרה: שם יחידה לא חוקי %s, חבילה=%s"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr ""
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr ""
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr ""
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "מזהה"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "מזהה המתחיל עם ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "מזהה מכיל ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "אפשרויות IDE"
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr ""
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr ""
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "הכותרת של ה IDE מתחילה בשם הפרוייקט"
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr ""
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr ""
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr ""
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "הקובץ המיוצא קיים"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, fuzzy,badformat
#| msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "הקובץ המיוצא s%s%s%קיים. לפתוח את הקובץ ולהחליף רק את אפשרויות המהדר? ( יתר ההגדרות יישמרו.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr ""
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "טען מקובץ"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr ""
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "קבצים אחרונים"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "שמור לקובץ"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr ""
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr ""
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr ""
#: lazarusidestrconsts.lisignore
#, fuzzy
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "התעלם"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "התעלם מהכל"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "התעלם והמשך"
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "התעלם מבינארי"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "התעלם מסוג חריגות זה"
#: lazarusidestrconsts.lisignoreuseasancestor
msgid "Ignore, use %s as ancestor"
msgstr ""
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "העתק זיהוי של היחידה , הפרוייקט או החבילה הנוכחיים."
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "הערת מימוש של המחלקה"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr ""
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr ""
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr ""
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr ""
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr ""
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "ייבא רשימה"
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr ""
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "בלתי אפשרי"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "בתיקיית המקור של החבילה \"%s\""
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "בתיקיית המקור של הפרוייקט. בדוק כפילויות."
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincludefilter
#, fuzzy
#| msgid "Include Filter"
msgid "Include filter"
msgstr "כלול מסנן"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "כלול נתיב"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "כלול נתיבים"
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr ""
#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ""
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr ""
#: lazarusidestrconsts.lisindentationforpascalsources
#, fuzzy
#| msgid "Indentation for pascal sources"
msgid "Indentation for Pascal sources"
msgstr "זיהוי לקוד פסקל"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "אינדקס"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "מידע"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "מידע עבור %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "מידע על FPC"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "בנתיב החיפוש של יחידות FPC. כנראה הותקן על ידי חבילת FPC. בדוק אם המהדר וקובץ ה ppu הם מאותה התקנה."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "לפני הקשורים"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "פריט מורש"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr ""
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "רכיב מורש של הפרוייקט"
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, fuzzy
#| msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "כדי ליצור העתק נקי של הפרוייקט/חבילה, כל הקבצים בתיקייה הבאה יימחקו וכל התוכן יאבד. האם למחוק את כל הקבצים ב s%s%s%?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "הכנס"
#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr ""
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "הכנס תאריך"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "הכנס תאריך ושעה"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
#, fuzzy
#| msgid "Insert date and time. Optional: format string"
msgid "Insert date and time. Optional: format string."
msgstr "הכנס תאריך ושעה. אפשרי: עיצוב המחרוזת"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
#, fuzzy
#| msgid "Insert date. Optional: format string"
msgid "Insert date. Optional: format string."
msgstr "הכנס תאריך. אפשרי: עיצוב המחרוזת"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "הכנס סיום אם צריך"
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "הכנס מאקרו"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
#, fuzzy
#| msgid "Insert name of current procedure"
msgid "Insert name of current procedure."
msgstr "הכנס את שם הפרוצדורה הנוכחית"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "הכנס תוית PrintShort"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "הכנס תוית printshort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "הכנס את כותרת הפרוצדורה"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "הכנס את שם הפרוצדורה"
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "הכנס שעה"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
#, fuzzy
#| msgid "Insert time. Optional: format string"
msgid "Insert time. Optional: format string."
msgstr "הכנס שעה. אפשרי: עיצוב המחרוזת"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "הכנס תוית url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "פקח"
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr ""
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "נתונים"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "מפקח המהדר"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "מתודה"
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr ""
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "תכונות"
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr ""
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr ""
#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr ""
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr ""
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "ההתקנה נכשלה"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr ""
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "התקן זאת,אני אוהב אותו שמן"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "התקן את מה שנבחר"
#: lazarusidestrconsts.lisinstalluninstallpackages
#, fuzzy
#| msgid "Install/Uninstall packages"
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "התקן/הסר חבילות"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "במקום חבילה מהודרת צור קובץ Makefile פשוט."
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "אינטראקטיבי"
#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "פקודה לא חוקית"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "מחיקה לא חוקית"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr ""
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
msgid "The file \"%s\" is not executable."
msgstr ""
#: lazarusidestrconsts.lisinvalidexpression
#, fuzzy,badformat
msgid "Invalid expression:%s%s%s%s"
msgstr "ביטוי לא חוקי: s%s%s%"
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, fuzzy,badformat
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "ביטוי לא חוקי: הפונקציה \"Make Resourcestring\" מצפה למחרוזת קבועה בקובץ יחיד. בחר את הביטוי ונסה שוב."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "מסנן לא חוקי"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, fuzzy,badformat
msgid "Invalid line, column in message%s%s"
msgstr "שורה לא חוקית, עמודה בהודעה s%s%"
#: lazarusidestrconsts.lisinvalidmacrosin
msgid "Invalid macros in \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "אופן לא חוקי %s"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "בחירה מרובה לא חוקית"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "לא חוקי (מכובה)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "לא חוקי (מופעל)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "מזהה פסקל לא חוקי"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
#, fuzzy,badformat
#| msgid "The name \"%s\" is not a valid pascal identifier."
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr "השם s% אינו מזהה חוקי של פסקל."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "שם פרוצדורה לא חוקי"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "שם קובץ של הפרוייקט לא חוקי"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "תיקיית פרסום לא חוקית"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "בחירה לא חוקית"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
#, fuzzy,badformat
msgid "%s is already part of the Project."
msgstr "זה כבר חלק מהפרוייקט. s%"
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, fuzzy,badformat
#| msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "זה שם פרוייקט לא חוקי %s%s%s. בחר שם אחר (למשל project1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr ""
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr ""
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr ""
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "אני מתפלא איך עשית זאת. שגיאה ב %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "אני מתפלא איך עשית זאת. שגיאה בתיקיית הבסיס:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "היסטוריית קפיצות"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr ""
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr ""
#: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s"
msgstr ""
#: lazarusidestrconsts.liskb
msgid "%s KB"
msgstr ""
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "שמור"
#: lazarusidestrconsts.liskeepfileopen
#, fuzzy
#| msgid "Keep converted file open in editor"
msgid "Keep converted files open in editor"
msgstr "שמור את הקובץ שהומר פתוח בעורך"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "כל קבצי הפרוייקט ישארו פתוחים בעורך אחרי ההמרה"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "שמור ברשימת ההתקנות"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "שמור שם"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr ""
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "שמור הזחה יחסית של תבנית מרובת שורות"
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "שמור הזחה"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "שמור אותם והמשך"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "מקש"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "פקודות מותאמות אישית"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "פקודות מעצב"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "פקודות מפקח העצמים"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "מפתח (או סדרה של שני מפתחות)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "בטל בנייה"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "הוסף משגיח"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr ""
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "בנה את התכנית/פרוייקט"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "בחר סכמת מיפוי מקשים"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "קלאסי"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "סגור פרויקט"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "הגדרת עורך ע\"י CodeTools"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "הדר פרוייקט.תוכנית"
#: lazarusidestrconsts.liskmconfigbuildfile
#, fuzzy
#| msgid "Config %sBuild File%s"
msgid "Config \"Build File\""
msgstr "ארגן ובנה את קובץ s%"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
#, fuzzy
#| msgid "Configure custom components"
msgid "Configure Custom Components"
msgstr "מגדיר רכיבים מותאמים אישית"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "עזרה רגישה להקשר"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "החלף חבילת דלפי לחבילת לזארוס"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project"
msgid "Convert Delphi Project to Lazarus Project"
msgstr "החלף פרוייקט דלפי לפרוייקט לזארוס"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit"
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "החלף יחידת דלפי ליחידת לזארוס"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
#, fuzzy
#| msgid "Convert DFM file to LFM"
msgid "Convert DFM File to LFM"
msgstr "החלף DFM ל LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
#, fuzzy
#| msgid "Copy selected Components to clipboard"
msgid "Copy selected components"
msgstr "העתק את הרכיבים הנבחרים ללוח הזמני"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
#, fuzzy
#| msgid "Cut selected Components to clipboard"
msgid "Cut selected components"
msgstr "גזור את הרכיבים שנבחרו אל הלוח הזמני"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to OS X"
msgstr ""
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "מחק את התו האחרון"
#: lazarusidestrconsts.liskmdiffeditorfiles
#, fuzzy
#| msgid "Diff editor files"
msgid "Diff Editor Files"
msgstr "עורך להשוואת קבצים"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "ערוך תבניות קוד"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "ערוך עזרה רגישה להקשר"
#: lazarusidestrconsts.liskmencloseselection
#, fuzzy
#| msgid "Enclose selection"
msgid "Enclose Selection"
msgstr "צרף את הבחירה"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "חשב/שנה"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr ""
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "הגדרת כלים חצוניים"
#: lazarusidestrconsts.liskmfindincremental
#, fuzzy
#| msgid "Find incremental"
msgid "Find Incremental"
msgstr "מצא באופן מתקדם"
#: lazarusidestrconsts.liskmgotomarker0
#, fuzzy
#| msgid "Go to marker 0"
msgid "Go to bookmark 0"
msgstr "לך לסימן 0"
#: lazarusidestrconsts.liskmgotomarker1
#, fuzzy
#| msgid "Go to marker 1"
msgid "Go to bookmark 1"
msgstr "לך לסימן 1"
#: lazarusidestrconsts.liskmgotomarker2
#, fuzzy
#| msgid "Go to marker 2"
msgid "Go to bookmark 2"
msgstr "לך לסימן 2"
#: lazarusidestrconsts.liskmgotomarker3
#, fuzzy
#| msgid "Go to marker 3"
msgid "Go to bookmark 3"
msgstr "לך לסימן 3"
#: lazarusidestrconsts.liskmgotomarker4
#, fuzzy
#| msgid "Go to marker 4"
msgid "Go to bookmark 4"
msgstr "לך לסימן 4"
#: lazarusidestrconsts.liskmgotomarker5
#, fuzzy
#| msgid "Go to marker 5"
msgid "Go to bookmark 5"
msgstr "לך לסימן 5"
#: lazarusidestrconsts.liskmgotomarker6
#, fuzzy
#| msgid "Go to marker 6"
msgid "Go to bookmark 6"
msgstr "לך לסימן 6"
#: lazarusidestrconsts.liskmgotomarker7
#, fuzzy
#| msgid "Go to marker 7"
msgid "Go to bookmark 7"
msgstr "לך לסימן 7"
#: lazarusidestrconsts.liskmgotomarker8
#, fuzzy
#| msgid "Go to marker 8"
msgid "Go to bookmark 8"
msgstr "לך לסימן 8"
#: lazarusidestrconsts.liskmgotomarker9
#, fuzzy
#| msgid "Go to marker 9"
msgid "Go to bookmark 9"
msgstr "לך לסימן 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "לך לעורך קוד 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "לך לעורך קוד 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "לך לעורך קוד 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "לך לעורך קוד 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "לך לעורך קוד 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "לך לעורך קוד 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "לך לעורך קוד 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "לך לעורך קוד 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "לך לעורך קוד 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "לך לעורך קוד 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "הכנס תאריך ושעה"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "הכנס שם משתמש"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "פקח"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "סכמת מיפוי מקשים"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "לזארוס (ברירת מחדל)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "(סגנון אפל גירסה 10) Mac OS X"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "(סגנון לזארוס) Mac OS X"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "חבילה חדשה"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "פרויקט חדש"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "פרויקט חדש מקובץ"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "יחידה חדשה"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "הערה: כל המקשים יוגדרו לערכים של הסכמה הנבחרת."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "לפתוח קובץ חבילה"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "הדבק את הרכיבים מהלוח הזמני"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "השהה תוכנית"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "פרסם פרויקט"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "הידור מהיר ללא קישור"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr ""
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "הרץ תוכנה"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "שמור הכל"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "שמור כ"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "שמור פרוייקט"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "שמור פרוייקט כ "
#: lazarusidestrconsts.liskmselectlineend
#, fuzzy
#| msgid "Select line end"
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "בחר את סוף השורה"
#: lazarusidestrconsts.liskmselectlinestart
#, fuzzy
#| msgid "Select line start"
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "בחר את התחלת השורה"
#: lazarusidestrconsts.liskmselectpagebottom
#, fuzzy
#| msgid "Select page bottom"
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "בחר את תחתית הדף"
#: lazarusidestrconsts.liskmselectpagetop
#, fuzzy
#| msgid "Select page top"
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "בחר את ראש הדף"
#: lazarusidestrconsts.liskmselectwordleft
#, fuzzy
#| msgid "Select word left"
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "בחר את שמאל המילה"
#: lazarusidestrconsts.liskmselectwordright
#, fuzzy
#| msgid "Select word right"
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "בחר את ימין המילה"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "קבע סימניה חופשית"
#: lazarusidestrconsts.liskmsetmarker0
#, fuzzy
#| msgid "Set marker 0"
msgid "Set bookmark 0"
msgstr "קבע סמן 0"
#: lazarusidestrconsts.liskmsetmarker1
#, fuzzy
#| msgid "Set marker 1"
msgid "Set bookmark 1"
msgstr "קבע סמן 1"
#: lazarusidestrconsts.liskmsetmarker2
#, fuzzy
#| msgid "Set marker 2"
msgid "Set bookmark 2"
msgstr "קבע סמן 2"
#: lazarusidestrconsts.liskmsetmarker3
#, fuzzy
#| msgid "Set marker 3"
msgid "Set bookmark 3"
msgstr "קבע סמן 3"
#: lazarusidestrconsts.liskmsetmarker4
#, fuzzy
#| msgid "Set marker 4"
msgid "Set bookmark 4"
msgstr "קבע סמן 4"
#: lazarusidestrconsts.liskmsetmarker5
#, fuzzy
#| msgid "Set marker 5"
msgid "Set bookmark 5"
msgstr "קבע סמן 5"
#: lazarusidestrconsts.liskmsetmarker6
#, fuzzy
#| msgid "Set marker 6"
msgid "Set bookmark 6"
msgstr "קבע סמן 6"
#: lazarusidestrconsts.liskmsetmarker7
#, fuzzy
#| msgid "Set marker 7"
msgid "Set bookmark 7"
msgstr "קבע סמן 7"
#: lazarusidestrconsts.liskmsetmarker8
#, fuzzy
#| msgid "Set marker 8"
msgid "Set bookmark 8"
msgstr "קבע סמן 8"
#: lazarusidestrconsts.liskmsetmarker9
#, fuzzy
#| msgid "Set marker 9"
msgid "Set bookmark 9"
msgstr "קבע סמן 9"
#: lazarusidestrconsts.liskmstopprogram
#, fuzzy
#| msgid "Stop program"
msgid "Stop Program"
msgstr "עצור תכנית"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "החלף בין יחידה לטופס"
#: lazarusidestrconsts.liskmtogglemarker0
#, fuzzy
#| msgid "Toggle marker 0"
msgid "Toggle bookmark 0"
msgstr "החלף סמן 0"
#: lazarusidestrconsts.liskmtogglemarker1
#, fuzzy
#| msgid "Toggle marker 1"
msgid "Toggle bookmark 1"
msgstr "החלף סמן 1"
#: lazarusidestrconsts.liskmtogglemarker2
#, fuzzy
#| msgid "Toggle marker 2"
msgid "Toggle bookmark 2"
msgstr "החלף סמן 2"
#: lazarusidestrconsts.liskmtogglemarker3
#, fuzzy
#| msgid "Toggle marker 3"
msgid "Toggle bookmark 3"
msgstr "החלף סמן 3"
#: lazarusidestrconsts.liskmtogglemarker4
#, fuzzy
#| msgid "Toggle marker 4"
msgid "Toggle bookmark 4"
msgstr "החלף סמן 4"
#: lazarusidestrconsts.liskmtogglemarker5
#, fuzzy
#| msgid "Toggle marker 5"
msgid "Toggle bookmark 5"
msgstr "החלף סמן 5"
#: lazarusidestrconsts.liskmtogglemarker6
#, fuzzy
#| msgid "Toggle marker 6"
msgid "Toggle bookmark 6"
msgstr "החלף סמן 6"
#: lazarusidestrconsts.liskmtogglemarker7
#, fuzzy
#| msgid "Toggle marker 7"
msgid "Toggle bookmark 7"
msgstr "החלף סמן 7"
#: lazarusidestrconsts.liskmtogglemarker8
#, fuzzy
#| msgid "Toggle marker 8"
msgid "Toggle bookmark 8"
msgstr "החלף סמן 8"
#: lazarusidestrconsts.liskmtogglemarker9
#, fuzzy
#| msgid "Toggle marker 9"
msgid "Toggle bookmark 9"
msgstr "החלף סמן 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
#, fuzzy
#| msgid "Toggle view Assembler"
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "החלף (הצג/הסתר) מהדר האסמבלי"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
#, fuzzy
#| msgid "Toggle view Breakpoints"
msgid "View Breakpoints"
msgstr "החלף (הצג/הסתר) נקודות עצירה"
#: lazarusidestrconsts.liskmtoggleviewcallstack
#, fuzzy
#| msgid "Toggle view Call Stack"
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "החלף (הצג/הסתר) קריאות למחסנית"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "החלף (הצג/הסתר) סייר הקוד"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
#, fuzzy
#| msgid "Toggle view component palette"
msgid "Toggle View Component Palette"
msgstr "החלף (הצג/הסתר) לוח הרכיבים"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
#, fuzzy
#| msgid "Toggle view Debuger Event Log"
msgid "View Debuger Event Log"
msgstr "החלף (הצג/הסתר) לוג ארועי מנפה השגיאות"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
#, fuzzy
#| msgid "Toggle view Debugger Output"
msgid "View Debugger Output"
msgstr "החלף (הצג/הסתר) פלט מנפה השגיאות"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "החלף (הצג/הסתר) עורך התיעוד"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "החלף (הצג/הסתר) לחצנים מהירים של ה IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
#, fuzzy
#| msgid "Toggle view Local Variables"
msgid "View Local Variables"
msgstr "החלף (הצג/הסתר) משתנים מקומיים"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "החלף (הצג/הסתר) הודעות"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "החלף (הצג/הסתר) צופה העצמים"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
#, fuzzy
#| msgid "Toggle view Registers"
msgid "View Registers"
msgstr "החלף (הצג/הסתר) אוגרים"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "החלף (הצג/הסתר) תוצאות חיפוש"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "החלף (הצג/הסתר) את עורך הקוד"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
#, fuzzy
#| msgid "Toggle view Watches"
msgid "View Watches"
msgstr "החלף (הצג/הסתר) משגיחים"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "הצג היסטורית הקפיצה"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "הצג אפשרויות הפרויקט"
#: lazarusidestrconsts.liskmviewprojectsource
#, fuzzy
#| msgid "View project source"
msgid "View Project Source"
msgstr "הצג קוד הפרויקט"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "הצג מידע על היחידה"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr ""
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "טעינת היישום לא חוקית"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "טעינת שורת הפקודה המיועדת"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "לזארוס"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr ""
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "הספרייה של לזרוס"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "התקייה, שיש להשתמש בה כתיקיית המוצא"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "לזרוס IDE v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "לזארוס IDE"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "מזהה השפה של לזרוס (למשל: en, de, br,fi, he)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "שם השפה של לזרוס (למשל english, deutsch, hebrew)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "לזארוס [אפשרויות] <פרוייקט-שם קובץ>"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "פעולה"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "בחר בתיקיית הפלט לקבצי הריצה של הIDE"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "האם אתה בטוח שאתה רוצה למחוק את פרופיל הבנייה הזה?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr ""
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "הגדרות משותפות"
#: lazarusidestrconsts.lislazbuildconfirmbuild
#, fuzzy
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "אשר לפני בנייה מחודשת של לזרוס"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "אשר מחיקה"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "נפה שגיאות IDE"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "קפל תיקייה"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "שגיאה בכתיבת קובץ"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, fuzzy,badformat
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "בונה לזארוס אינו אינטראקטיבי, יוצא עכשיו."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "נהל פרופילי בנייה "
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "נהל פרופילים"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "שם הפרופיל הפעיל"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "הוסף פרופיל חדש"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "אפשרויות הבנייה הנוכחיות יקושרו עם:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr ""
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "במצב מיטבי IDE"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "אפשרויות:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "אפשרויות שהועברו למהדר"
#: lazarusidestrconsts.lislazbuildprofile
#, fuzzy
#| msgid "Profile to Build"
msgid "Profile to build"
msgstr "פרופיל בנייה"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "שנה שם הפרופיל"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "שם חדש לפרופיל:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
#, fuzzy
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "אתחל אחרי בנייה מוצלחת"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "אתחל את לזארוס אוטומטית אחרי בניית ה IDE. (אין לזה השפעה בזמן בניית חלקים אחרים)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "בחר פרופילים לבנייה"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "הראה דיאלוג אישרור כשאתה בונה ישירות מתפריט \"כלים\""
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "מעבד היעד:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "תיקיית היעד:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "מערכת ההפעלה המיועדת"
#: lazarusidestrconsts.lislazbuildunabletowritefile
#, fuzzy,badformat
msgid "Unable to write file \"%s\":%s"
msgstr "לא יכול לכתוב את הקובץ s%:%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "עדכן את revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "עדכן את מידע התיקון בדיאלוג \"About Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "נקה ובנה הכל"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr ""
#: lazarusidestrconsts.lislclwidgettype
#, fuzzy
#| msgid "LCL Widget Type"
msgid "LCL widget type"
msgstr "עצם מסוג LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "הוסף קישור לירושה"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "העתק מהירושה"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "הזז ערך ליורש"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr ""
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, fuzzy,badformat
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "היחידה s% אינה בבעלות חבילה או פרוייקט כלשהם. הוסף את היחידה לחבילה או לפרוייקט. לא יכול ליצור את קובץ ה fpdoc."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "שמאל"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "רווח גבול שמאלי. הערך מתווסף לרווח הגבול הבסיסי ומשמש לרווח שמשמאל לפקד."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "עיגון לשמאל"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "זהו פקד אח אליו מעוגן הצד השמאלי. השאר ריק עבור הורה."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "צדדים שמאליים"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "רווח במדה שווה משמאל"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "רמות"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "קובץ LFM "
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr ""
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "קובץ LFM הרוס"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "קובץ LFM תקין"
#: lazarusidestrconsts.lislgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך) של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "נתיב הספריה"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr ""
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "שורה:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "שורה/אורך"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "קישור:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "אפשרויות מקשר"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "קשר יעד"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "רשימה של כל ערכי case"
#: lazarusidestrconsts.lisloadingfailed
#, fuzzy,badformat
msgid "Loading %s failed."
