mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-22 05:39:34 +02:00
21124 lines
791 KiB
Plaintext
21124 lines
791 KiB
Plaintext
# Olexandr Pylypchuk <pilipchukap@rambler.ru>, 2016, 2017.
|
||
msgid ""
|
||
msgstr ""
|
||
"Project-Id-Version: lazaruside\n"
|
||
"POT-Creation-Date: \n"
|
||
"PO-Revision-Date: 2017-03-31 00:44+0300\n"
|
||
"Last-Translator: Olexandr Pylypchuk <pilipchukap@rambler.ru>\n"
|
||
"Language-Team: Ukrainian <kde-i18n-doc@kde.org>\n"
|
||
"Language: uk\n"
|
||
"MIME-Version: 1.0\n"
|
||
"Content-Type: text/plain; charset=UTF-8\n"
|
||
"Content-Transfer-Encoding: 8bit\n"
|
||
"X-Generator: Lokalize 1.5\n"
|
||
"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
||
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
||
msgid "Select Groups"
|
||
msgstr "Виберіть групи"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
||
msgid "Select groups to disable when breakpoint is hit"
|
||
msgstr "Виберіть групи для вимкнення при задіянні точки зупинки"
|
||
|
||
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
||
msgid "Select groups to enable when breakpoint is hit"
|
||
msgstr "Виберіть групи для ввімкнення при задіянні точки зупинки"
|
||
|
||
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
||
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
||
msgstr "Деякі групи в списку ввімкнення/вимкнення не існують.%0:sСтворити їх?%0:s%0:s%1:s"
|
||
|
||
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
||
msgid "Use predefined scheme"
|
||
msgstr "Попередньо визначена схема"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetall
|
||
msgid "Reset all settings"
|
||
msgstr "Скинути всі налашування"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresetgutter
|
||
msgid "Reset all gutter settings"
|
||
msgstr "Скинути всі налаштування смужки"
|
||
|
||
#: lazarusidestrconsts.dlfmouseresettext
|
||
msgid "Reset all text settings"
|
||
msgstr "Скинути всі текстові налашування"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
||
msgid "Add history point"
|
||
msgstr "Додати точку історії"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
||
msgid "Context Menu"
|
||
msgstr "Контекстне меню"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
||
msgid "Context Menu (debug)"
|
||
msgstr "Контекстне меню (зневадження)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
||
msgid "Context Menu (tab)"
|
||
msgstr "Контекстне меню (вкладка)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
||
msgid "Jumps to implementation"
|
||
msgstr "Стрибає до реалізації"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
||
msgid "Jumps to implementation/other block end"
|
||
msgstr "Стрибає до кінця блоку реалізації/іншого"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
||
msgid "History back"
|
||
msgstr "Назад по історії"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
||
msgid "History forward"
|
||
msgstr "Вперед по історії"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
||
msgid "Toggle extra Caret"
|
||
msgstr "Перемкнути додатковий курсор"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr "Нічого/Типово"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
||
msgid "Continue %0:s (Bound to: %1:s)"
|
||
msgstr "Продовжити %0:s (Пов'язано з: %1:s)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
||
msgid "Continue %0:s"
|
||
msgstr "Продовжити %0:s"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
||
msgid "Select text"
|
||
msgstr "Вибрати текст"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
||
msgid "Select text (lines)"
|
||
msgstr "Вибрати текст (рядки)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
||
msgid "Select text (tokens)"
|
||
msgstr "Вибрати текст (елементи)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
||
msgid "Select text (words)"
|
||
msgstr "Вибрати текст (слова)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
||
msgid "Select text (Column mode)"
|
||
msgstr "Вибрати текст (стовпці)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
||
msgid "Select text (Line mode)"
|
||
msgstr "Вибрати текст (рядки)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
||
msgid "Set free bookmark"
|
||
msgstr "Встановити вільну закладку"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
||
msgid "Select current Line (Full)"
|
||
msgstr "Вибрати поточний Рядок (Увесь)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
||
msgid "Select current Line (Text)"
|
||
msgstr "Вибрати поточний Рядок (Текст)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
||
msgid "Select current Paragraph"
|
||
msgstr "Вибрати поточний Абзац"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
||
msgid "Select current Word"
|
||
msgstr "Вибрати поточне Слово"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
||
msgid "Reset zoom"
|
||
msgstr "Скинути масштаб"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplediff
|
||
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
||
msgstr "Ця сторінка не показує ваші поточні налаштування. Див. сторінку з додатковими параметрами. Використовуйте цю сторінку для скидання будь-яких їх змін"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
||
msgid "General"
|
||
msgstr "Загальне"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
||
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
||
msgstr "Стандартне, Всі дії (точка зупинки, згортання) при натисканні кнопки Миші"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
||
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
||
msgstr "Розширене, Дії - при відпуск. кнопки Миші. Виділення - при натиск. і переміщ."