msgstr "טעינת s% נכשלה"
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr ""
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "מקומיים"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "חשב את הביטוי"
#: lazarusidestrconsts.lislogmessage
#, fuzzy
#| msgid "Log message"
msgid "Log Message"
msgstr "הודעת לוג"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "מחרוזת של אותיות קטנות"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
#, fuzzy
#| msgid "Lowercase string given as parameter"
msgid "Lowercase string given as parameter."
msgstr "מחרוזת של אותיות קטנות נתונה כפרמטר"
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr ""
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr ""
#: lazarusidestrconsts.lislrsincludefiles
#, fuzzy
#| msgid "lrs include files"
msgid "Lazarus resources (.lrs) include files"
msgstr "קובץ \"כלול\" מסוג lrs"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "מאקרו %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "הזן מידע"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "הזן פרמטרים לריצה"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
#, fuzzy
#| msgid "Main Unit has Application.CreateForm statements"
msgid "Main unit has Application.CreateForm statements"
msgstr "ליחידה הראשית יש יישום. משפטי CreateForm"
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
msgid "Main unit has Application.Scaled statement"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
msgid "Main unit has Application.Title statement"
msgstr ""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
#, fuzzy
#| msgid "Main Unit has Uses Section containing all Units of project"
msgid "Main unit has Uses section containing all units of project"
msgstr "ליחידה הראשית יש קטע הכולל את כל יחידות הפרוייקט"
#: lazarusidestrconsts.lismainunitispascalsource
#, fuzzy
#| msgid "Main Unit is Pascal Source"
msgid "Main unit is Pascal source"
msgstr "היחידה הראשית היא קוד של פסקל"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr ""
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "קובץ ריצה של Make"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "קובץ Make לא נמצא"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "מחרוזת המשאבים של Make"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "הוסף אחרי הקטע"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, fuzzy,badformat
#| msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "מחרוזת המשאבים s%s%s% כבר קיימת. בחר שם אחר.השתמש ב\"התעלם\" כדי להוסיף אותו בכל זאת."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "אפשרויות המרה"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "מזהה מותאם אישית"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "מזהה"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "אורך המזהה"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "קידומת מזהה:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "הוסף לפי א' ב'"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "הכנסה רגישת הקשר"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "קטע מחרוזת משאבים לא חוקי"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "אנא בחר איזור של מחרוזת משאבים מהרשימה"
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "מחרוזת המשאבים כבר קיימת"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "קטע מחרוזת המשאבים:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "תצוגה מקדימה של הקוד"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "מחרוזת קבועה בקוד"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "מחרוזת בעלת אותו ערך"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr ""
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
msgstr ""
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr ""
#: lazarusidestrconsts.lismaxs
#, fuzzy,badformat
msgid "Max %d"
msgstr "מקסימום d%"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, fuzzy,badformat
msgid "%s Maybe you have to recompile the package."
msgstr "יתכן שתצטרך להדר מחדש את החבילה."
#: lazarusidestrconsts.lismb
msgid "%s MB"
msgstr ""
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "פעולה"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "השלכת זיכרון"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "בטל בנייה"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "אודות FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "הוסף נקודת עצירה"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr ""
#: lazarusidestrconsts.lismenuaddjumppointtohistory
#, fuzzy
#| msgid "Add jump point to history"
msgid "Add Jump Point to History"
msgstr "הוסף נקודת קפיצה להיסטוריה"
#: lazarusidestrconsts.lismenuaddtoproject
#, fuzzy
#| msgid "Add editor file to Project"
msgid "Add Editor File to Project"
msgstr "הוסף את קבצי העורך לפרויקט"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "הוסף משגיח ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
#, fuzzy
#| msgid "Break Lines in selection"
msgid "Break Lines in Selection"
msgstr "חתוך את השורה במקום שנבחר"
#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr ""
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "בנה קובץ"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus with current profile"
msgid "Build Lazarus with Current Profile"
msgstr "בנה את לזרוס"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, fuzzy
#| msgid "Build Lazarus with profile: %s"
msgid "Build Lazarus with Profile: %s"
msgstr "בנה את לזארוס עם הפרופיל: %s"
#: lazarusidestrconsts.lismenuchecklfm
#, fuzzy
#| msgid "Check LFM file in editor"
msgid "Check LFM File in Editor"
msgstr "בדוק את קובץ הLFM בעורך"
#: lazarusidestrconsts.lismenucleandirectory
#, fuzzy
#| msgid "Clean directory ..."
msgid "Clean Directory ..."
msgstr "נקה ספרייה ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr ""
#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close A&ll Editor Files"
msgid "Close A&ll"
msgstr "סגור את כל הקבצים בעורך"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr ""
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "סגור פרויקט"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
#, fuzzy
#| msgid "CodeTools defines editor ..."
msgid "CodeTools Defines Editor ..."
msgstr "הגדרת עורך ע\"י CodeTools"
#: lazarusidestrconsts.lismenucommentselection
#, fuzzy
#| msgid "Comment selection"
msgid "Comment Selection"
msgstr "בחירת הערה"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr ""
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "השלם קוד"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr ""
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "מגדיר את קובץ בנה והרץ ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
#, fuzzy
#| msgid "Configure custom components ..."
msgid "Configure Custom Components ..."
msgstr "מגדיר רכיבים מותאמים אישית ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
#, fuzzy
#| msgid "Configure external tools ..."
msgid "Configure External Tools ..."
msgstr "הגדר כלים חיצוניים"
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "מגדיר \"בנה לזרוס\""
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "עזרה רגישת הקשר"
#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr ""
#: lazarusidestrconsts.lismenuconvertdelphipackage
#, fuzzy
#| msgid "Convert Delphi package to Lazarus package ..."
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "המר חבילת דלפי לחבילת לזארוס"
#: lazarusidestrconsts.lismenuconvertdelphiproject
#, fuzzy
#| msgid "Convert Delphi project to Lazarus project ..."
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "המר פרוייקט דלפי לפרוייקט לזארוס"
#: lazarusidestrconsts.lismenuconvertdelphiunit
#, fuzzy
#| msgid "Convert Delphi unit to Lazarus unit ..."
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "המר יחידת דלפי ליחידת לזארוס"
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert binary DFM to text LFM + check syntax ..."
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "המר קובץ בינארי DFM לקובץ בינארי LFM ובדוק תחביר ..."
#: lazarusidestrconsts.lismenuconvertencoding
#, fuzzy
#| msgid "Convert encoding of projects/packages ..."
msgid "Convert Encoding of Projects/Packages ..."
msgstr "המר את קידוד הפרויקט/חבילה ..."
#: lazarusidestrconsts.lismenudebugwindows
#, fuzzy
#| msgid "Debug windows"
msgid "Debug Windows"
msgstr "חלון ניפוי שגיאות"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr ""
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "ע&ריכה"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "תבניות קוד ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "ערוך עזרה רגישת הקשר"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Install/Uninstall packages ..."
msgid "Install/Uninstall Packages ..."
msgstr "התקן/הסר חבילות ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditoraddiconfroms
msgid "Add icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr ""
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr ""
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptioneditemss
msgid "Captioned items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
msgid "Change conflicting accelerator \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
msgid "Change %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
msgid "Change shortcut conflict \"%s\""
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
msgid "Change the shortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
msgid "Change the shortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
msgid "Conflicts found initially: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
msgid "Deepest nested menu level: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteitem
#, fuzzy
#| msgid "Delete Item"
msgid "&Delete item"
msgstr "מחק פריט"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
msgid "Editing Caption of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsdots
msgid "To resolve conflict edit %s.%s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingsfors
msgid "Editing %s for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
msgid "Editing %s.%s - no menuitem selected"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
msgid "Enter a new ShortCut for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexd
msgid "GroupIndex: %d"
msgstr ""
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
msgid "Values in use: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
msgid "Insert menu template into root of %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""
#: lazarusidestrconsts.lismenueditoritemswithicons
msgid "Items with icon: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
msgid "List shortcuts for %s ..."
msgstr ""
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "עורך תפריטים"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr ""
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
msgid "Menuitem shortcut conflicts in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "הזז למטה (או לימין)"
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "הזז למעלה (או לשמאל)"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorpickaniconfroms
msgid "Pick an icon from %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorpopupassignmentss
msgid "Popup assignments: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""
#: lazarusidestrconsts.lismenueditorremainingconflictss
msgid "Remaining conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolvedconflictss
msgid "Resolved conflicts: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""
#: lazarusidestrconsts.lismenueditorsconflictswiths
msgid "%s conflicts with %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutitemss
msgid "Shortcut items: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsd
msgid "Shortcuts (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedins
msgid "Shortcuts used in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
msgid "Shortcuts used in %s (%d)"
msgstr ""
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr ""
#: lazarusidestrconsts.lismenueditorsins
msgid "\"%s\" in %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut.\n"
msgstr ""
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcuts
msgid "%s: Shortcuts"
msgstr ""
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
msgid "%s: Shortcuts and accelerator keys"
msgstr ""
#: lazarusidestrconsts.lismenueditorsssonclicks
msgid "%s.%s.%s - OnClick: %s"
msgstr ""
#: lazarusidestrconsts.lismenueditorssubmenu
msgid "%s submenu"
msgstr ""
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr ""
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available.\n"
msgstr ""
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict\n"
msgstr ""
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""
#: lazarusidestrconsts.lismenuencloseinifdef
#, fuzzy
#| msgid "Enclose in $IFDEF..."
msgid "Enclose in $IFDEF ..."
msgstr "תחום ב $IFDEF..."
#: lazarusidestrconsts.lismenuencloseselection
#, fuzzy
#| msgid "Enclose selection ..."
msgid "Enclose Selection ..."
msgstr "צרף את הבחירה"
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "הערכה/שינוי ..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr ""
#: lazarusidestrconsts.lismenuextractproc
#, fuzzy
#| msgid "Extract procedure ..."
msgid "Extract Procedure ..."
msgstr "חלץ פרוצדורה ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "קובץ&"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "מצא"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "מצא& ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
#, fuzzy
#| msgid "Find other end of code block"
msgid "Find Other End of Code Block"
msgstr "מצא סיום אחר של בלוק קוד"
#: lazarusidestrconsts.lismenufindcodeblockstart
#, fuzzy
#| msgid "Find code block start"
msgid "Find Start of Code Block"
msgstr "מצא התחלת בלוק קוד"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
#, fuzzy
#| msgid "Find Declaration at cursor"
msgid "Find Declaration at Cursor"
msgstr "מצא הצהרה שבמקום הסמן"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "מצא מקורות המזהה"
#: lazarusidestrconsts.lismenufindinfiles
#, fuzzy
#| msgid "Find &in files ..."
msgid "Find &in Files ..."
msgstr "מצא בקבצים ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "מצא את הבא"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "מצא את הקודם"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr ""
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "אפשרויות ..."
#: lazarusidestrconsts.lismenugotoincludedirective
#, fuzzy
#| msgid "Goto include directive"
msgid "Goto Include Directive"
msgstr "לך להוראת \"כלול\""
#: lazarusidestrconsts.lismenugotoline
#, fuzzy
#| msgid "Goto line ..."
msgid "Goto Line ..."
msgstr "לך לשורה"
#: lazarusidestrconsts.lismenuguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced IFDEF/ENDIF"
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "נחש שגיאות במיקום IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
#, fuzzy
#| msgid "Guess unclosed block"
msgid "Guess Unclosed Block"
msgstr "נחש בלוקים לא סגורים"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "עזרה&"
#: lazarusidestrconsts.lismenuideinternals
#, fuzzy
#| msgid "IDE internals"
msgid "IDE Internals"
msgstr "תכונות פנימיות של ה IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "חיפוש מתקדם"
#: lazarusidestrconsts.lismenuindentselection
#, fuzzy
#| msgid "Indent selection"
msgid "Indent Selection"
msgstr "הזך בחירה"
#: lazarusidestrconsts.lismenuinsertchangelogentry
#, fuzzy
#| msgid "ChangeLog entry"
msgid "ChangeLog Entry"
msgstr "רשומה ביומן השינויים"
#: lazarusidestrconsts.lismenuinsertcharacter
#, fuzzy
#| msgid "Insert from Character Map"
msgid "Insert from Character Map ..."
msgstr "הכנס ממפת התווים"
#: lazarusidestrconsts.lismenuinsertcvskeyword
#, fuzzy
#| msgid "Insert CVS keyword"
msgid "Insert CVS Keyword"
msgstr "מלת מפתח של CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
#, fuzzy
#| msgid "Current date and time"
msgid "Current Date and Time"
msgstr "תאריך ושעה נוכחיים"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr ""
#: lazarusidestrconsts.lismenuinsertgeneral
#, fuzzy
#| msgid "General"
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "כללי"
#: lazarusidestrconsts.lismenuinsertgplnotice
#, fuzzy
#| msgid "GPL notice"
msgid "GPL Notice"
msgstr "הערת GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertlgplnotice
#, fuzzy
#| msgid "LGPL notice"
msgid "LGPL Notice"
msgstr "הערת LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
#, fuzzy
#| msgid "Modified LGPL notice"
msgid "Modified LGPL Notice"
msgstr "הערת LGPL מותאמת"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr ""
#: lazarusidestrconsts.lismenuinsertusername
#, fuzzy
#| msgid "Current username"
msgid "Current Username"
msgstr "שם המשתמש הנוכחי"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "פקח ..."
#: lazarusidestrconsts.lismenujumpback
#, fuzzy
#| msgid "Jump back"
msgid "Jump Back"
msgstr "קפוץ אחורה"
#: lazarusidestrconsts.lismenujumpforward
#, fuzzy
#| msgid "Jump forward"
msgid "Jump Forward"
msgstr "קפוץ קדימה"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "קפוץ אל"
#: lazarusidestrconsts.lismenujumptoimplementation
#, fuzzy
#| msgid "Jump to implementation"
msgid "Jump to Implementation"
msgstr "קפוץ למימוש"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr ""
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr ""
#: lazarusidestrconsts.lismenujumptonextbookmark
#, fuzzy
#| msgid "Jump to next bookmark"
msgid "Jump to Next Bookmark"
msgstr "קפוץ אל הסימניה הבאה"
#: lazarusidestrconsts.lismenujumptonexterror
#, fuzzy
#| msgid "Jump to next error"
msgid "Jump to Next Error"
msgstr "קפוץ אל השגיאה הבאה"
#: lazarusidestrconsts.lismenujumptoprevbookmark
#, fuzzy
#| msgid "Jump to previous bookmark"
msgid "Jump to Previous Bookmark"
msgstr "קפוץ אל הסימניה הקודמת"
#: lazarusidestrconsts.lismenujumptopreverror
#, fuzzy
#| msgid "Jump to previous error"
msgid "Jump to Previous Error"
msgstr "קפוץ אל השגיאה הקודמת"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr ""
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr ""
#: lazarusidestrconsts.lismenulowercaseselection
#, fuzzy
#| msgid "Lowercase selection"
msgid "Lowercase Selection"
msgstr "בחירת אותיות קטנות"
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr ""
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "צור מחרוזת משאבים ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr ""
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "רכיב חדש"
#: lazarusidestrconsts.lismenunewcustom
msgid "New %s"
msgstr ""
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "טופס חדש"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "חדש ..."
#: lazarusidestrconsts.lismenunewpackage
#, fuzzy
#| msgid "New package ..."
msgid "New Package ..."
msgstr "חבילה חדשה ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "פרויקט חדש ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
#, fuzzy
#| msgid "New Project from file ..."
msgid "New Project from File ..."
msgstr "פרויקט חדש מקובץ ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "יחידה חדשה"
#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "א&שר"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "עזרה מקוונת"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "פתח ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
#, fuzzy
#| msgid "Open filename at cursor"
msgid "Open Filename at Cursor"
msgstr "פתח שם קובץ במיקום הסמן"
#: lazarusidestrconsts.lismenuopenpackage
#, fuzzy
#| msgid "Open loaded package ..."
msgid "Open Loaded Package ..."
msgstr "פתח חבילה טעונה ..."
#: lazarusidestrconsts.lismenuopenpackagefile
#, fuzzy
#| msgid "Open package file (.lpk) ..."
msgid "Open Package File (.lpk) ..."
msgstr "פתח קובץ חבילה (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
#, fuzzy
#| msgid "Open package of current unit"
msgid "Open Package of Current Unit"
msgstr "פתח את החבילה של היחידה הנוכחית"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "פתח פרויקט ..."
#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open &Recent ..."
msgid "Open &Recent"
msgstr "פתח אחרונים ..."
#: lazarusidestrconsts.lismenuopenrecentpkg
#, fuzzy
#| msgid "Open recent package"
msgid "Open Recent Package"
msgstr "פתח חבילות אחרונות ..."
#: lazarusidestrconsts.lismenuopenrecentproject
#, fuzzy
#| msgid "Open Recent Project ..."
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "פתח פרויקטים אחרונים ..."
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr ""
#: lazarusidestrconsts.lismenupackage
#, fuzzy
#| msgid "&Package"
msgid "Pa&ckage"
msgstr "ח&בילה"
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "גרף החבילות ..."
#: lazarusidestrconsts.lismenupackagelinks
#, fuzzy
#| msgid "Package links ..."
msgid "Package Links ..."
msgstr "קישורי חבילה ..."
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr ""
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr ""
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "רשימת פרוצדורות"
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "פרויקט&"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "מפקח פרוייקט"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "אפשרויות פרויקט ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "הרץ"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "פרסם פרויקט..."
#: lazarusidestrconsts.lismenuquickcompile
#, fuzzy
#| msgid "Quick compile"
msgid "Quick Compile"
msgstr "הידור מהיר"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
#, fuzzy
#| msgid "Quick syntax check"
msgid "Quick Syntax Check"
msgstr "בדיקת תחביר מהירה"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "בדיקת תחביר מהירה תקינה"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "הסר מהפרוייקט"
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "שנה שם מזהה"
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug"
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "דיווח באגים ..."
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr ""
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
#, fuzzy
#| msgid "Rescan FPC source directory"
msgid "Rescan FPC Source Directory"
msgstr "סרוק שוב את תיקיית FPC"
#: lazarusidestrconsts.lismenuresetdebugger
#, fuzzy
#| msgid "Reset debugger"
msgid "Reset Debugger"
msgstr "אתחל את מנפה השגיאות"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "שחזר"
#: lazarusidestrconsts.lismenurun
#, fuzzy
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "ה&רץ"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "הרץ קובץ"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "הרץ פרמטרים ..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to &Cursor"
msgid "Step over to &Cursor"
msgstr "רוץ עד לסמן"
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr ""
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "שמור"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "שמור כ ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "שמור פרוייקט"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "שמור פרוייקט כ ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "חפש&"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "בחר"
#: lazarusidestrconsts.lismenuselectall
#, fuzzy
#| msgid "Select all"
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "בחר הכל"
#: lazarusidestrconsts.lismenuselectcodeblock
#, fuzzy
#| msgid "Select code block"
msgid "Select Code Block"
msgstr "בחר בלוק קוד"
#: lazarusidestrconsts.lismenuselectline
#, fuzzy
#| msgid "Select line"
msgid "Select Line"
msgstr "בחר שורה"
#: lazarusidestrconsts.lismenuselectparagraph
#, fuzzy
#| msgid "Select paragraph"
msgid "Select Paragraph"
msgstr "בחר קטע"
#: lazarusidestrconsts.lismenuselecttobrace
#, fuzzy
#| msgid "Select to brace"
msgid "Select to Brace"
msgstr "בחר עד לסוגריים"
#: lazarusidestrconsts.lismenuselectword
#, fuzzy
#| msgid "Select word"
msgid "Select Word"
msgstr "בחר מילה"
#: lazarusidestrconsts.lismenusetfreebookmark
#, fuzzy
#| msgid "Set a free bookmark"
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "קבע סימניה חופשית"
#: lazarusidestrconsts.lismenushowexecutionpoint
#, fuzzy
#| msgid "S&how execution point"
msgid "S&how Execution Point"
msgstr "הראה נקודת ביצוע"
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr ""
#: lazarusidestrconsts.lismenusortselection
#, fuzzy
#| msgid "Sort selection ..."
msgid "Sort Selection ..."
msgstr "סדר את הבחירה ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr ""
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step in&to"
msgid "Step In&to"
msgstr "קפוץ לתוך"
#: lazarusidestrconsts.lismenustepintocontext
#, fuzzy
#| msgid "Step into (Context)"
msgid "Step Into (Context)"
msgstr "צעד לתוך (הקשר)"
#: lazarusidestrconsts.lismenustepintoinstr
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "צעד לתוך ההוראה"
#: lazarusidestrconsts.lismenustepintoinstrhint
#, fuzzy
#| msgid "Step into instruction"
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "צעד לתוך ההוראה"
#: lazarusidestrconsts.lismenustepout
#, fuzzy
#| msgid "Step o&ut"
msgid "Step O&ut"
msgstr "קפוץ החוצה"
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "&Step over"
msgid "&Step Over"
msgstr "קפוץ מעבר ל"
#: lazarusidestrconsts.lismenustepovercontext
#, fuzzy
#| msgid "Step over (Context)"
msgid "Step Over (Context)"
msgstr "צעד מעבר (הקשר)"
#: lazarusidestrconsts.lismenustepoverinstr
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "צעד מעבר להוראה"
#: lazarusidestrconsts.lismenustepoverinstrhint
#, fuzzy
#| msgid "Step over instruction"
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "צעד מעבר להוראה"
#: lazarusidestrconsts.lismenuswapcaseselection
#, fuzzy
#| msgid "Swap case in selection"
msgid "Swap Case in Selection"
msgstr "החלף ראשיות באזור שנבחר"
#: lazarusidestrconsts.lismenutabstospacesselection
#, fuzzy
#| msgid "Tabs to spaces in selection"
msgid "Tabs to Spaces in Selection"
msgstr "החלף טאבים לרווחים בבחירה"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "אודות"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "מכיל"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "תפריט ערוך סטנדרטי"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "תפריט קובץ סטנדרטי"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "תפריט עזרה סטנדרטי"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "מצא"
#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "מצא את הבא"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "פתח אחרונים"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "מדריך"
#: lazarusidestrconsts.lismenutogglecomment
#, fuzzy
#| msgid "Toggle comment"
msgid "Toggle Comment in Selection"
msgstr "הצג (הראה/הסתר) הערות"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "כלים&"
#: lazarusidestrconsts.lismenuuncommentselection
#, fuzzy
#| msgid "Uncomment selection"
msgid "Uncomment Selection"
msgstr "בטל את סימון הבחירה כהערה"
#: lazarusidestrconsts.lismenuunindentselection
#, fuzzy
#| msgid "Unindent selection"
msgid "Unindent Selection"
msgstr "בטל את זיהוי הבחירה"
#: lazarusidestrconsts.lismenuuppercaseselection
#, fuzzy
#| msgid "Uppercase selection"
msgid "Uppercase Selection"
msgstr "בחירה באותיות ראשיות"
#: lazarusidestrconsts.lismenuuseunit
#, fuzzy
#| msgid "Add unit to uses section ..."
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "הוסף יחידה לסעיף \"משתמש ב\""
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "הצגה&"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "עורך המעגנים"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "נקודות עצירה"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "קרא למחסנית"
#: lazarusidestrconsts.lismenuviewcodebrowser
#, fuzzy
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "סייר הקוד"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "פלטת הרכיבים"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "ר&כיבים"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "דו\"ח איורעים"
#: lazarusidestrconsts.lismenuviewdebugoutput
#, fuzzy
#| msgid "Debug output"
msgid "Debug Output"
msgstr "פלט ניפוי השגיאות"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "טפסים ..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "היסטורית הקפיצות ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "משתנים מקומיים"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "הודעות"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "מפקח עצמים"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr ""
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "אוגרים"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "סייר הגבלות"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "תוצאות חיפוש"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "עורך קוד מקור"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtoggleformunit
#, fuzzy
#| msgid "Toggle form/unit view"
msgid "Toggle Form/Unit View"
msgstr "החלף בין הצגת טופס/יחידה"
#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "Unit Dependencies ..."
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "תלויות היחידה"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "מידע על היחידה"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "יחידות..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "משגיחים"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr ""
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "חל&ון"
#: lazarusidestrconsts.lismeother
#, fuzzy
#| msgid "Other"
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "אחר"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "עורך הודעות"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr ""
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "מחלקת המתודה לא נמצאה"
#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "ארועים חסרים"
#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr ""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "המזהים אינם קיימים"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "חבילות חסרות"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "האפשרויות שלך הן:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "הסר סימון"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "עבור דלפי בלבד"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) הסר סימון מהיחידות שנבחרו."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) השתמש ביחידות רק עבור דלפי"
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) חפש יחידות. הנתיבים שנמצאו הוספו להגדרות הפרוייקט."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) צא עכשיו, התקן חבילות או תקן את הנתיב ונסה שוב."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "חפש את נתיב היחידה"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "דלג על יחידה זאת"
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr ""
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr ""
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr ""
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr ""
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr ""
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr ""
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr ""
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr ""
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr ""
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr ""
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr ""
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr ""
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr ""
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr ""
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr ""
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr ""
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr ""
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr ""
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr ""
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr ""
#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr ""
#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr ""
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr ""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr ""
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""
#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ""
#: lazarusidestrconsts.lismodifiedlgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
#| "\n"
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך) של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "שנה"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "עוד"
#: lazarusidestrconsts.lismoresub
#, fuzzy
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "עוד"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr ""
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr ""
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr ""
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "הזז \"%s\" מיקום אחד למטה"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "הזז \"%s\" מיקום אחד למעלה"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr ""
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr ""
#: lazarusidestrconsts.lismovepage
#, fuzzy
#| msgid "Move Page ..."
msgid "Move Page"
msgstr "הזז דף ..."
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr ""
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr ""
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr ""
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr ""
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr ""
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr ""
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr ""
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr ""
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr ""
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr ""
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr ""
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ""
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "שמור הודעות לקובץ (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "שם"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "התנגשות בין שמות"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr ""
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "שם הפרוצדורה החדשה"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "אף פעם"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "חדש"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "מחלקה חדשה"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "יישום מסוף חדש"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "צור קובץ עורך חדש. %sבחר סוג."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "צור קובץ טקסט ריק"
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "צור פרויקט חדש.%sבחר סוג."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "צור חבילה סטנדרטית חדשה.%sחבילה היא אוסף של יחידות ורכיבים."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "צור יחידה חדשה עם datamodule."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "צור יחידה חדשה עם מסגרת."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "צור יחידה חדשה עם טופס LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "ירושה מפרוייקט טופס או רכיב"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "לא נבחר פריט"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "אנא בחר פריט מהרשימה"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "קידוד חדש:"
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr ""
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr ""
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr ""
#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "פרוייקט חדש - s%"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr ""
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
#, fuzzy
#| msgid "New units are added to uses sections:"
msgid "New units are added to uses sections"
msgstr "יחידות חדשות נוספו לאזור \"משתמש ב\":"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "לא"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "ללא קבצי גיבוי"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "לא נבחר פרופיל לבנייה"
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "אין שינוי"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "לא נבחר קוד"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "לא נורשו אפשרויות המהדר."
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "אין טיפים"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "לא נבחר חלון IDE"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "אין קובץ LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "לא נבחר מאקרו"
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "ללא שם"
#: lazarusidestrconsts.lisnone
#, fuzzy,badformat
msgid "%snone"
msgstr "ללא"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "ללא, הקלק כדי לבחור אחד"
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "לא נבחרה צומת"
#: lazarusidestrconsts.lisnopascalfile
#, fuzzy
#| msgid "No pascal file"
msgid "No Pascal file"
msgstr "אין קובץ פסקל"
#: lazarusidestrconsts.lisnoprogramfilesfound
#, fuzzy,badformat
#| msgid "No program file %s%s%s found."
msgid "No program file \"%s\" found."
msgstr "אף קובץ תכנית %s%s%s לא נמצא"
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "לא נמצא אזור של מחרוזת משאבים"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
#, fuzzy
#| msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "בדרך כלל מסנן הוא ביטוי רגולרי. בתחביר רגיל . היא תו רגיל, * מצינת כלשהו, ? מציינת תו בודד כלשהו, ופסיק ו ; מפרידים בין אפשרויות. לדוגמה: בתחביר פשוט*.pas;*.pp מתאים ל ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "לא נמצאו מחרוזת קבועות"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr ""
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "לא חבילה להתקנה"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
#, fuzzy
#| msgid "Not a valid pascal identifier"
msgid "Not a valid Pascal identifier"
msgstr "זה אינו מזהה פסקל חוקי"
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr ""
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "תחתית"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "שמאל"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "ימין"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "פסגה"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "הערה: לא יכול להגדיר תבנית עבור קוד Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "הערה: לא יכול להגדיר תבנית עבור קוד לזארוס"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr ""
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr ""
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "לא ממומש"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "לא ממומש עדיין: %s%s"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr ""
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "לא עכשיו"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr ""
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "צור"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "צור פרויקט חדש"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "מספר הקבצים להמרה: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr ""
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal ברירת מחדל"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "נתיב האובייקט"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "עבור למפקח העצמים ללשונית מועודפים"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (כבוי)"
#: lazarusidestrconsts.lisofpackage
msgid " of package %s"
msgstr ""
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr ""
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisoifclassnotfound
#, fuzzy,badformat
#| msgid "Class %s%s%s not found."
msgid "Class \"%s\" not found."
msgstr "המחלקה %s%s%s לא נמצאה"
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr ""
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "התקן אוטומטית באופן דינמי"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "התקן אוטומטית באופן סטטי"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "תאור:"
#: lazarusidestrconsts.lisoipdescriptiondescription
#, fuzzy,badformat
msgid "%sDescription: %s"
msgstr "תאור: s%"
#: lazarusidestrconsts.lisoipfilename
#, fuzzy,badformat
msgid "Filename: %s"
msgstr "שם קובץ: s%"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "הותקן באופן דינמי"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "הותקן באופן סטטי"
#: lazarusidestrconsts.lisoiplicenselicense
msgid "%sLicense: %s"
msgstr ""
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "חסר"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "שהשתנה"
#: lazarusidestrconsts.lisoipopenloadedpackage
#, fuzzy
#| msgid "Open loaded package"
msgid "Open Loaded Package"
msgstr "פתח חבילה טעונה"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "שם החבילה"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "אנא בחר בחבילה"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "קריאה בלבד"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "מצב"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, fuzzy,badformat
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "חבילה זאת מותקנת, אבל קובץ ה lpk לא נמצא"
#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "ok"
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "אשר"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "מחלקה קדומה"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (דלוק)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "בסוף השורה (למשל: מקש return או enter)"
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr ""
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr ""
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "חפש רק מילים שלמות"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "בהעתקה מהלוח הזמני"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "פתח"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "פתח כקובץ XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "פתח מעצב או פתח יחידה"
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr ""
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "פתח קובץ קיים"
#: lazarusidestrconsts.lisopenfile
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "פתח קובץ"
#: lazarusidestrconsts.lisopenfile2
#, fuzzy
#| msgid "Open file"
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "פתח קובץ"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "פתח %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "לפתוח חבילה?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "פתח חבילה %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "לפתוח קובץ חבילה"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "לפתוח פרויקט?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "פתח פרויקט"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "לפתוח פרויקט בשנית"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "לפתוח את קובץ הפרויקט"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "פתח symlink"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "פתח את המטרה"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "פתח את הקובץ כקוד מקור נורמאלי"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "האם לפתוח את החבילה %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "האם לפתוח את הפרויקט %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr ""
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr ""
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr ""
#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "אפשרויות"
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "אפשרויות השתנו, הדר (נקי) מחדש עם הפרמטר -B"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "או"
#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ""
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgstr ""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "מעמיס על השפה. דוגמא: language=he--. בשביל לקבל רשימה של ערכים אפשריים ראה את הקבצים בספריית השפות."
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, fuzzy,badformat
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "דרוס את מהדר ברירת המחדל לדוגמא ppc386 ppcx64 ppcppc וכו'. מהדר ברירת המחדל מאוחסן בקובץ environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy,badformat
#| msgid "%soverride the project build mode."
msgid "%soverride the project or IDE build mode."
msgstr "החלף את אופן הבנייה של הפרוייקט"
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, fuzzy,badformat
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "דרוס את מעבד ברירת המחדל של הפרוייקט לדוגמא ppc386 ppcx64 ppcppc וכו'. ברירת המחדל: s%"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, fuzzy,badformat
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "דרוס את מערכת ההפעלה שהיא ברירת המחדל לדוגמא win32 linux. ברירת המחדל: s%"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
#, fuzzy,badformat
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "דרוס את מערכת העצמים של הםרוייקט לדוגמא gtk gtk2 qt win32 carbon. ברירת המחדל: s%"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "האם לשכתב את הקובץ מחדש?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "משכתב את הקובץ מחדש על דיסק"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "\"הבעלים\" כבר בשימוש ע\"י TReader/TWriter. בחר שם אחר."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "חבילה"
#: lazarusidestrconsts.lispackage2
#, fuzzy,badformat
msgid "package %s"
msgstr "חבילה s%"
#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ""
#: lazarusidestrconsts.lispackageinfo
#, fuzzy
#| msgid "Package Info"
msgid "Package info"
msgstr "מידע על החבילה"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "שם החבילה מתחיל ב ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "שם החבילה מכיל ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "החבילה לא נמצאה"
#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr ""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr ""
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "יחידה של החבילה"
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr ""
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr ""
#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr ""
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr ""
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr "פרוש"
#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr ""
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "ספירת מעברים"
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "הדבק"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "הדבק את מה שבלוח הזמני"
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr ""
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "נתיב"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "דפדף"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr ""
#: lazarusidestrconsts.lispatheditmovepathdown
#, fuzzy
#| msgid "Move path down"
msgid "Move path down (Ctrl+Down)"
msgstr "הזז נתיב למטה"
#: lazarusidestrconsts.lispatheditmovepathup
#, fuzzy
#| msgid "Move path up"
msgid "Move path up (Ctrl+Up)"
msgstr "הזז נתיב למעלה"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr ""
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr ""
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr ""
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr ""
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "נתיב תבניות"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "נתיב חיפוש:"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr ""
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "נתיב של שרותי make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "נתיב אל מופע שנכשל:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "השהה"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr ""
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr ""
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr ""
#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr ""
#: lazarusidestrconsts.lispckeditaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "הוסף לפרוייקט"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "בצע שינויים"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, fuzzy,badformat
msgid "Call %sRegister%s procedure of selected unit"
msgstr "קרא לפרוצדורת הרישום של היחידה שנבחרה"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr ""
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "נקה את שם קובץ ברירת המחדל/מועדף של התלות"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "להדר הכל?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "הדר חבילה"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "אפשרויות מהדר לחבילה %s"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr ""
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "צור makefile"
#: lazarusidestrconsts.lispckeditdefault
#, fuzzy,badformat
msgid "%s, default: %s"
msgstr "ברירת מחדל"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "תכונות התלות"
#: lazarusidestrconsts.lispckediteditgeneraloptions
#, fuzzy
#| msgid "Edit General Options"
msgid "Edit general options"
msgstr "ערוך אפשרויות כלליות"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "תכונות קובץ"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "התקן"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "גירסה מקסימלית לא חוקית"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "גירסה מינימלית לא חוקית"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "גירסה מקסימלית:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "גירסה מינימלית"
#: lazarusidestrconsts.lispckeditmodified
#, fuzzy,badformat
msgid "Modified: %s"
msgstr "השתנה: s%"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "הזז תלות למטה"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "הזז תלות למעלה"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "חבילה %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, fuzzy
#| msgid "Package %s%s%s has changed.%sSave package?"