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
||
msgid "Extended, Actions, right gutter half only"
|
||
msgstr "Розширене, дії - праворуч від смужки"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
||
msgid "Use line numbers to select lines"
|
||
msgstr "Використати номери рядків для вибору рядків"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
||
msgid "Gutter"
|
||
msgstr "Смужка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
||
msgid "Right mouse includes caret move"
|
||
msgstr "Переміщувати курсор за правою кнопкою миші"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsect
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
||
msgid "Alt-Ctrl Button"
|
||
msgstr "Alt-Ctrl Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
||
msgid "Alt-Ctrl Wheel"
|
||
msgstr "Alt-Ctrl Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
||
msgid "Alt Button"
|
||
msgstr "Alt Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
||
msgid "Alt Wheel"
|
||
msgstr "Alt Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
||
msgid "Ctrl Button"
|
||
msgstr "Ctrl Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
||
msgid "Ctrl Wheel"
|
||
msgstr "Ctrl Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
||
msgid "Drag selection (copy/paste)"
|
||
msgstr "Копіювати/Вставляти перетягуванням"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
||
msgid "Extra-1 Button"
|
||
msgstr "Extra-1 Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
||
msgid "Extra-2 Button"
|
||
msgstr "Extra-2 Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
||
msgid "Alt Double"
|
||
msgstr "Alt Подвійне"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
||
msgid "Ctrl Double"
|
||
msgstr "Ctrl Подвійне"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
||
msgid "Double"
|
||
msgstr "Подвійний"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
||
msgid "Shift Double"
|
||
msgstr "Shift Подвійне"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
||
msgid "Quad"
|
||
msgstr "Почетвірний"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
||
msgid "Triple"
|
||
msgstr "Потрійний"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
||
msgid "Middle Button"
|
||
msgstr "Середня кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
||
msgid "Middle"
|
||
msgstr "Середня"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Екстра 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Екстра 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
||
msgid "Left 1"
|
||
msgstr "Ліва 1"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
||
msgid "Left 2"
|
||
msgstr "Ліва 2"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
||
msgid "Wheel"
|
||
msgstr "Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
||
msgid "Right Button"
|
||
msgstr "Права Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
||
msgid "Shift-Alt-Ctrl Button"
|
||
msgstr "Shift-Alt-Ctrl Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
||
msgid "Shift-Alt-Ctrl"
|
||
msgstr "Shift-Alt-Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
||
msgid "Shift-Alt Button"
|
||
msgstr "Shift-Alt Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
||
msgid "Shift-Alt Wheel"
|
||
msgstr "Shift-Alt Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
||
msgid "Shift-Ctrl Button"
|
||
msgstr "Shift-Ctrl Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
||
msgid "Shift-Ctrl Wheel"
|
||
msgstr "Shift-Ctrl Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
||
msgid "Shift Button"
|
||
msgstr "Shift Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
||
msgid "Wheel"
|
||
msgstr "Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
||
msgid "Shift Wheel"
|
||
msgstr "Shift Колесо"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewarning
|
||
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
||
msgstr "Ви маєте незбережені зміни. Використання цієї сторінки скине зміни на сторінці розширених параметрів"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
||
msgid "Scroll horizontal (System speed)"
|
||
msgstr "Прокрутка горизонтально (Системна швидкість)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
||
msgid "Scroll horizontal (Single line)"
|
||
msgstr "Прокрутка горизонтально (Один рядок)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
||
msgid "Scroll horizontal (Page)"
|
||
msgstr "Прокрутка горизонтально (Сторінка)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
||
msgid "Scroll horizontal (Half page)"
|
||
msgstr "Прокрутка горизонтально (півсторінки)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
||
msgid "Scroll horizontal (Page, less one line)"
|
||
msgstr "Прокрутка горизонтально (Сторінка, менше рядка)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
||
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
||
msgid "Nothing/Default"
|
||
msgstr "Нічого/Типово"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
||
msgid "Scroll (System speed)"
|
||
msgstr "Прокрутка (Системна швидкість)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
||
msgid "Scroll (Single line)"
|
||
msgstr "Прокрутка (Один рядок)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
||
msgid "Scroll (Page)"
|
||
msgstr "Прокрутка (Сторінка)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
||
msgid "Scroll (Half page)"
|
||
msgstr "Прокрутка (півсторінки)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
||
msgid "Scroll (Page, less one line)"
|
||
msgstr "Прокрутка (Сторінка, менше рядка)"
|
||
|
||
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
||
msgid "Zoom"
|
||
msgstr "Масштаб"
|
||
|
||
#: lazarusidestrconsts.dlfnopredefinedscheme
|
||
msgid "< None >"
|
||
msgstr "< Немає >"
|
||
|
||
#: lazarusidestrconsts.dlfreadonlycolor
|
||
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
||
msgid "Read Only"
|
||
msgstr "Лише для читання"
|
||
|
||
#: lazarusidestrconsts.dlg1up2low
|
||
msgid "Lowercase, first letter up"
|
||
msgstr "Нижній регістр, з великої букви"
|
||
|
||