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "חבילה s%s%s% השתנתה. האם לשמור את החבילה?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "החבילה %s לא נשמרה"
#: lazarusidestrconsts.lispckeditpage
#, fuzzy,badformat
msgid "%s, Page: %s"
msgstr "עמוד: s%"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "הוסף תלות מחדש"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "הוסף קובץ מחדש"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "קריאה בלבד: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
#, fuzzy
#| msgid "Recompile all required"
msgid "Recompile All Required"
msgstr "הדר מחדש את כל מה שדרוש"
#: lazarusidestrconsts.lispckeditrecompileclean
#, fuzzy
#| msgid "Recompile clean"
msgid "Recompile Clean"
msgstr "נקה הידור מחדש"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "הדר זאת וכל החבילות הדרושות מחדש?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "תוספי רישום"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "יחידת רישום"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "הסר תלות"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "הסר תלות?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, fuzzy,badformat
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "הסר תלות s%s%s% מחבילה s%s%s%?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr ""
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "חבילות דרושות שהוסרו"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "הסר קובץ"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "להסיר את הקובץ?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, fuzzy,badformat
#| msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "הסר קובץ s%s%s% מחבילה s%s%s%?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "הסר את הפריט הנבחר"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "חבילות דרושות"
#: lazarusidestrconsts.lispckeditsavepackage
#, fuzzy
#| msgid "Save package"
msgid "Save Package"
msgstr "שמור חבילה"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "אחסן את שם הקובץ כברירת מחדל בתלות זאת"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "אחסן את שם הקובץ כמועדף בתלות זאת"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, fuzzy
#| msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "הגירסה המקסימלית s%s%s% היא לא גירסה חוקית של החבילה. (דוגמה נכונה 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, fuzzy
#| msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "הגירסה המינימלית s%s%s% היא לא גירסה חוקית של החבילה. (דוגמה נכונה 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "הסר התקנה"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "הצג בקוד החבילה"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr ""
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "מותקן"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "התקן בהתחלה הבאה"
#: lazarusidestrconsts.lispckexplstate
#, fuzzy,badformat
msgid "%sState: "
msgstr "מצב"
#: lazarusidestrconsts.lispckexpluninstallonnextstart
#, fuzzy
#| msgid "Uninstall on next start"
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "הסר התקנה בהתחלה הבאה"
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr ""
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "הוסף אפשרויות לפרוייקטים וחבילות תלויות"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "הוסף נתיבים לתלויות החבילות/פרוייקטים"
#: lazarusidestrconsts.lispckoptsauthor
#, fuzzy
#| msgid "Author:"
msgid "Author"
msgstr "מחבר:"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "בנה אוטומטית מחדש כשצריך"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "בנה אוטומטית מחדש בבנית הבל מחדש"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "מותאם אישית"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
#, fuzzy
#| msgid "Description/Abstract"
msgid "Description / Abstract"
msgstr "תאור/הפשטה"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
#, fuzzy
#| msgid "Designtime and Runtime"
msgid "Designtime and runtime"
msgstr "זמן עיצוב וזמן ריצה"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "אינטגרציית IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "הוסף"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "סוג חבילה לא חוקי"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "ספריה"
#: lazarusidestrconsts.lispckoptslicense
#, fuzzy
#| msgid "License:"
msgid "License"
msgstr "רשיון:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "מקשר"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "ראשי"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "הידור ידני (אף פעם לא אוטומטי)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "משני"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "אובייקט"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "אפשרויות חבילה"
#: lazarusidestrconsts.lispckoptspackagetype
#, fuzzy
#| msgid "PackageType"
msgid "Package type"
msgstr "סוג חבילה"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "מספק"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "הפצה"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr ""
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, fuzzy,badformat
#| msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "לחבילה s%s%s% יש דגל של התקנה אוטומטית.כלומר היא תותקן ע\"י ה IDE. חבילות ההתקנה חייבות להיות חבילות זמן עיצוב."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "חבילה זאת מספקת אותם דברים כמו החבילות הבאות:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
#, fuzzy
#| msgid "Update/Rebuild"
msgid "Update / Rebuild"
msgstr "עדכן/בנה מחדש"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "שימוש"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr ""
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr ""
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr ""
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr ""
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "בטל"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "התקדמות"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "קפל תיקייה"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "נמצאה התנגשות"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "ערוך יחידה וירטואלית"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "פרוש תיקייה"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "שם קובץ:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "תקן את רישיות האותיות בקבצים"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "שם קובץ יחידה לא חוקי"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "שם יחידה לא חוקי"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "חסרים קבצים של של החבילה %s"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "קובץ חדש לא בנתיב \"כלול\""
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "לא חסרים קבצים. כל הקבצים קיימים."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "הסר קבצים"
#: lazarusidestrconsts.lisperevertpackage
#, fuzzy
#| msgid "Revert package"
msgid "Revert Package"
msgstr "החזר חבילה לצצבה הקודם"
#: lazarusidestrconsts.lispesavepackageas
#, fuzzy
#| msgid "Save package as"
msgid "Save Package As ..."
msgstr "שמור חבילה בשם"
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "הראה מידרג תיקיות"
#: lazarusidestrconsts.lispeshowmissingfiles
#, fuzzy
#| msgid "Show missing files"
msgid "Show Missing Files"
msgstr "הראה קבצים חסרים"
#: lazarusidestrconsts.lispesortfiles
#, fuzzy
#| msgid "Sort Files"
msgid "Sort Files Permanently"
msgstr "סדר קבצים"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "סדר קבצים בסדר אלפבתי"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, fuzzy,badformat
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "הקובץ \"%s\" אינו נמצא כרגע בנתיב \"כלול\" של החבילה. האם להוסיף \"%s\" לנתיב \"כלול\""
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "שם יחידה:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "השתמש בכל היחידות בתיקייה"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "אל תשתמש באף יחידה מהתיקייה"
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr ""
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "הוספת CompiledSrcPath"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "תיקיית הפלט"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "סימון ספריית קוד המקור של החבילה"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "נתיב היחידה"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr ""
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, fuzzy,badformat
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "אתה באמת רוצה לשכוח את כל השינויים לחבילה s% ולטעון אותה מחדש מהקובץ?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "יחידה חדשה שאינה נמצאת בנתיב היחידות"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "פרסם חבילה"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "לשחזר חבילה?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, fuzzy
#| msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "הקובץ %s%s%s%s אינו בנתיב החבילה כרגע. להוסיף אותו לנתיב החבילה?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr ""
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "בינארי"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "קובץ \"כלול\""
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "סוגיות של קובץ xml"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "טקסט של טופס לזארוס - LFM"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "משאבים של לזארוס - LRS"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "יחידה ראשית"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "טקסט"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "יחידה ווירטואלית"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, fuzzy,badformat
#| msgid "%sAdding new Dependency for package %s: package %s%s"
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "הוספת תלות חדשה לחבילה s%:חבילה s%s%"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, fuzzy,badformat
#| msgid "%sAdding new Dependency for project %s: package %s%s"
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "הוספת תלות חדשה לפרוייקט s%:חבילה s%s%"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "הוסף יחידה לחלק ה uses של חבילה. בטל אפשרות זו רק עבור יחידות אשר לא אמורות להיות מהודרות בכל מקרה."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "נמצאו חבילות רב משמעיות"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "חבילות שהותקנו אוטומטית"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, fuzzy,badformat
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "שתי החבילות קשורות. כלומר כל חבילה משתמשת בשניה, או ששתיהן משתמשות בחבילה שלישית."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "תלות שבורה"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr ""
#: lazarusidestrconsts.lispkgmangcompilepackage
msgid "Compile package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "המחיקה נכשלה"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "למחוק את הקובץ הישן של החבילה?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, fuzzy,badformat
#| msgid "Delete old package file %s%s%s?"
msgid "Delete old package file \"%s\"?"
msgstr "מחק את קובץ החבילה הישן?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "תלויות ללא בעלים: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "שגיאה בקריאת קובץ"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "שגיאה בקריאת חבילה"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "שגיאה: עדכון קבצי po נכשל עבור חבילה %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "שגיאה בכתיבת קובץ"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "שגיאה בכתיבת חבילה"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "קובץ כבר בחבילה"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "קובץ נמצא בפרוייקט"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "שם הקובץ שונה משם החבילה"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "שם הקובץ בשימוש ע\"י חבילה אחרת"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "שם הקובץ נמצא בשימוש על ידי הפרויקט"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, fuzzy,badformat
#| msgid "File %s%s%s not found."
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "הקובץ %s%s%s לא נמצא."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "הקובץ לא נשמר"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, fuzzy,badformat
msgid "Installing the package %s will automatically install the package:"
msgstr "התקנת החבילה s% תתקין אוטומטית את החבילה:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, fuzzy,badformat
msgid "Installing the package %s will automatically install the packages:"
msgstr "התקנת החבילה s% תתקין אוטומטית את החבילות:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "שם קובץ לא חוקי של המהדר"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "סיומת הקובץ לא חוקית"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "סיומת קובץ החבילה אינו תקין"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "שם קובץ לא חוקי של החבילה "
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "שם החבילה אינו תקין"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "שם החבילה לא חוקי"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, fuzzy,badformat
#| msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "טעינת חבילה s% תחליף את החבילה s%s%s מקובץ %. החבילה הישנה שונתה. האם לשמור אותה?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "חבילה חדשה"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "חבילה: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "התנגשויות בחבילה"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
#, fuzzy
#| msgid "Package is no designtime package"
msgid "Package is not a designtime package"
msgstr "החבילה לא מכילה חבילה לזמן עיצוב"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "נדרשת חבילה"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "קובץ קוד המקור הראשי של החבילה"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "שם החבילה כבר קיים"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "חבילה חייבת להיות עם הסיומת .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "יש לשמור קודם את הקובץ לפני הוספתו לחבילה"
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "פרויקט: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "לבנות מחדש את לזרוס?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "לשנות שם קובץ לאותיות קטנות?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, fuzzy,badformat
#| msgid "Replace existing file %s%s%s?"
msgid "Replace existing file \"%s\"?"
msgstr "להחליף קובץ קיים %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "החלף קובץ"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr ""
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name.\n"
msgstr ""
#: lazarusidestrconsts.lispkgmangsavepackage
#, fuzzy
#| msgid "Save Package?"
msgid "Save package?"
msgstr "לשמור חבילה?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, fuzzy,badformat
msgid "Save Package %s (*.lpk)"
msgstr "שמור חבילה (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, fuzzy,badformat
#| msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "האם צריך לשנות את שם הקובץ לאותיות קטנות ל %s%s%s%s ?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "דלג על חבילה זאת"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "קובץ הגדרות לחבילות סטטיות"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
#, fuzzy,badformat
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "קובץ המהדר לחבילה s% אינו קובץ ריצה חוקי: s%s%"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, fuzzy,badformat
#| msgid "The file %s%s%s%sis already in the package %s."
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "הקובץ s%s%s% כבר נמצא בחבילה s%."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, fuzzy,badformat
#| msgid "The file %s%s%s is not a Lazarus package."
msgid "The file \"%s\" is not a Lazarus package."
msgstr "הקובץ %s%s%s אינו חבילה של לזארוס"
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, fuzzy,badformat
#| msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "שם הקובץ %s%s%s אינו מתאים לשם החבילה %s%s%s בקובץ. לשנות את שם החבילה ל %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, fuzzy,badformat
#| msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "שם הקובץ %s%s%s הוא חלק מהםרוייקט. פרוייקט וחבילה לא יכולים לחלוק בקבצים."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, fuzzy,badformat
#| msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "שם הקובץ %s%s%s בשימוש ע\"י חבילה %s%s%s בקובץ %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr ""
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "החבילה הבאה לא הצליחה להטען:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "החבילות הבאות לא הצליחו להטען:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, fuzzy
#| msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "היחידות הבאות יתוספו לסעיף \"משתמש ב\" של %s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
#, fuzzy,badformat
#| msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "הידור החבילה %s%s%s לא הצליח.להסיר אותה מרשימת ההתקנות?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, fuzzy,badformat
#| msgid "The package file name %s%s%s in%s%s%s%s is not a valid Lazarus package name."
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי של חבילת לזארוס."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, fuzzy,badformat
#| msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "החבילה %s היא חבילת זמן ריצה בלבד. אי אפשר להתקין חבילה כזאת ב IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy,badformat
#| msgid "The package %s%s%s is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "החבילה %s%s%s מסומנת להתקנה, אבל אי אפשר למצוא אותה.להסיר את התלות מרשימת ההתקנות של החבילות?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, fuzzy,badformat
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "החבילה s% דרושה ע\"י s%, אשר מסומנת להתקנה. ראה גרף החבילה."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, fuzzy,badformat
#| msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי, בחר שם אחר (למשל package1.lpk)."
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, fuzzy,badformat
#| msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "שם החבילה %s%s%s של הקובץ %s%s%s%s אינו חוקי."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "החבילה %s%s%s סומנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy
#| msgid "The package %s%s%s was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%s%sDo you want to rebuild Lazarus now?"
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "החבילה %s%s%s סומנה להתקנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, fuzzy
#| msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "הפרוייקט דורש את החבילה s%s%s%, אבל אי אפשר למצוא אותה. ראה Project -> Project Inspector."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, fuzzy,badformat
#| msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "יש שתי יחידות עם אותן השם: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s."
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr ""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, fuzzy,badformat
#| msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "יש יחידה של FPC עם אותו שם כמו של החבילה:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, fuzzy,badformat
#| msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "יש יחידה של FPC עם אותו שם כמו:%s%s%s%s%s%s מ %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, fuzzy,badformat
#| msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "יש כבר חבילה אחרת עם השם %s%s%s. מתנגש עם חבילה: %s%s%s%s קובץ %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy,badformat
#| msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Package -> Package Graph.%sReplace is impossible."
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "ש כבר חבילה s%s%s% אשר נטענה מקובץ %s%s%s. ראה Components -> Package Graph. החלפה אפשרית."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "יש חבילה לא שמורה בין החבילות הדרושות. ראה גרף החבילות."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, fuzzy,badformat
#| msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "יש יחידה עם אותן השם כמו חבילה: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s."
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "זאת חבילה וירטואלית. אין לה קוד עדיין. ראשית שמור את החבילה."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "לא ניתן ליצור את הספרייה"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
#, fuzzy,badformat
#| msgid "Unable to create output directory %s%s%s%sfor package %s."
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "לא ניתן ליצור את ספריית הפלט %s%s%s%sעבור החבילה %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
#, fuzzy,badformat
#| msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "לא ניתן ליצור את ספריית הקוד %s%s%s%sעבור החבילה %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy,badformat
#| msgid "Unable to create target directory for Lazarus:%s%s%s%s.%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "לא ניתן ליצור את ספריית היעד עבור לזרוס:%s%s%s%s.%sספרייה זו נחוצה עבור השינויים שנעשו ללזרוס עם החבילות שהותקנו."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
#, fuzzy,badformat
#| msgid "Unable to delete file %s%s%s."
msgid "Unable to delete file \"%s\"."
msgstr "לא ניתן למחוק את הקובץ %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "לא ניתן למחוק את הקובץ"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
#, fuzzy,badformat
#| msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "לא ניתן למחוק את קובץ המצב הישן %s%s%s%sעבור החבילה %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "לא מצליח לטעון את החבילה."
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
#, fuzzy,badformat
#| msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "לא ניתן לפתוח את החבילה %s%s%s.%sהחבילה סומנה להתקנה."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
#, fuzzy,badformat
#| msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "לא ניתן לקרוא את מצב הקובץ %s%s%s%sשל החבילה %s.%sשגיאה: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, fuzzy,badformat
#| msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "לא מצליח לכתוב את החבילה %s%s%s% לקובץ %s%s%s. שגיאה: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
#, fuzzy,badformat
#| msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "לא מצליח לכתוב קובץ מצב %s%s%s% של חבילה %s. שגיאה: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "להסיר את החבילה?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, fuzzy,badformat
msgid "Uninstall package %s?"
msgstr "להסיר את החבילה s%?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "חבילה לא שמורה"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "משתמש ביחידה"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, fuzzy,badformat
#| msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "אזהרה: הקובץ %s%s%s%s שייך לפרויקט הנוכחי."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "שמור "
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "חדש"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "הסר"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr ""
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "מותקן"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
#, fuzzy
#| msgid "Can not register components without unit"
msgid "Cannot register components without unit"
msgstr "לא יכול לרשום את הרכיבים ללא יחידה"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
#, fuzzy,badformat
#| msgid "Component Class %s%s%s already defined"
msgid "Component Class \"%s\" already defined"
msgstr "מחלקת רכיבים %s%s%s כבר מוגדרת"
#: lazarusidestrconsts.lispkgsysfilename
#, fuzzy
#| msgid "%s%sFile Name: %s%s%s"
msgid "%s%sFile Name: \"%s\""
msgstr "שם קובץ: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "מחלקת רכיבים לא חוקית"
#: lazarusidestrconsts.lispkgsysinvalidunitname
#, fuzzy,badformat
msgid "Invalid Unitname: %s"
msgstr "שם יחידה לא חוקי: s%"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: \"%s\""
msgstr ""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "הקובץ של החבילה לא נמצא"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "שגיאה ברישום החבילה"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "פרוצדורת הרישום ריקה"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "יחידת הרישום נקראה, אבל אף חבילה לא נרשמת."
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr ""
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
#, fuzzy,badformat
#| msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "החבילה %s%s%s מותקנת, אבל לא נמצא קובץ חוקי לחבילה (lpk.). חבילה שבורה מדומה נוצרה. "
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "זאת היא חבילת ברירת המחדל. משמשת רק לרכיבים ללא חבילה. רכיבים אלו לא מעודכנים."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "חבילה זאת מותקנת, אבל קובץ lpk לא נמצא. כל רכיביה נוטרלו. תקן זאת."
#: lazarusidestrconsts.lispkgsysunitname
#, fuzzy
#| msgid "%s%sUnit Name: %s%s%s"
msgid "%s%sUnit Name: \"%s\""
msgstr "שם יחידה: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "הקובץ הזה איננו באף חבילה שנטענה."
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr ""
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, fuzzy,badformat
#| msgid "Unable to read package file %s%s%s.%sError: %s"
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "לא ניתן לקרוא את קובץ החבילה %s%s%s.%sשגיאה: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr ""
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "גלובלי"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "קישורי חבילה"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr ""
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr ""
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "משתמש"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr "תקן בבקשה את שגיאה המופיעה בחלון ההודעות, הנמצא בדרך כלל מתחת לחלון עורך הטקסט."
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "אנא פתח יחידה לפני הרצה."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "אנא בחר את הקוד לחילוץ לפרוצדורה/מתודה חדשה."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<הכל>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "שנה גופן"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "העתקת שם מתודה ללוח הזמני"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "סנן ע\"י התאמת חלק כלשהוא של המתודה"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "סנן ע\"י התאמת התחלת המתודה"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "קפוץ אל הקטע שנבחר"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<ללא>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "אוב&ייקטים"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "רשימת פרוצדורות"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "סוג"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "בחר תיקייה לקובץ po."
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "אל תשמור שום מידע session"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "מצביע"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
#, fuzzy
#| msgid "Save in IDE config directory"
msgid "Save in .lps file in IDE config directory"
msgstr "שמור בתיקיית ההגדרות של ה IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "שמור בקובץ lpi."
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "שמור בקובץ lps. בתיקיית הפרוייקט"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "שמור מידע session ב"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ""
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr ""
#: lazarusidestrconsts.lispositionoutsideofsource
msgid "%s (position outside of source)"
msgstr ""
#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr ""
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "מלה קודמת"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "הספרייה הראשית בה לזרוס שומר את קבצי ההגדורת שלו. ברירת המחדל היא "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr ""
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr ""
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "עדיפות"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "פרטי"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "מתודה פרטית"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy,badformat
#| msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "כנראה שאתה צריך להתקין כמה חבילות לפני שתמשיך. אזהרה:s% הפרוייקט תלוי בכמה חבילות, המכילות יחידות עם פרוצדורות רישום. פרוצדורת רישום משמשת בדרך כלל להתקנת רכיבים ב IDE. אבל היחידות הבאות שייכות שייכות לחבילות שעדיין לא מותקנות ב IDE. אם תנסה לפתוח טופס ב IDE, אשר משתמש ברכיבים כאלו, תקבל שגיאה על רכבים חסרים וטעינת הטופס תיתן כנראה תוצאות לא נעימות. אין לזה השפעה על פתיחת הפרוייקט או איזה שהוא קובץ קוד שלו.זה רק אומר ש: זה רעיון גרוע לפתוח טופס לצורך עיצוב, לפני התקנת חבילות חסרות."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "פרוצדורה"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "פרוצדורות עם ממשקים"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "תוכנה"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "תוכנית התגלתה"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
#, fuzzy
#| msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "קובץ קוד המקור של תוכנה חייב להכיל סיומות כדוגמת .pas, .pp או .lpr"
#: lazarusidestrconsts.lisprojaddaddfilestoproject
#, fuzzy
#| msgid "Add files to project"
msgid "Add Files to Project"
msgstr "הוסף קבצים לפרוייקט"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "התלות כבר קיימת"
#: lazarusidestrconsts.lisprojaddeditorfile
#, fuzzy
#| msgid "Add editor files"
msgid "Add Editor Files"
msgstr "הוסף קבצי עורך"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "גירסה מינימלית-מקסימלית לא חוקית"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
#, fuzzy
#| msgid "Invalid pascal unit name"
msgid "Invalid Pascal unit name"
msgstr "שם לא חוקי של יחידת פסקל "
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "גירסה לא חוקית"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "גירסה מקסימלית (לא חובה):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "גגירסה מינימלית (לא חובה):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "דרישה חדשה"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "שם החבילה:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "החבילה לא נמצאה"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, fuzzy,badformat
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "התלות %s%s%s לא נמצאה. בחר חבילה קיימת."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, fuzzy,badformat
#| msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "הגרסה המרבית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "הגרסה המקסימאלית נמוכה מהגרסה המינימאלית."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, fuzzy,badformat
#| msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "הגרסה המינימלית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, fuzzy,badformat
#| msgid "The project has already a dependency for the package %s%s%s."
msgid "The project has already a dependency for the package \"%s\"."
msgstr "לפרוייקט כבר יש תלות בחבילה %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, fuzzy,badformat
#| msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "שם היחידה %s%s%s כבר קיים בפרוייקט עם קובץ: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, fuzzy,badformat
#| msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "שם היחידה %s%s%s כבר קיים בבחירה עם קובץ: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
#, fuzzy,badformat
#| msgid "The unit name %s%s%s is not a valid Pascal identifier."
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "שם היחידה %s%s%s אינו מזהה חוקי של פסקל."
#: lazarusidestrconsts.lisprojaddtoproject
#, fuzzy
#| msgid "Add to project"
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "הוסף לפרויקט"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "שם היחידה כבר קיים"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr ""
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr ""
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr ""
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "הפרויקט השתנה"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "הפרוייקט השתנה על הדיסק"
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr ""
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "תיקיית הפרויקט"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "הכותרת בשורת המשימות מראה גם את הנתיב אל תיקיית הפרוייקט"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "שם הקובץ של הפרויקט"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "פרוייקט כולל נתיב"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "התגלה קובץ המידע של הפרויקט"
#: lazarusidestrconsts.lisprojectinformation
#, fuzzy
#| msgid "Project Information"
msgid "Project information"
msgstr "מידע הפרויקט"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "הפרויקט בר ריצה"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr ""
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr ""
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "מאקרו תכונות הפרויקט"
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr ""
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "תיקיית הפלט של הפרוייקט (למשל תיקיית ה ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "התיקייה שבה חייב להיות הקובץ הראשי של הפרוייקט"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr ""
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr ""
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, fuzzy,badformat
msgid "Project %s raised exception class '%s'."
msgstr "הפרוייקט העלה חריגה במחלקה s%"
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, fuzzy,badformat
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "הפרוייקט העלה חריגה במחלקה s% עם הודעה: s%s%"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr ""
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "נתיב קוד המקור של הפרויקט"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "יחידת הפרוייקט"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "נתיב יחידות הפרויקט"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "אשף הפרויקטים"
#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr ""
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "אשר מחיקת תלויות"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "אשר הסרת קובץ"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, fuzzy,badformat
msgid "Delete dependency for %s?"
msgstr "למחוק תלות ב s%?"
#: lazarusidestrconsts.lisprojinspprojectinspector
#, fuzzy,badformat
msgid "Project Inspector - %s"
msgstr "מפקח הפרוייקט s%"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "חבילות דרושות שהוסרו"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, fuzzy,badformat
msgid "Remove file %s from project?"
msgstr "להסיר קובץ S% מהפרוייקט"
#: lazarusidestrconsts.lisprojinspremoveitemsf
msgid "Remove %s items from project?"
msgstr ""
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "לא ניתן לקרוא את קובץ המצב %s של הפרויקט %s%sשגיאה: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
#, fuzzy,badformat
msgid "Unable to write state file for project %s%sError: %s"
msgstr "לא יכול לכתוב את קובץ המצב של הפרוייקט s%s% שגיאה: s%"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "תמיד בנה (גם אם לא היה שינוי)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr ""
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "שגיאה"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "לא ניתן לשנות את רשימת הטפסים הנוצרים אוטומטית בקוד התוכנה.%sאנא תקן קודם את השגיאות."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "סימן תיקיית קוד המקור של הפרויקט"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "שאל על ערך"
#: lazarusidestrconsts.lisproperties
#, fuzzy
#| msgid "Properties (replace or delete)"
msgid "Properties (replace or remove)"
msgstr "תכונות (החלף או מחק)"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "מוגן"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "מתודה מוגנת"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "מתודה ציבורית"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "מתודה מסוג Published"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "פרסם את ספריית הפרויקט"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr ""
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
#, fuzzy
#| msgid "Invalid Exclude filter"
msgid "Invalid exclude filter"
msgstr "מסנן \"אל תכלול\" לא חוקי"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
#, fuzzy
#| msgid "Invalid Include filter"
msgid "Invalid include filter"
msgstr "מסנן \"כלול\" לא חוקי"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "שמור את קובץ lrs. בתיקיית הפלט"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr ""
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
#, fuzzy
#| msgid "A pascal unit must have the extension .pp or .pas"
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "ערוך יחידה וירטואלית"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "יש כבר יחידה בשם זה.%sקובץ: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
#, fuzzy
#| msgid "The unitname is not a valid pascal identifier."
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "שם יחידה זה אינו שם חוקי של מזהה פסקל."
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
#, fuzzy
#| msgid "The unitname is used when the IDE extends uses clauses."
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "שם היחידה בשימוש כאשר ה IDE פורש את סעיף ה \"משתמש ב\" ."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "שם היחידה ושם הקובץ לא מתאימים. לדוגמה: unit1.pas ו Unit1 "
#: lazarusidestrconsts.lispwconvertproject
#, fuzzy
#| msgid "Convert Delphi Project"
msgid "Convert &Delphi Project"
msgstr "המר פרוייקט דלפי"
#: lazarusidestrconsts.lispwnewproject
#, fuzzy
#| msgid "New Project"
msgid "&New Project"
msgstr "פרויקט חדש"
#: lazarusidestrconsts.lispwopenproject
#, fuzzy
#| msgid "Open Project"
msgid "&Open Project"
msgstr "פתח פרויקט"
#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent Project"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "פתח פרוייקט אחרון"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr ""
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "תיקונים מהירים"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "תיקון מהיר: הסר את היחידה"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "חפש מזהה"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "יציאה"
#: lazarusidestrconsts.lisquitlazarus
#, fuzzy
#| msgid "Quit Lazarus"
msgid "&Quit Lazarus"
msgstr "צא מלזרוס"
#: lazarusidestrconsts.lisrange
#, fuzzy
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "טווח"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "שגיאת קריאה"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr ""
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr ""
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "רשומה"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr ""
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "רשומה/מבנה נתונים"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "בצע שוב"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "אוגרים"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "ביטוי רגולרי"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr ""
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "נתיב יחסי"
#: lazarusidestrconsts.lisremove
#, fuzzy
#| msgid "remove"
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "הסר"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr ""
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "הסר את כל התכונות הלא חוקיות"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr ""
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "הסר את כל היחידות"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr ""
#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr ""
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "הסר מרשימת ההתקנות"
#: lazarusidestrconsts.lisremovefromproject
#, fuzzy
#| msgid "Remove from project"
msgid "Remove from Project"
msgstr "הסר מהפרוייקט"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "הסר מנתיב החיפוש"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "להסיר נתיב \"כלול\" ?"
#: lazarusidestrconsts.lisremovelocalvariable
#, fuzzy,badformat
msgid "Remove local variable %s"
msgstr "הסר משתנה מקומי s%"
#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr ""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
#, fuzzy
#| msgid "Remove non existing files"
msgid "Remove nonexistent files"
msgstr "הסר קבצים לא קיימים"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "הסר את היחידות שנבחרו"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "הסר אותם"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "הסר את הנתיבים מ \"Other sources\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "להסיר נתיב היחידות ?"
#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr ""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "שנה שם"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr ""
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "לשנות שם קובץ?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "שינוי שם הקובץ נכשל"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr ""
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "שנה שם ל %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "שנה שם לאותיות קטנות"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "פתח פרוייקט מחדש"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "פתח מחדש בקידוד אחר"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "חזור"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "חזור על הספירה:"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "החלף"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "החלפה"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "פונקציות חלופיות"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "תחליפים"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "תקן תכונות וסוגים לא מוכרים"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr ""
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "החלפת הבחירה נכשלה."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "סרוק מחדש"
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr ""
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr ""
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr ""
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr ""
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "שגיאה בשמירת משאב"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
#, fuzzy
#| msgid "Resource type of project:"
msgid "Resource type of project"
msgstr "סוג משאב של הפרוייקט"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "אתחל"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "תוצאה:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
msgstr ""
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
#, fuzzy
#| msgid ""
#| "returns list of all values of case variable in front of variable\n"
#| "\n"
#| "Optional Parameters (comma separated):\n"
#| "WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgstr "מחזיר רשימה של כל הערכים של משתנה case לפני המשתנה"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "השחזור נכשל"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "ימין"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "עיגון לימין"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "רווח גבול ימני. ערך זה מתווסף לרווח הבסיסי ומשמש לרווח מימין לפקד."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "זהו פקד האח איליו מעוגן הצד הימני. השאר ריק עבור הורה."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "צדדים ימניים"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "רווח מימין במידה שווה"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Root"
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr ""
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "הרץ"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr ""
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "ריצה"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "(רץ ...) %s"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "הקובץ אינו קובץ ריצה"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, fuzzy,badformat
#| msgid "The host application %s%s%s is not executable."
msgid "The host application \"%s\" is not executable."
msgstr "היישום המארח %s%s%s אינו קובץ ריצה"
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "ריצה"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr ""
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr ""
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr ""
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "\"הרץ עד ל\" נכשל"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
#, fuzzy
#| msgid "Abstract methods - not yet overridden"
msgid "Abstract Methods - not yet overridden"
msgstr "מתודה מופשטת - עדיין לא נדרסה"
#: lazarusidestrconsts.lissamabstractmethodsof
#, fuzzy,badformat
msgid "Abstract methods of %s"
msgstr "מתודה מופשטת של s%"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "הסמן אינו בהצהרת המחלקה"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "סביבת הפיתוח עסוקה"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, fuzzy,badformat
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "זוהי מחלקה מופשטת, יש לה מתודה מופשטת."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "לא נמצאה מתודה מופשטת"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "שכתב את כל מה שנבחר"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "שכתב את מה שנבחר ראשון"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "בחר בכלום"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, fuzzy,badformat
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "יש מתודות מופשטות לשכתוב. בחר את המתודות שעבורן צריך ליצור שארית:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "לא נשארו מתודות מופשטות לשכתוב."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "אי אפשר לעדכן את המתודה כי היא מוגדרת במחלקה הנוכחית"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "לא ניתן להציג את מתודות מופשטות של המחלקה הנוכחית, בגלל"
#: lazarusidestrconsts.lissave
#, fuzzy
#| msgid "Save ..."
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "שמור ..."
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "שמור הכל"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr ""
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "שמור את כל הקבצים ששונו"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "שמור וצא מהדיאלוג"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "שמור ובנה מחדש את ה IDE"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "שמור כ"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr ""
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "לשמור שינויים?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "לשמור שינויים לפרויקט %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "שמור את הקובץ הנוכחי שבעורך"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr ""
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr ""
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "שמור מידע עורך על קבצים שאינם של הפרוייקט"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "שמור קובץ כ"
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, fuzzy,badformat
#| msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "לשמור את הקובץ %s%s%s%s לפני סגירת הטופס %s%s%s?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "שמור מידע של קבצי עורך סגורים"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr ""
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr ""
#: lazarusidestrconsts.lissaveproject
#, fuzzy,badformat
msgid "Save project %s (*%s)"
msgstr "שמור את פרוייקט %s "
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr ""
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr ""
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr ""
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "שמור הגדרות"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr ""
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "שמור"
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr ""
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "קנה מידה:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr ""
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr ""
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr ""
#: lazarusidestrconsts.lisscanning2
msgid "%s. Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr ""
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr ""
#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr ""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "תיקיית הגדרות משנית, המיקום בו לזרוס יחפש את תבנית קבצי ההגדרות . ברירת המחדל היא "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr ""
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr ""
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "ראה הודעות."
#: lazarusidestrconsts.lisseeprojectprojectinspector
#, fuzzy,badformat
msgid "%sSee Project -> Project Inspector"
msgstr "ראה Project -> Project Inspector"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "בחר פריט עזרה"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "בחר צומת"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr ""
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "בחר טפסים של דלפי (dfm.*)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "נבחר"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr ""
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr ""
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(שכן תחתון שנבחר)"
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr ""
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr ""
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr ""
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(שכן שמאלי שנבחר)"
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr ""
#: lazarusidestrconsts.lisselectedmodeswerebuilt
msgid "Selected %d modes were successfully built."
msgstr ""
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(שכן ימני שנבחר)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(שכן עליון שנבחר)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "בחר את הקובץ"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr ""
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "הבחירה חורגת מגבולות המחרוזת"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "כלי בחירה"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr ""
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr ""
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr ""
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "קבע ברירת מחדל"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
#, fuzzy
#| msgid "(Setup default indentation)"
msgid "(Set up default indentation)"
msgstr "(קבע זיהוי ברירת מחדל)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "קצר:"
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr ""
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr ""
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr ""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr ""
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "הראה טיפים של הצהרה"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "הראה הבדלים בין האופנים..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "הראה יחידות/חבילות ריקות"
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr ""
#: lazarusidestrconsts.lisshowglyphsfor
#, fuzzy
#| msgid "Show Glyphs for:"
msgid "Show Glyphs for"
msgstr "הראה גליף עבור:"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "הראה gutter"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr ""
#: lazarusidestrconsts.lisshowhintsinobjectinspector
#, fuzzy
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "הראה רמזים"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "הראה מזהים"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "הראה תיבת מידע"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr ""
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr ""
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr ""
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr ""
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "הראה חבילות"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "הראה מיקום של עורך הקוד"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr ""
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr ""
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr ""
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr ""
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "הראה דיאלוג הגדרות עבור ההגדרות החשובות ביותר"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "הראה תווים מיוחדים"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
#, fuzzy
#| msgid "Show status bar"
msgid "Show statusbar"
msgstr "הראה שורת מצב"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "הראה יחידות"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr ""
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr ""
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr ""
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
#, fuzzy
msgid "Show value hints while debugging"
msgstr "הראה טיפים חשובים בזמן ניפוי השגיאות"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "הראה גירסה וצא"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "כווץ לקטן ביותר"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "אח"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr ""
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr ""
#: lazarusidestrconsts.lissimplesyntax
#, fuzzy
#| msgid "Simple Syntax"
msgid "Simple syntax"
msgstr "תחביר פשוט"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "דלג על הקובץ"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "דלג על הקובץ והמשך בטעינה"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "דלג על טעינת הפרויקט האחרון"
#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr ""
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr ""
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr ""
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "התאמות"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "מצטער, סוג זה לא ממומש עדיין"
#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr ""
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr ""
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "עולה"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "תלוי ברישיות&"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "יורד"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "מתחם"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "התעלם מרווח"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "שורות"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "אפשרויות"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "פיסקאות"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "תצוגה מקדימה"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "קבל"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "סדר את הבחירה"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "מילים"
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr ""
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "המקור והיעד זהים: %s%s"
#: lazarusidestrconsts.lissourcebreakpoint
#, fuzzy
#| msgid "&Source Breakpoint..."
msgid "&Source Breakpoint ..."
msgstr "נקודת עצירה בקוד"
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
#, fuzzy,badformat
#| msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
msgstr "תיקיית המקור %s%s%s% ותיקיית היעד %s%s%s% זהות. יתכן שלא הבנת תכונה זאת. היא תנקה/תיצור מחדש את תיקיית היעד ותעתיק אליה את החבילה/פרוייקט."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, fuzzy,badformat
#| msgid "Source directory %s%s%s does not exist."
msgid "Source directory \"%s\" does not exist."
msgstr "תיקיית המקור %s%s%s לא קיימת"
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr ""
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "המקור השתנה"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, fuzzy,badformat
#| msgid "Source of page %s%s%s has changed. Save?"
msgid "Source of page \"%s\" has changed. Save?"
msgstr "המקור של דף השתנה %s%s%s. לשמור?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "נתיב למקור"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "רווח במידה שווה"
#: lazarusidestrconsts.lissrcos
#, fuzzy
msgid "Src OS"
msgstr "מערכת הפעלה של הקוד"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "מחפש"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "חפש טקסט"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "התחל בהמרה"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr ""
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "התחל עם פרוייקט חדש"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr ""
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "עצור"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "להפסיק את ניפוי השגיאות הנוכחי ולבנות מחדש?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "להפסיק את ניפוי השגיאות?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "להפסיק את ניפוי השגיאות?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "עצור אם יש חריגה"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "להפסיק את ניפוי השגיאות?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "קובץ lpi מוזר"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "שגיאת זרימה"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "מחרוזת"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "סגנון"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "תת שגרה"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "תת שגרה באותה רמה"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "הצלחה"
#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimported
msgid "Successfully imported from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
msgid "Successfully imported compiler options from \"%s\"."
msgstr ""
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr ""
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "נתיב \"כלול\" חשוד"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "נתיב יחידה חשוד"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN Revision: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "שם משתנה לא חוקי"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, fuzzy,badformat
#| msgid "%s%s%s is not a valid identifier."
msgid "\"%s\" is not a valid identifier."
msgstr " לא מזהה חוקי %s%s%s"
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "עדכן את משתני המערכת"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr ""
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr ""
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "מצב תחביר"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr ""
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "לשונית"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr ""
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr ""
#: lazarusidestrconsts.listaborderof
#, fuzzy,badformat
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "סדר לשוניות של "
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr ""
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr ""
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr ""
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr ""
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr ""
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr ""
#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "מעבד היעד"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "שם קובץ המטרה: (ריק = השתמש בתיקיית הפלט של היחידה)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "שם קובץ היעד (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "קובץ המטרה של הפרוייקט"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "שם קובץ המטרה והפרמטרים שלו"
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr ""
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "מערכת ההפעלה המיועדת"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "תא בר עריכה"
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, fuzzy,badformat
#| msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "מכניס תא בר עריכה, עם ערך ברירת מחדל, (Sync=n (,S=n, לסינכרון עם התא הקודם מ n=1 ועד לתא הקודם הגבוה ביותר. ברירת המחדל היא לסנכרן עם התא הקודם עם אותה ברירת מחדל "
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "תיקיית ביקורת"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr ""
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "חבילת היישומים נוצרה עבור \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy,badformat
#| msgid "The class %s%s%s is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "המחלקה %s%s%s היא TControl ואי אפשר להדביק אותה על מחלקה שאינה פקד. לא יכול להדביק."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
#, fuzzy,badformat
#| msgid "The Codetools found an error:%s%s%s"
msgid "The Codetools found an error:%s%s"
msgstr "נמצאה שגיאה: %s%s%s ע\"י CodeTools"
#: lazarusidestrconsts.listhecommandafterisnotexecutable
#, fuzzy,badformat
#| msgid "The command after %s%s%s is not executable."
msgid "The command after \"%s\" is not executable."
msgstr "הפקודה אחרי %s%s%s אינה ברת ביצוע"
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
#, fuzzy,badformat
#| msgid "The command after publishing is invalid:%s%s%s%s"
msgid "The command after publishing is invalid:%s\"%s\""
msgstr "הפקודה אחרי הפירסום אינה חוקית: %s%s%s%s"
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, fuzzy,badformat
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "לא ניתן למחוק את הרכיב, כי הוא שייך ל s%."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, fuzzy,badformat
#| msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "עורך הרכיבים של מחלקה %s%s%s גרם לשגיאה: %s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, fuzzy,badformat
#| msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "עורך הרכיבים של מחלקה %s%s%s שהופעל ע\"י פעולה #%s %s%s%s%s גרם לשגיאה: %s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, fuzzy,badformat
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "הרכיב s% הוא ירושה מ s%. כדי למחוק רכיב מורש פתח את האב ומחק אותו שם."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, fuzzy,badformat
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "הרכיב s% הוא ירושה מ s%. כדי לשנות שם רכיב מורש פתח את האב ומחק אותו שם."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
#, fuzzy
#| msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "שם הרכיב חייב להיות יחודי בין כל הרכיבים של הטופס/מודול הנתונים.השם מושווה ללא רגישות לראשיות כמו כל מזהה פסקל נורמלי."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr ""
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, fuzzy
#| msgid "The %s contains a not existing directory:%s%s"
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "ה %s מכיל תיקייה בלתי קיימת %s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, fuzzy,badformat
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "ה %s מכילה את התו כוכבית. לאזרוס משתמש בו כתו רגיל ולא פורש אותו כמסכת קבצים."
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr ""
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy,badformat
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "מנפה השגיאות אינו קיים או שאינו קובץ ריצה. ראה Environment -> Debugger Options"
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr ""
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, fuzzy,badformat
#| msgid "The destination directory%s%s%s%s does not exist."
msgid "The destination directory%s\"%s\" does not exist."
msgstr "תיקיית היעד %s%s%s%s אינה קיימת. "
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
#, fuzzy,badformat
#| msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "תיקיית היעד %s%s%s%s אינה קיימת. בדוק את שם קובץ המטרה של הפרוייקט Menu > Project > Project Options."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "התיקייה \"%s\" לא מכילה יותר שום קבצי \"כלול\" של הפרוייקט. להסיר את התיקייה מנתיב החיפוש של קבצי \"כלול של הפרוייקט ?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "התיקייה \"%s\" לא מכילה יותר שום יחידות של הפרוייקט. להסיר את התיקייה מנתיב החיפוש של יחידות הפרוייקט ?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, fuzzy,badformat
#| msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "התיקייה %s%s%s%s אינה דרושה עוד בנתיב היחידה. להסיר אותה?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
#, fuzzy,badformat
#| msgid "The directory %s%s%s is not writable."
msgid "The directory \"%s\" is not writable."
msgstr "התיקייה %s%s%s%s אינה מורשה לכתיבה."
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
#, fuzzy,badformat
#| msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
msgstr "התיקייה %s%s%s%s עדיין אינה בנתיב היחידה. להוסיף אותה?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "התיקייה %s לא נמצאה. "
#: lazarusidestrconsts.listhefile
#, fuzzy,badformat
#| msgid "The file %s%s%s"
msgid "The file \"%s\""
msgstr " הקובץ %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
#, fuzzy,badformat
msgid "The file %s does not look like a lpi file."
msgstr "הקובץ s% לא נראה כמו קובץ lpi."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "אינדקס הקובץ דרוש לפונקציות כמו \"מצא הצהרה\". בזמן הסריקה אתה יכול לערוך את הקוד ולהדרו, אבל פונקציות כאלו יתנו שגיאות \"יחידה לא נמצאה\". זה יכול לקחת דקה."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
#, fuzzy,badformat
#| msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "הקובץ %s%s%s הוא קישור סימבולי. לפתוח את %s%s%s במקומו?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, fuzzy
#| msgid "The file %s%s%s is not a Lazarus project.%sCreate a new project for this %s?"
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "הקובץ %s%s%s אינו פרוייקט של לזארוס. האם ליצור פרוייקט חדש בשבילו?"
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr ""
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy
#| msgid "The file %s%s%s%sseems to be a program. Close current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "הקובץ %s%s%s נראה כתוכנית. לסגור את הפרוייקט הנוכחי וליצור פרוייקט לזארוס חדש? No יגרום לטעינת הקובץ כקובץ קוד רגיל."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, fuzzy
#| msgid "The file %s seems to be the program file of an existing lazarus Project."
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "הקובץ %s נראה כקובץ תוכנית של פרוייקט לזארוס קיים."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
#, fuzzy
#| msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr "הקובץ %s%s%s%s נמצא באחת מתיקיות הקוד של החבילה ונראה כמו יחידה מהודרת. יחידות מהודרות חייבות להיות בתיקיית הפלט של החבילה, אחרת חבילות אחרות ייתקלו בבעיות בשימוש בחבילה זאת. האם למחוק את הקובץ הבעייתי?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, fuzzy,badformat
#| msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "הקובץ %s%s%s%s לא נמצא. האם אתה רוצה למצוא אותו בעצמך?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, fuzzy,badformat
#| msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "הקובץ %s%s%s%s לא נמצא. \"התעלם\" יגרום להמשך טעינת הפרוייקט, \"צא\" יעצור את הטעינה."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, fuzzy,badformat
#| msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "המתודות הבאות שבשימוש s% אינם במקורות %s%s%s%s%s%s האם להסיר את המקורות הרעועים?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "המזהה הוא יחידה. השתמש ב File - Save כאמצעי לשינוי שם היחידה."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, fuzzy,badformat
#| msgid "The key %sis already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "המקש %s% כבר מוקצה ל s%. להסיר את ההקצאה הישנה למקש עבור הפונקציה החדשה?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, fuzzy,badformat
#| msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "חבורת היישומים s%s% הדרושה להרצה לא קיימת או שאינה ברת ריצה. האם אתה רוצה ליצור אחת? ראה Project -> Project Options -> Application for settings."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, fuzzy,badformat
#| msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "היישום המשגר %s%s%s%s לא קיים או שאינו בר ריצה. ראה Run -> Run parameters -> Local"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr ""
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr ""
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "קובץ ה LFM (טופס לזארוס) מכיל תכונות לא חוקיות. כלומר הוא מכיל למשל כמה תכונות/מחלקות, אשר לא קיימות ב LCL הנוכחי. התיקון הרגיל הוא להסיר תכונות אלו מקובץ ה lfm ולתקן ידנית את קוד הפסקל."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr ""
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, fuzzy,badformat
#| msgid "The new include file is not yet in the include search path.%sAdd directory %s to build modes?"
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "קובץ \"כלול\" החדש עדיין לא בנתיב החיפוש. האם להוסיף את התיקייה %s ?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, fuzzy,badformat
#| msgid "The new unit is not yet in the unit search path.%sAdd directory %s to build modes?"
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "היחידה החדשה עדיין אינה בנתיב חיפוש היחידות. להוסיף תיקייה?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr ""
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, fuzzy,badformat
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "ה \"Other sources\" מכיל תיקייה שכבר נמצאת ב \"Other unit files\"."
#: lazarusidestrconsts.listheoutputdirectoryismissing
#, fuzzy,badformat
#| msgid "The output directory %s%s%s is missing."
msgid "The output directory \"%s\" is missing."
msgstr "תיקיית הפלט %s%s%s חסרה."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, fuzzy,badformat
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של קבצי ה\"כלול\"."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, fuzzy,badformat
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש המורשים של קבצי ה\"כלול\"."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, fuzzy,badformat
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות המורשות."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, fuzzy,badformat
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "תיקיית הפלט צריכה להיות תיקייה נפרדת שאינה מכילה קבצי קוד."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "למחלקה שהיא הבעלים יש את השם הזה"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "לבעלים יש את השם הזה"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, fuzzy,badformat
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "החבילה %s מוסיפה את הנתיב \"%s\" לנתיב \"כלול\" של ה IDE. זוהי כנראה הגדרה שגוייה של החבילה."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, fuzzy,badformat
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "החבילה %s מוסיפה את הנתיב \"%s\" לנתיב היחידה של ה IDE. זוהי כנראה הגדרה שגוייה של החבילה."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "החבילה כבר מכילה יחידה עם שם זה."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr ""
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, fuzzy,badformat
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "אי אפשר להסיר את התקנת החבילה, כי היא דרושה ל IDE עצמו."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, fuzzy,badformat
#| msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "לחבילה %s אין אף פרוצדורת רישום, שבדרך כלל אומר שהיא לא מספקת שום תוסף ל IDE. התקנתה רק תגדיל את גודל ה IDE ויכולה אפילו לגרום לחוסר יציבות.טיפ: אם אתה רוצה להשתמש בחבילה בפרוייקט שלך, השתמש בתפריט \"Add to project\"."
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr ""
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr ""
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy,badformat
#| msgid "The program %smake%s was not found.%sThis tool is needed to build Lazarus.%s"
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "התוכנית make לא נמצאה. כלי זה דרוש לבניית לזארוס."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "אפשרויות המהדר לפרוייקט, וההוראות בקובץ הקוד הראשי שונות. עבור היחידה החדשה משתמש באפשרויות האופן וסוג המחרוזות של הפרוייקט."
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, fuzzy,badformat
#| msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "הפרוייקט לא משתמש ביחידות ממשקים של LCL, אבל נראה שהיא זקוקה להן. תקבל שגיאות מקשר מוזרות אם תשתמש בטפסי LCL ללא ממשקים."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "לפרוייקט אין קובץ קוד ראשי"
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, fuzzy,badformat
#| msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "קובץ מידע הפרוייקט %s%s%s%s זהה לקובץ הקוד הראשי של הפרוייקט!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, fuzzy,badformat
#| msgid "The project information file %s%s%s%shas changed on disk."
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "קובץ מידע הפרוייקט %s%s%s%s השתנה על הדיסק."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy,badformat
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "הפרוייקט חייב להשמר לפני הבנייה. אם תקבע את תיקיית הביקורת באפשרויות הסביבה, תוכל ליצור פרוייקטים חדשים ולבנות אותם מיד. לשמור את הפרוייקט?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, fuzzy,badformat
#| msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "הפרוייקט משתמש כמטרה במערכת ההפעלה = s% ובמעבד = s%. הקובץ system.ppu עבור מטרה זאת לא נמצא בתיקיית הקבצים הבינאריים של FPC.ודא ש fpc מותקו כראוי עבור מטרה זאת ושהקובץ fpc.cfg מכיל את התיקיות הנכונות."
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "הפרוייקט משתמש במשאבי FPC חדשים, אשר דורשים לפחות FPC 2.4"
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr ""
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
msgid "%sThere are additional notes for this message on%s"
msgstr ""
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr ""
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, fuzzy,badformat
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "יש קבצים נוספים בתיקייה בעלי אותו שם, אשר נבדלים רק בראשיות: האם למחוק אותם?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, fuzzy
#| msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "יש קובץ בעל אותו שם וסיומת דומה בדיסק קובץ: %s%s קובץ רב משמעי: %s%s%s , האם למחוק את הבעייתי?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "יש כבר רכיב עם שם זה. "
#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, fuzzy,badformat
#| msgid "There is already a form with the name %s%s%s"
msgid "There is already a form with the name \"%s\""
msgstr "יש כבר טופס עם השם %s%s%s. "
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "יש כבר מאקרו של IDE בשם \"%s\""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, fuzzy,badformat
#| msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "יש כבר יחידה עם השם %s%s%s. מזהה פסקל חייב להיות ייחודי."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, fuzzy,badformat
#| msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "יש כבר יחידה עם השם %s%s%s בפרוייקט. בחר שם אחר."
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr ""
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "חייב להיות לפחות אופן בנייה אחד."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, fuzzy,badformat
#| msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "מחלקת המשאבים %s%s%s עברה בירושה מ s%s%s%. כנראה זאת שגיאת דפוס של TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "הייתה שגיאה בזמן כתיבת הרכיב שנבחר %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "הייתה שגיאה בזמן המרת הזרימה הבינארית של הרכיב שנבחר %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "הייתה שגיאה בזמן העתקת זרימת הרכיב שנבחר ללוח הזמני:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
#, fuzzy
#| msgid "The root component can not be deleted."
msgid "The root component cannot be deleted."
msgstr "אי אפשר למחוק את רכיב השורש."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "ההגדרות אוחסנו עם הפרוייקט."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "היחידות לא נמצאו:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr ""
#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr ""
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr ""
#: lazarusidestrconsts.listheunitbelongstopackage
#, fuzzy,badformat
msgid "The unit belongs to package %s."
msgstr "היחידה שייכת לחבילה s%"
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, fuzzy,badformat
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "היחידה s% קיימת פעמיים בנתיב היחידות של: s%"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "ליחידה יש את השם הבא"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy
#| msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "שם קובץ היחידה %s%s%s אינו באותיות קטנות. המהדר של FreePascal לא מחפש את כל אפשרויות הראשיות. מומלץ להשתמש באותיות קטנות בשם הקובץ.לשנות את השם לאותיות קטנות."
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr ""
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, fuzzy,badformat
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "קובץ אחר משתמש ביחידה s%. לעדכן את המקורות אוטומטית?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, fuzzy,badformat
#| msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "ליחידה עצמה יש כבר את השם %s%s%s. מזהה פסקל חייב להיות ייחודי."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, fuzzy,badformat
#| msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "נתיב חיפוש היחידות של %s%s%s מכיל את תיקיית הקוד %s%s%s של חבילה s%"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, fuzzy,badformat
#| msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "תיקיית העבודה %s%s%s לא קיימת. בדוק את תיקיית העבודה ב Menu > Run > Run parameters."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr ""
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "הפונקציה צריכה קובץ lfm. פתוח בעורך הטקסט."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "הודעת עזרה ז"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr ""
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, fuzzy,badformat
#| msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "זה נראה כמו קובץ פסקל. מומלץ להשתמש בשם באותיות קטנות, כדי למנוע בעיות שונות במערכות הפעלה מסוימות ובמהדרים אחרים. לשנות את השם לאותיות קטנות?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "לפרוייקט זה אין קובץ קוד ראשי"
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, fuzzy
#| msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "סט זה של אפשרויות הבניה של לזארוס לא נתמך ע\"י התקנה זאת. לא ניתן לכתוב לתיקייה %s%s%s. ראה באתר לזארוס על דרכים אחרות להתקין את לזארוס."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, fuzzy,badformat
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "אי אפשר לחלץ משפט זה. בחר קוד אחר לחילוץ פרוצדורה/מתודה חדשה."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr ""
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr ""
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "נוכחי"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "פונקציה"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "שורה"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "מקור"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "מצב"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "כותרת&"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "הכותרת בסרגל המשימות מראה למשל: project1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "כותרת (השאר ריק לברירת מחדל)"
#: lazarusidestrconsts.listitleopencomponenticon24x24
msgid "Choose a component icon 24x24"
msgstr ""
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "פונקציה: הוסף את תוחם הנתיב"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
#, fuzzy
#| msgid "Function: chomp path delimiter"
msgid "Function: remove trailing path delimiter"
msgstr "פונקציה: חתוך את תוחם הנתיב"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "פונקציה: חלץ את סיומת הקובץ"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "פונקציה: חלץ את שם וסיומת הקובץ"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "פונקציה: חלץ את שם הקובץ בלבד"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "פונקציה: חלץ את נתיב הקובץ"
#: lazarusidestrconsts.listmunknownmacro
#, fuzzy,badformat
msgid "(unknown macro: %s)"
msgstr "(מאקרו לא מוכר: s%)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "נתיב:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "החלף בין תצוגה עם נתיב מלא לבין נתיב יחסי"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""
#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr ""
#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr ""
#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr ""
#: lazarusidestrconsts.listoolhasnoexecutable
msgid "tool \"%s\" has no executable"
msgstr ""
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr ""
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr ""
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr ""
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr ""
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr ""
#: lazarusidestrconsts.listop
#, fuzzy
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "פסגה"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "עיגון למעלה"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "גבול עליון. ערך זה יתווסף לרווח הבסיסי וישמש לרווח מעל הפקד."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr ""
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "עליונים"
#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "זהו פקד האח שאליו מעוגן הצד העליון. השאר ריק עבור הורה."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "רווח שווה מלמעלה"
#: lazarusidestrconsts.listotalpages
msgid "Total Pages: %s"
msgstr ""
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr ""
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "העת זקוק לרענון"
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr ""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "סוגים( לא הוסרו אם אין תחליף)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr ""
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr ""
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr ""
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr ""
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr ""
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr ""
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr ""
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr ""
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr ""
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr ""
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr ""
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr ""
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr ""
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr ""
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr ""
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr ""
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr ""
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr ""
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "אל תראה הודעה זאת שוב."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "שגיאה בביטוי רגולרי"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "גופן ללא UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "לך לשורה:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "לא נמצא"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, fuzzy,badformat
#| msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "להחליף מופע זה של %s%s%s%s ב %s%s%s?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "מחפש את: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr ""
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "חיפוש המחרוזת '%s' לא נמצא!"
#: lazarusidestrconsts.lisuethecurre
#, fuzzy,badformat
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "הגופן הנוכחי של העורך לא תומך ב UTF-8, אבל נראה שהמערכת שלך משתמשת בו. זה אומר שתווי ASCII כנראה יוצגו לא נכון. אתה יכול לבחור גופן אחר באפשרויות העורך."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "נקה את מטמון הinclude"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "בתים %s"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "נכלל ע\"י:"
#: lazarusidestrconsts.lisuidinproject
#, fuzzy
#| msgid "in Project:"
msgid "In project:"
msgstr "בפרויקט:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "שורות:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "שם:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "לא"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "גודל:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "סוג:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "כן"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "הראה את ערכי CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "לא ניתן להמיר זרם של מידע בינרי לטקסט"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "לא ניתן להעתיק רכיב ללוח הזמני"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, fuzzy,badformat
#| msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "לא ניתן להוסיף הערות בראש קובץ המשאבים %s%s%s%s.%s כנראה שגיאת תחביר"
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, fuzzy,badformat
#| msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "לא ניתן להוסיף את המשאב T%s:FORMDATA לקובץ המשאבים %s%s%s%s.%s כנראה בגלל שגיאת תחביר"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "לא ניתן להוסיף את %s לפרויקט בגלל שיש כבר יחידה עם שם זהה בפרויקט."
#: lazarusidestrconsts.lisunabletobackupfileto
#, fuzzy,badformat
#| msgid "Unable to backup file %s%s%s to %s%s%s!"
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "פעולת הגיבוי של הקובץ %s%s%s לקובץ %s%s%s לא הצליחה!"
#: lazarusidestrconsts.lisunabletochangeclassofto
#, fuzzy,badformat
msgid "%s%sUnable to change class of %s to %s"
msgstr "לא יכול לשנות את המחלקה s% ל s%"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
msgid "Unable to change project scaled in source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "לא יכול לשנות את כותרת הפרוייקט בקוד. %s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "לא ניתן לנקות את ספריית היעד"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, fuzzy,badformat
#| msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "לא ניתן לנקות את %s%s%s.%s יש לבדוק הרשאות."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "לא ניתן להמיר את הטקסט ברכיבים למבנה בינארי:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, fuzzy,badformat
#| msgid "Unable to convert file %s%s%s%sError: %s"
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "לא ניתן להמיר את הקובץ %s%s%s%sשגיאה: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, fuzzy,badformat
#| msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "לא ניתן להמיר מידע טקסטואלי של הקובץ %s%s%s%s%s לזרם בינרי. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
msgid "Unable to convert to encoding \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "לא ניתן להעתיק את הקובץ"
#: lazarusidestrconsts.lisunabletocopyfileto
#, fuzzy,badformat
#| msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "לא ניתן להעתיק את הקובץ %s%s%s%sל%s%s%s"
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
#, fuzzy,badformat
#| msgid "Unable to create backup directory %s%s%s."
msgid "Unable to create backup directory \"%s\"."
msgstr "לא ניתן ליצור את תיקיית הגיבוי %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
#, fuzzy,badformat
#| msgid "Unable to create directory %s%s%s."
msgid "Unable to create directory \"%s\"."
msgstr "לא ניתן ליצור את התיקייה %s%s%s."
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "לא ניתן ליצור את הקובץ"
#: lazarusidestrconsts.lisunabletocreatefile2
#, fuzzy,badformat
#| msgid "Unable to create file %s%s%s"
msgid "Unable to create file \"%s\""
msgstr "לא ניתן ליצור את הקובץ %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
#, fuzzy,badformat
#| msgid "Unable to create file%s%s%s%s"
msgid "Unable to create file%s\"%s\""
msgstr "לא יכול ליצור את הקובץ %s%s%s%s"
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
#, fuzzy,badformat
#| msgid "Unable to create link %s%s%s with target %s%s%s"
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "לא ניתן ליצור את הקישור %s%s%s עם %s%s%s"
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr ""
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "לא יכול ליצור מתודה חדשה."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "לא ניתן ליצור חוצץ זמני לlfm."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "לא יכול למחוק"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, fuzzy,badformat
#| msgid "Unable to delete ambiguous file %s%s%s"
msgid "Unable to delete ambiguous file \"%s\""
msgstr "לא ניתן למחוק את הקובץ הרב משמעי %s%s%s"
#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "לא יכול למצוא את סעיף המשאבים ביחידה זאת או כל יחידה אחרת שבשימוש."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, fuzzy,badformat
#| msgid "Unable to find a valid classname in %s%s%s"
msgid "Unable to find a valid classname in \"%s\""
msgstr "לא ניתן למצוא שם תקני למחלקה ב%s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
#, fuzzy,badformat
#| msgid "Unable to find file %s%s%s."
msgid "Unable to find file \"%s\"."
msgstr "לא ניתן למצוא את הקובץ %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy,badformat
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "לא ניתן למצוא את הקובץ s%s%s.%s אם הקובץ שייך לפרויקט, יש לבדוק את נתיב החיפוש ב%s פרויקט->מהדר->אפשרויות...->נתיבי חיפוש->קבצי יחידות אחרים. אם קובץ זה שייך לחבילה, יש לבדוק את אפשרויות המהדר בחבילה. אם הקובץ שייך ללזרוס, יש לנקות את הקבצים המהודרים. במידה והקובץ שייך ל FPC, אז יש לבדוק את ההגדרות ב fpc.cfg. במידה ואתה לא בטוח, בדוק את פרוייקט->אפשרויות מהדר ...->בדיקה"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "לא ניתן למצוא את %s בזרם של LFM."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "לא יכול למצוא מתודה."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, fuzzy,badformat
#| msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s%s%s%s"
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "לא יכול למצוא יחידת פסקל (pas,.pp.) עבור קובץ lfm%s%s%s%s"
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "לא ניתן לקבל מידע על שינויים בעורך."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "לא ניתן לקבל את הקוד של המתכנן."
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadpackage
#, fuzzy,badformat
#| msgid "Unable to load package %s%s%s"
msgid "Unable to load package \"%s\""
msgstr "לא יכול לטעון חבילה %s%s%s"
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, fuzzy,badformat
#| msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgid "Unable to load the component class \"%s\", because it depends on itself."
msgstr "לא ניתן לטעון את המחלקה %s%s%s ברכיב, בגלל שהיא תלויה בעצמה."
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "לא ניתן לפתוח את רכיב האב"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "לא ניתן לפתוח את המתכנן. %s המחלקה %s אינה יורשת ממחלקה אחרת כדוגמת TFrom או TDataModule."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "לא ניתן לקרוא את הקובץ %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "לא ניתן לקרוא את הקובץ"
#: lazarusidestrconsts.lisunabletoreadfile2
#, fuzzy,badformat
#| msgid "Unable to read file %s%s%s!"
msgid "Unable to read file \"%s\"."
msgstr "לא ניתן לקרוא את הקובץ %s%s%s!"
#: lazarusidestrconsts.lisunabletoreadfileerror
#, fuzzy,badformat
#| msgid "Unable to read file %s%s%s%sError: %s"
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "לא ניתן לקרוא את הקובץ %s%s%s%sשגיאה: %s"
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr ""
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
#, fuzzy,badformat
#| msgid "Unable to read the project info file%s%s%s%s."
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "לא יכול לקרוא את קובץ מידע הפרוייקט %s%s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, fuzzy,badformat
#| msgid "Unable to remove old backup file %s%s%s!"
msgid "Unable to remove old backup file \"%s\"!"
msgstr "לא ניתן להסיר את קובץ הגיבויים %s%s%s הישן!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "לא יכול להסיר את כותרת הפרוייקט בקוד. %s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, fuzzy,badformat
#| msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "לא ניתן לשנות את השם של קובץ רב משמעי %s%s%s%sל %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "לא ניתן לשנות את שם הקובץ"
#: lazarusidestrconsts.lisunabletorenamefileto
#, fuzzy,badformat
#| msgid "Unable to rename file %s%s%s to %s%s%s!"
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "לא ניתן לשנות את שם הקובץ %s%s%s ל %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
#, fuzzy,badformat
#| msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "לא ניתן לשנות את שם הקובץ %s%s%s%sל %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "לא ניתן לשנות את שם הטופס בקוד המקור."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "לא ניתן לשנות את שם המתודה. תקן את השגיאה המופיעה בחלון ההודעות."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "לא ניתן לשנות את שם המשתנה בקוד המקור."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "לא ניתן להריץ"
#: lazarusidestrconsts.lisunabletorun2
msgid "Unable to run \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "לא ניתן לקבוע את צד העיגון בפקד"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "לא יכול להציג מתודה."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "לא ניתן להזרים את הרכיבים שנבחרו"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "לא ניתן להזרים את הרכיבים שנבחרו."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "לא ניתן לגרום להזרים את %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "לא ניתן להמיר את הזרם הבינרי של הרכיב %s:T%s לטקסט."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "לא ניתן לעדכן את CreateForm בקוד המקור של הפרויקט."
#: lazarusidestrconsts.lisunabletowrite2
#, fuzzy,badformat
#| msgid "Unable to write %s%s%s"
msgid "Unable to write \"%s\""
msgstr "לא יכול לכתוב %s%s%s"
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "לא יכול לכתוב קובץ"
#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletowritefileerror
#, fuzzy,badformat
#| msgid "Unable to write file %s%s%s%sError: %s"
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "לא יכול לכתוב קובץ %s%s%s%s שגיאה: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
#, fuzzy
#| msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "לא יכול לכתוב את קובץ מידע הפרוייקט %s%s%s%s. שגיאה: s%"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
#, fuzzy,badformat
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "לא יכול לכתוב את קובץ ה session . שגיאה: %s"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "לא יכול לכתוב לקובץ \"%s\" ."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "לא יכול לכתוב זרימת xml ל %s%s שגיאה: %s"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr ""
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "בטל פעולה"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr ""
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "אי אפשר להסיר את ההתקנה"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "הסר את התקנת הבחירה"
#: lazarusidestrconsts.lisunit
#, fuzzy
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "יחידה"
#: lazarusidestrconsts.lisunithaschangedsave
#, fuzzy,badformat
#| msgid "Unit %s%s%s has changed. Save?"
msgid "Unit \"%s\" has changed. Save?"
msgstr "יחידה %s%s%s השתנתה. לשמור?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "מזהה היחידה קיים"
#: lazarusidestrconsts.lisunitinpackage
#, fuzzy,badformat
#| msgid "%s unit %s in package %s%s"
msgid "%s unit %s in package %s"
msgstr "יחידה s% בחבילה %s%s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "שם היחידה כבר קיים בפרוייקט"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "שם היחידה מתחיל ב ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "שם היחידה מכיל ..."
#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr ""
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "תיקיית הפלט של היחידה"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "נתיב היחידה"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "נתיבי היחידה"
#: lazarusidestrconsts.lisunitrequirespackage
msgid "unit %s requires package %s"
msgstr ""
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "ללא סימן"
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr ""
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr ""
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "למעלה"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr ""
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr ""
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "עדכן מקורות"
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr ""
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr ""
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr ""
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "מחרוזת באותיות ראשיות"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
#, fuzzy
#| msgid "Uppercase string given as parameter"
msgid "Uppercase string given as parameter."
msgstr "מחרוזת באותיות ראשיות ניתנה כפרמטר"
#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr ""
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "הודעת \"איך להשתמש\" (אפשרות h-)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
#, fuzzy
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "השתמש במחרוזת ansi"
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr ""
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr ""
#: lazarusidestrconsts.lisusedby
msgid " used by %s"
msgstr ""
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "השתמש ב\"חבילות זמן תיכנות\""
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
#, fuzzy
#| msgid "Use Exclude Filter"
msgid "Use exclude filter"
msgstr "השתמש במסנן \"אל תכלול\""
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "השתמש במזהה"
#: lazarusidestrconsts.lisuseidentifierinat
#, fuzzy,badformat
msgid "Use identifier %s in %s at %s"
msgstr "השתמש במזהה s% ב %s ב %s"
#: lazarusidestrconsts.lisuseincludefilter
#, fuzzy
#| msgid "Use Include Filter"
msgid "Use include filter"
msgstr "השתמש במסנן \"כלול\""
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "יישום משגר"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "השתמש בחבילה %s בחבילה %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "השתמש בחבילה בחבילה"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "השתמש בחבילה %s בפרוייקט"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "השתמש בחבילה בפרוייקט"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr ""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "תיקיית הבית של המשתמש"
#: lazarusidestrconsts.lisuseunit
#, fuzzy
#| msgid "Add unit to uses section"
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "הוסף יחידה לסעיף \"משתמש ב\""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "השתמש ביחידה %s ביחידה %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 עם BOM"
#: lazarusidestrconsts.lisvalue
#, fuzzy
#| msgid "Value:"
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "ערך:"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "ערך%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "ערך:"
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "ערכים"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr ""
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "משתנה"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr ""
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "וודא קריאות למתודות"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "גרסה"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr ""
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "אנכי"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "העתק את הגרסה ללוח הזמני"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr ""
#: lazarusidestrconsts.lisviewbreakpointproperties
#, fuzzy
#| msgid "Breakpoint Properties..."
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "הצג תכונות נקודת עצירה"
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr ""
#: lazarusidestrconsts.lisviewsourcedisass
#, fuzzy
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "החלף (הצג/הסתר) מהדר האסמבלי"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "הצג קוד (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr ""
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
#, fuzzy,badformat
#| msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "אזהרה: נמצא קובץ רב משמעי: %s%s%s. קוד המקור של הקובץ הוא: %s%s%s"
#: lazarusidestrconsts.liswarnings
msgid ", Warnings: %s"
msgstr ""
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, fuzzy,badformat
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "אזהרה: זאת היחידה הראשית, היחידה הראשית החדשה תהייה s.pas%"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "משגיח"
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr ""
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr ""
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr ""
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr ""
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr ""
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "תכונות המשגיח"
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr ""
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "גלובלי"
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr ""
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr ""
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr ""
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr ""
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
#, fuzzy
#| msgid "When a unit is renamed, update references ..."
msgid "When a unit is renamed, update references"
msgstr "כששם היחידה משתנה, עדכן את המקורות"
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "כאשר מופעל - האפשרויות הנוכחיות נשמרות בתבנית, אשר משתמשים בה ביצירת פרוייקט חדש"
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "כאשר הסמן של עורך הקוד נע, הראה את הצומת הנוכחית בסייר הקוד"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr ""
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr ""
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr "עם קבצי \"כלול\""
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr ""
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr ""
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr ""
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "עם החבילות הנידרשות"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "מח&ק הכל"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "ב&טל הכל"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "א&פשר הכל"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "ביטוי"
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr ""
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "תכונות&"
#: lazarusidestrconsts.liswlwatchlist
#, fuzzy
#| msgid "Watch list"
msgid "Watch List"
msgstr "רשימת המשגיחים"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "המילה הנמצאת במיקום הסמן בעורך הנוכחי"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "תיקיית עבודה לבנייה"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "תיקיית עבודה לריצה"
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "שגיאת כתיבה"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "שגיאת כתיבה: %s%sקובץ: %s%s%s"
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr ""
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "שגיאת XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "שגיאה בקובץ %s בעת קריאת XML%sשגיאה: %s"
#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr ""
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
#, fuzzy
#| msgid "You can disable this for individual forms via the popup menu in the source editor, file settings, i18n for lfm strings"
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "אתה יכול לנטרל זאת לטפסים מסוימים דרך התפריט הקופץ של עורך הקוד , הגדרות קובץ, i18n עבור מחרוזת lfm"
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
#, fuzzy
#| msgid "You can not build lazarus while debugging or compiling."
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "לא ניתן לבנות את לזרוס בזמן שהוא מנפה שגיאות או מהדר"
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr ""
#: lazarusidestrconsts.lis_all_
#, fuzzy
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<הכל>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "עורך קוד מקור"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr ""
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr ""
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr ""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr ""
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr ""
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "הוסף את יחידת החבילה לחלק ה \"משתמש ב\""
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "בינארי"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "עשרוני"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "הוסף הפוך"
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr ""
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr ""
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "הגדל אוטומטית את מספר הבנייה"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr ""
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "בנה:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "סדרת תווים:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "סגור את הדף הנוכחי"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "הגדרות מותנות"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "צור הגדרה חדשה"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "אפשר i18n"
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr ""
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr ""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "נמצא אבל לא מופיע ברשימה שכאן:"
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr ""
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
msgid "Force update PO files on next compile"
msgstr ""
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr ""
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "אפשרויות i18n"
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr ""
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
#, fuzzy
#| msgid "Include Version Info in executable"
msgid "Include version info in executable"
msgstr "כלול מידע גירסה בקובץ הריצה"
#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr ""
#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr ""
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr ""
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr ""
#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr ""
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "שחזר את נתוני החלון"
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr ""
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr ""
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "אפריקנית"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "ערבית"
#: lazarusidestrconsts.rslanguageautomatic
#, fuzzy
#| msgid "Automatic (or english)"
msgid "Automatic (or English)"
msgstr "אוטומטי (או אנגלית)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "קטלנית"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "סינית"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "צ'כית"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "הולנדית"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "אנגלית"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "פינית"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "צרפתית"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "גרמנית"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "עברית"
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr ""
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "אינדונזית"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "איטלקית"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "יפנית"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "לטבית"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "אפשרויות שפה"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "פולנית"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "פורטוגזית"
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "פורטוגזית ברזילאית"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "רוסית"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "בחירת שפה:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "סלובקית"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "ספרדית"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "טורקית"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "אוקראינית"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "גירסה ראשית:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "גירסה משנית"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "מידע אחר"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "ספריית הפלט של קבצי PO"
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr ""
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr ""
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr ""
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "סוג"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "עידכון:"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "בחר ערך מורש"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "התחל חיפוש חדש"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "מספור גרסאות"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "פקודות תפריט עזרה"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "פקודות פקודה"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "פקודות CodeTools"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "פקודות בחירת עמודת טקסט"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "פקודות של תזוזות עכבר"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "פקודות של עריכת טקסט"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "פקודות של תפריט \"קובץ\""
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "פקודות של קיפול טקסט"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "מאקרויים"
#: lazarusidestrconsts.srkmcatmarker
#, fuzzy
#| msgid "Text marker commands"
msgid "Text bookmark commands"
msgstr "פקודות של סימון טקסט"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr ""
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "פקודות של תפריט \"חבילה\""
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "פקודות של תפריט \"פרוייקט\""
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "פקודות של תפריט \"הרץ\""
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "פקודות של תפריט \"חפש והחלף\""
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "פקודות של בחירת טקסט"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "פקודות של פנקס הקוד"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "עריכה של כל המופעים "
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "עריכה של כל המופעים (לא בתא)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "עריכה של כל המופעים (בזמן בחירה)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "עריכת תבנית"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "עריכת תבנית (לא בתא)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "פקודות של תפריט \"כלים\""
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "פקודות של תפריט \"הצג\""
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "פקודה:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "התנגשות"
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "בטל בנייה"
#: lazarusidestrconsts.srkmecabstractmethods
#, fuzzy
#| msgid "Abstract methods ..."
msgid "Abstract Methods ..."
msgstr "מתודה מופשטת ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
#, fuzzy
#| msgid "Add jump point"
msgid "Add Jump Point"
msgstr "הוסף נקודת קפיצה"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "הוסף משגיח"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr ""
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "השלמת תבנית קוד"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "העתק בלוק"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "מחק בלוק"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "לך להתחלת בלוק"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "לך לסוף בלוק"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "הסתר בלוק"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "הזכך בלוק"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "הזז בלוק"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "קבע התחלת בלוק"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "קבע סוף בלוק"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "הראה בלוק"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "החלף בלוק"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "בטל זיהוי בלוק"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "בנה תוכנית/פרוייקט"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "בנה קובץ"
#: lazarusidestrconsts.srkmecbuildlazarus
#, fuzzy
#| msgid "Build lazarus"
msgid "Build Lazarus"
msgstr "בנה את לזרוס"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr ""
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "תו"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "מחק את כל הטקסט"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr ""
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr ""
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "בחר עמודה למטה"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "בחר עמודה לסוף המוחלט"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "בחר עמודה להתחלה המוחלטת"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "בחר עמודה לשמאל"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "בחר עמודה לסוף שורה"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "בחר עמודה להתחלת שורה"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "בחר עמודה להתחלת הטקסט בשורה"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "בחר עמודה לתחתית הדף"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "בחר עמודה למעבר דף למטה"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "בחר עמודה לראש דף"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "בחר עמודה למעבר דף למעלה"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "בחר עמודה לימין"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "בחר עמודה למעלה"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "בחר עמודה למלה בשמאל"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "בחר עמודה למלה בימין"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "אופן בחירת עמודה"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "הדר תוכנית/פרוייקט"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "הגדר קובץ בנייה"
#: lazarusidestrconsts.srkmeccopy
#, fuzzy
#| msgid "Copy selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "העתק את הבחירה ללוח הזמני"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "העתק עורך חלון חדש"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "העתק את העורך לחלון החופשי הבא"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "העתק עורך לחלון החופשי הקודם"
#: lazarusidestrconsts.srkmeccut
#, fuzzy
#| msgid "Cut selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "גזור את הבחירה אל הלוח הזמני"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "מחק עד התחלת שורה"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "מחק את הקו שבסמן"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "מחק עד סוף השורה"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "מחק תו אחרון"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "מחק עד תחילת מילה"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "מחק שורה נוכחית"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "מחק עד סוף המילה"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr ""
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "השווה"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr ""
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "הזז את הסמן לסוף המוחלט"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "הזז את הסמן להתחלה המוחלטת"
#: lazarusidestrconsts.srkmecemptymethods
#, fuzzy
#| msgid "Empty methods ..."
msgid "Empty Methods ..."
msgstr "מתודות ריקות ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "אפשרויות IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "חשב/שנה"
#: lazarusidestrconsts.srkmecextractproc
#, fuzzy
#| msgid "Extract procedure"
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "חלץ את הפרוצדורה"
#: lazarusidestrconsts.srkmecexttool
#, fuzzy,badformat
msgid "External tool %d"
msgstr "כלי חיצוני d%"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "הגדרת כלים חצוניים"
#: lazarusidestrconsts.srkmecfind
#, fuzzy
#| msgid "Find text"
msgid "Find Text"
msgstr "מצא את הבא"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "מצא את הקצה השני של הבלוק"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "מצא את התחלת הבלוק"
#: lazarusidestrconsts.srkmecfinddeclaration
#, fuzzy
#| msgid "Find declaration"
msgid "Find Declaration"
msgstr "מצא הצהרה"
#: lazarusidestrconsts.srkmecfindidentifierrefs
#, fuzzy
#| msgid "Find identifier references"
msgid "Find Identifier References"
msgstr "מצא את מקורות המזהה"
#: lazarusidestrconsts.srkmecfindinfiles
#, fuzzy
#| msgid "Find in files"
msgid "Find in Files"
msgstr "מצא בקבצים"
#: lazarusidestrconsts.srkmecfindnext
#, fuzzy
#| msgid "Find next"
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "מצא את הבא"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
#, fuzzy
#| msgid "Find next word occurrence"
msgid "Find Next Word Occurrence"
msgstr "מצא את ההופעה הבאה של המילה"
#: lazarusidestrconsts.srkmecfindoverloads
#, fuzzy
#| msgid "Find overloads"
msgid "Find Overloads"
msgstr "מצא העמסות"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr ""
#: lazarusidestrconsts.srkmecfindprevious
#, fuzzy
#| msgid "Find previous"
msgid "Find Previous"
msgstr "מצא את הקודם"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
#, fuzzy
#| msgid "Find previous word occurrence"
msgid "Find Previous Word Occurrence"
msgstr "מצא את ההופעה הקודמת של המילה"
#: lazarusidestrconsts.srkmecfindproceduredefinition
#, fuzzy
#| msgid "Find procedure definiton"
msgid "Find Procedure Definiton"
msgstr "מצא את הגדרת הפרוצדורה"
#: lazarusidestrconsts.srkmecfindproceduremethod
#, fuzzy
#| msgid "Find procedure method"
msgid "Find Procedure Method"
msgstr "מצא את מתודת הפרוצדורה"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "קפל במיקום הסמן"
#: lazarusidestrconsts.srkmecfoldlevel
#, fuzzy,badformat
msgid "Fold to Level %d"
msgstr "קפל לרמה d%"
#: lazarusidestrconsts.srkmecgotoeditor
#, fuzzy,badformat
msgid "Go to editor %d"
msgstr "לך לעורך d%"
#: lazarusidestrconsts.srkmecgotoincludedirective
#, fuzzy
#| msgid "Go to to include directive of current include file"
msgid "Go to include directive of current include file"
msgstr "לך להוראת \"כלול\" של קובץ הכלול הנוכחי"
#: lazarusidestrconsts.srkmecgotolinenumber
#, fuzzy
#| msgid "Go to line number"
msgid "Go to Line Number"
msgstr "לך לשורה מספר"
#: lazarusidestrconsts.srkmecgotomarker
#, fuzzy,badformat
#| msgid "Go to Marker %d"
msgid "Go to bookmark %d"
msgstr "לך לסמן d%"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "לך לקואורדינטה XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
#, fuzzy
#| msgid "Guess misplaced $IFDEF"
msgid "Guess Misplaced $IFDEF"
msgstr "נחש IFDEF$ שלא במקומו"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "הכנס ChangeLog"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "הכנס ממפת תווים"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "הכנס מחבר מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "הכנס תאריך מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "הכנס כותרת מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "הכנס זיהוי מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "הכנס לוג מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "הכנס שם מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "הכנס מלת קוד מתוקנת של CVS"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "הכנס מקור מלת קוד של CVS"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "הכנס תאריך וזמן עכשווים"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr ""
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "הכנס הערת GPL "
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "הוסף GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "הכנס הערת LGPL "
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "פצל שורה , עזוב את הסמן"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "מצב הכנסה"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "הכנס הערת LGPL ששונתה"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr ""
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "הכנס שם משתמש נוכחי"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "פקח"
#: lazarusidestrconsts.srkmecinvertassignment
#, fuzzy
#| msgid "Invert assignment"
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "החלף הצבה"
#: lazarusidestrconsts.srkmeckeymapleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "שמאל"
#: lazarusidestrconsts.srkmeckeymapright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "ימין"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr ""
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "פצל את השורה והזז את הסמן"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "הזז את הסמן לסוף השורה"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "מצב בחירת שורה"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "הזז את הסמן להתחלת השורה"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "העבר סמן לטקסט המתחיל בשורה"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "נעל עורך"
#: lazarusidestrconsts.srkmecmakeresourcestring
#, fuzzy
#| msgid "Make resource string"
msgid "Make Resource String"
msgstr "צור מחרוזת משאבים"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "לך לסוגריים המתאימים"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "הזז את העורך שמאלה"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "הצמד את העורך שמאלה"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "העבר עורך לחלון חדש"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "העבר עורך לחלון החופשי הבא"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "העבר עורך לחלון החופשי הקודם"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "הזז את העורך ימינה"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "הצמד את העורך ימינה"
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr ""
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "הסמנייה הבאה"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "לך לעורך הבא"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "גש לעורך הטקסט הבא עם אותו הקוד"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "גש לחלון הבא"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "מצב בחירה רגיל"
#: lazarusidestrconsts.srkmecopenfileatcursor
#, fuzzy
#| msgid "Open file at cursor"
msgid "Open File at Cursor"
msgstr "פתח קובץ במיקום הסמן"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "מצב שכתוב"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "הזז את הסמן לתחתית הדף"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "הזז את הסמן דף אחד למטה"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "הזז את הסמן דף אחד שמאלה"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "הזז את הסמן דף אחד ימינה"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "הזז את הסמן לראש הדף"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "הזז את הסמן דף אחד למעלה"
#: lazarusidestrconsts.srkmecpaste
#, fuzzy
#| msgid "Paste clipboard to current position"
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "הדבק מלוח הגזירים למיקום הנוכחי"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "השהה תוכנה"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr ""
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "סמנייה קודמת"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "לך לעורך קודם"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr ""
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "גש לעורך הטקסט הקודם עם אותו הקוד"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "גש לחלון הקודם"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "הידור מהיר ללא קישור"
#: lazarusidestrconsts.srkmecremovebreakpoint
#, fuzzy
#| msgid "remove break point"
msgid "remove breakpoint"
msgstr "הסר נקודת עצירה"
#: lazarusidestrconsts.srkmecremoveemptymethods
#, fuzzy
#| msgid "Remove empty methods"
msgid "Remove Empty Methods"
msgstr "הסר מתודות ריקות"
#: lazarusidestrconsts.srkmecremoveunusedunits
#, fuzzy
#| msgid "Remove unused units"
msgid "Remove Unused Units"
msgstr "הסר יחידות שאינן בשימוש"
#: lazarusidestrconsts.srkmecrenameidentifier
#, fuzzy
#| msgid "Rename identifier"
msgid "Rename Identifier"
msgstr "שנה שם המזהה"
#: lazarusidestrconsts.srkmecreplace
#, fuzzy
#| msgid "Replace text"
msgid "Replace Text"
msgstr "החלף טקסט"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "דיווח באג"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "אתחל את מנפה השגיאות"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr ""
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "הרץ תוכנה"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "הרץ קובץ"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "הרץ פרמטרים"
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr ""
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "גלול שורה אחת למטה"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "גלול תו אחד שמאלה"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "גלול תו אחד ימינה"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "גלול שורה אחת למעלה"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "בחר למטה"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "בחר הכל"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "המר טאבים לרווחים בבחירה"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "בחר בסוף המוחלט"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "בחר בהתחלה המוחלטת"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "בחר \"לך לקואורדינטות XY\""
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr ""
#: lazarusidestrconsts.srkmecselleft
#, fuzzy
#| msgid "SelLeft"
msgid "Select Left"
msgstr "בחר שמאלה"
#: lazarusidestrconsts.srkmecsellineend
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "בחר בסוף שורה"
#: lazarusidestrconsts.srkmecsellinestart
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "בחר בהתחלת שורה"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "בחירה לטקסט בשורה חדשה"
#: lazarusidestrconsts.srkmecselpagebottom
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "בחר בתחתית הדף"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "בחר דף למטה"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "בחר דף שמאלה"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "בחר דף ימינה"
#: lazarusidestrconsts.srkmecselpagetop
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "בחר דף עליון"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "בחר דף למעלה"
#: lazarusidestrconsts.srkmecselright
#, fuzzy
#| msgid "SelRight"
msgid "Select Right"
msgstr "בחר ימינה"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr ""
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr ""
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "בחר עליון"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecselwordleft
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "בחר מילה אחת שמאלה"
#: lazarusidestrconsts.srkmecselwordright
#, fuzzy
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "בחר מילה אחת ימינה"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "קבע סימניה חופשית"
#: lazarusidestrconsts.srkmecsetmarker
#, fuzzy,badformat
#| msgid "Set Marker %d"
msgid "Set bookmark %d"
msgstr "קבע סמן d%"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "הזז טאב"
#: lazarusidestrconsts.srkmecshowabstractmethods
#, fuzzy
#| msgid "Show abstract methods"
msgid "Show Abstract Methods"
msgstr "הראה מתודות מופשטות"
#: lazarusidestrconsts.srkmecshowcodecontext
#, fuzzy
#| msgid "Show code context"
msgid "Show Code Context"
msgstr "הראה את הקשר הקוד"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "הצג נקודת ריצה"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "עצור תכנית"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "לך למקום האחרון בתא"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "לך למקום הראשון בתא"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "בחר תא"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "צא"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "התא הבא"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "התא הבא ( הכל נבחר)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "התא קודם"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "התא קודם (הכל נבחר)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "התחל עריכת כל המופעים"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "לך למקום האחרון בתא"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "לך למקום הראשון בתא"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "בחר תא"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "צא"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "סיום"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "התא הבא"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "התא הבא (סובב)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "התא הבא ( הכל נבחר)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "התא הבא (סובב / הכל נבחר)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "התא קודם"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "התא קודם (הכל נבחר)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr ""
#: lazarusidestrconsts.srkmecsyntaxcheck
#, fuzzy
#| msgid "Syntax check"
msgid "Syntax Check"
msgstr "בדיקת תחביר"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "הצג אסמבלר"
#: lazarusidestrconsts.srkmectogglebreakpoint
#, fuzzy
#| msgid "toggle break point"
msgid "toggle breakpoint"
msgstr "החלף נקודת עצירה"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "הצג נקודות עצירה"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "הצג את מחסנית הקריאות"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "הצג את סייר הקוד"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "הצג את סייר הקוד"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "הצג את פלטת הרכיבים"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "הצג את פלט מנפה השגיאות"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "החלף בין טופס ליחידה"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "הצג את עורך התיעוד"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "הצג את כפתורי ה Speed ב IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "הצג משתנים מקומיים"
#: lazarusidestrconsts.srkmectogglemarker
#, fuzzy,badformat
#| msgid "Toggle Marker %d"
msgid "Toggle bookmark %d"
msgstr "החלף סמן d%"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "החלף הדגשת מילה נוכחית (כן לא)"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "הצג הודעות"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "החלף אופן"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "הצג את Object Inspector"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "הצג אוגרים"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "הצג את סייר ההגבלות"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "הצג את תוצאות החיפוש"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "הצג את עורך קוד המקור"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "הצג משגיחים"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "פתח את כל הקיפולים"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "פתח את הקיפולים במיקום הסמן"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "פקודת עורך לא ידועה"
#: lazarusidestrconsts.srkmecunusedunits
#, fuzzy
#| msgid "Unused units ..."
msgid "Unused Units ..."
msgstr "יחידות שלא השתמשו בהן"
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr ""
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "הצג את עורך המעגנים"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "הצג רכיבים"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr ""
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "הצג טפסים"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "הצג את תלויות היחידה"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "הצג מידע על היחידה"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "הצג יחידות"
#: lazarusidestrconsts.srkmecwordcompletion
#, fuzzy
#| msgid "Word completion"
msgid "Word Completion"
msgstr "השלמת מילים"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr ""
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr ""
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "הזז את הסמן מילה אחת שמאלה"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "הזז את הסמן מילה אחת ימינה"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr ""
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr ""
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "ערוך מקשים של פקודה"
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr ""
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr ""
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "קפל הערות בזמן הבחירה"
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr ""
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "הסתר הערות בזמן הבחירה"
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr ""
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr ""
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "פתח את כל הקיפולים"
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
#, fuzzy
#| msgid "Unfold all in Selection"
msgid "Unfold all in selection"
msgstr "פרוש הכל בזמן הבחירה"
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
#, fuzzy
#| msgid "Unfold comments in Selection"
msgid "Unfold comments in selection"
msgstr "פרוש הערות בזמן הבחירה"
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr ""
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "הקובץ לקריאה בלבד"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "הקובץ \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" אינו בר כתיבה"
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "נעול"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr ""
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr ""
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "הוסף משגיח במיקום הסמן"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr ""
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "סימניה"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "סגור את כל הדפים האחרים"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "ס&גור את הדף"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "העתק שם קובץ"
#: lazarusidestrconsts.uemcopytonewwindow
#, fuzzy
#| msgid "Clone to new Window"
msgid "Clone to New Window"
msgstr "שכפל לחלון חדש"
#: lazarusidestrconsts.uemcopytootherwindow
#, fuzzy
#| msgid "Clone to other Window"
msgid "Clone to Other Window"
msgstr "שכפל לחלון אחר"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "חלון חדש"
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "נפה שגיאות"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "קידוד"
#: lazarusidestrconsts.uemevaluatemodify
#, fuzzy
#| msgid "&Evaluate/Modify..."
msgid "&Evaluate/Modify ..."
msgstr "הער&ך/שנה"
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "מצא הצהרה"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr ""
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "לך לסימניה"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "מדגש"
#: lazarusidestrconsts.ueminspect
#, fuzzy
#| msgid "&Inspect..."
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "פ&קח"
#: lazarusidestrconsts.ueminvertassignment
#, fuzzy
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "הפוך הצבה"
#: lazarusidestrconsts.uemlineending
#, fuzzy
#| msgid "Line ending"
msgid "Line Ending"
msgstr "סוף שורה"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "נ&על דף"
#: lazarusidestrconsts.uemmovepageleft
#, fuzzy
#| msgid "Move page left"
msgid "Move Page Left"
msgstr "הזז את הדף שמאלה"
#: lazarusidestrconsts.uemmovepageleftmost
#, fuzzy
#| msgid "Move page leftmost"
msgid "Move Page Leftmost"
msgstr "הצמד את הדף לשמאל"
#: lazarusidestrconsts.uemmovepageright
#, fuzzy
#| msgid "Move page right"
msgid "Move Page Right"
msgstr "הזז את הדף ימינה"
#: lazarusidestrconsts.uemmovepagerightmost
#, fuzzy
#| msgid "Move page rightmost"
msgid "Move Page Rightmost"
msgstr "הצמד את הדף לימין"
#: lazarusidestrconsts.uemmovetonewwindow
#, fuzzy
#| msgid "Move to new Window"
msgid "Move to New Window"
msgstr "העבר לחלון חדש"
#: lazarusidestrconsts.uemmovetootherwindow
#, fuzzy
#| msgid "Move to other Window"
msgid "Move to Other Window"
msgstr "העבר לחלון אחר"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "חלון חדש"
#: lazarusidestrconsts.uemnextbookmark
#, fuzzy
#| msgid "Goto next Bookmark"
msgid "Goto Next Bookmark"
msgstr "לך לסימניה הבאה"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "שונה"
#: lazarusidestrconsts.uemopenfileatcursor
#, fuzzy
#| msgid "&Open file at cursor"
msgid "&Open File at Cursor"
msgstr "פתח &קובץ במיקום הסמן"
#: lazarusidestrconsts.uemprevbookmark
#, fuzzy
#| msgid "Goto previous Bookmark"
msgid "Goto Previous Bookmark"
msgstr "לך לסימניה קודמת"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "קפיצה לפרוצדורה"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "קריאה בלבד"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "סידור מחדש"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "הרץ &עד לסמן"
#: lazarusidestrconsts.uemsetfreebookmark
#, fuzzy
#| msgid "Set a free Bookmark"
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "קבע סימניה חופשית"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "הראה מספרי שורה"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "מקור"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "החלף סימניה"
#: lazarusidestrconsts.uemtogglebreakpoint
#, fuzzy
#| msgid "&Toggle Breakpoint"
msgid "Toggle &Breakpoint"
msgstr "החלף נקודת עצירה"
#: lazarusidestrconsts.uemviewcallstack
#, fuzzy
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "הצג את מחסנית הקריאות"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "לא ממומש עדיין"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "הכנס"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "קריאה בלבד"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "מידע אודות הגרסה"
Reference in New Issue View Git Blame Copy Permalink