#: lazarusidestrconsts.dlgactivedesktop
|
||
msgid "active"
|
||
msgstr "активний"
|
||
|
||
#: lazarusidestrconsts.dlgaddassignmentoperator
|
||
msgid "Add assignment operator :="
|
||
msgstr "Додавати оператор присвоєння :="
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
||
msgid "Brackets highlight"
|
||
msgstr "Підсвічування дужок"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
||
msgid "Code folding tree"
|
||
msgstr "Дерево згортань коду"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdefault
|
||
msgid "Default Text"
|
||
msgstr "Текст за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
||
msgid "Disabled breakpoint"
|
||
msgstr "Вимкнена точка зупинки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
||
msgid "Enabled breakpoint"
|
||
msgstr "Ввімкнена точка зупинки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
||
msgid "Error line"
|
||
msgstr "Рядок з помилкою"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
||
msgid "Execution point"
|
||
msgstr "Точка виконання"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
||
msgid "Folded code marker"
|
||
msgstr "Маркер згорнутого коду"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
||
msgid "Fold start-line"
|
||
msgstr "Рядок початку згорнутого блоку"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
||
msgid "Global"
|
||
msgstr "Глобально"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
||
msgid "Gutter"
|
||
msgstr "Смужка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
||
msgid "Line"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
||
msgid "Syncron Edit"
|
||
msgstr "Синхронне редагування"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||
msgid "Template Edit"
|
||
msgstr "Редагування шаблону"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
||
msgid "Gutter Separator"
|
||
msgstr "Роздільна смужка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
||
msgid "Hide start-line"
|
||
msgstr "Рядок початку прихованого блоку"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
||
msgid "Incremental others"
|
||
msgstr "Інкрементальні інші"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
||
msgid "Highlight current word"
|
||
msgstr "Підсвічувати поточне слово"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
||
msgid "Incremental search"
|
||
msgstr "Інкрементальний пошук"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
||
msgid "Invalid breakpoint"
|
||
msgstr "Неправильна точка зупинки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
||
msgid "Current line highlight"
|
||
msgstr "Підсвітка поточного рядка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
||
msgid "Line number"
|
||
msgstr "Номер рядка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
||
msgid "Modified line"
|
||
msgstr "Змінений рядок"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
||
msgid "Mouse link"
|
||
msgstr "Посилання при наведенні мишки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
||
msgid "Selected Area"
|
||
msgstr "Виділена ділянка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Активна комірка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Інші комірки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Синхронізовані комірки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
||
msgid "Active Cell"
|
||
msgstr "Активна комірка"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
||
msgid "Other Cells"
|
||
msgstr "Інші комірки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
||
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
||
msgid "Syncronized Cells"
|
||
msgstr "Синхронізовані комірки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
||
msgid "Text block"
|
||
msgstr "Текстовий блок"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
||
msgid "Unknown breakpoint"
|
||
msgstr "Невідома точка зупинки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
||
msgid "Word-Brackets"
|
||
msgstr "Квадратні дужки"
|
||
|
||
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
||
msgid "Visualized Special Chars"
|
||
msgstr "Візуалізація спеціальних символів"
|
||
|
||
#: lazarusidestrconsts.dlgaddsemicolon
|
||
msgid "Add semicolon"
|
||
msgstr "Додавати символ 'крапка з комою'"
|
||
|
||
#: lazarusidestrconsts.dlgadjusttopline
|
||
msgid "Adjust top line due to comment in front"
|
||
msgstr "Вирівняти верхній рядок за рахунок коментаря попереду"
|
||
|
||
#: lazarusidestrconsts.dlgalphabetically
|
||
msgid "Alphabetically"
|
||
msgstr "За алфавітом"
|
||
|
||
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
||
msgid "Always visible cursor"
|
||
msgstr "Завжди видимий курсор"
|
||
|
||
#: lazarusidestrconsts.dlgambigfileact
|
||
msgid "Ambiguous file action:"
|
||
msgstr "Двозначна дія з файлом:"
|
||
|
||
#: lazarusidestrconsts.dlgambigwarn
|
||
msgid "Warn on compile"
|
||
msgstr "Попередж. при компіляції"
|
||
|
||
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
||
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
||
msgstr "Перед повідомленням про помилку/попередженням/підказкою є значок. Такий самий значок з'являється на смужці у Редакторі коду."
|
||
|
||
#: lazarusidestrconsts.dlgansicommenttab
|
||
msgid "Ansi (* *)"
|
||
msgstr "Ansi (* *)"
|
||
|
||
#: lazarusidestrconsts.dlgapplicationsettings
|
||
msgid "Application settings"
|
||
msgstr "Параметри застосунку"
|
||
|
||
#: lazarusidestrconsts.dlgassertcode
|
||
msgid "Include assertion code"
|
||
msgstr "Включити assert-код"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateforms
|
||
msgid "Auto-create forms:"
|
||
msgstr "Автостворювані форми:"
|
||
|
||
#: lazarusidestrconsts.dlgautocreateformshint
|
||
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
||
msgstr "Кожна форма створюється у головному модулі .lpr викликом Application.CreateForm(). Вивільняють пам'ять вони теж автоматично."
|
||
|
||
#: lazarusidestrconsts.dlgautocreatenewforms
|
||
msgid "Auto-create new forms"
|
||
msgstr "Створювати нові форми автоматично"
|
||
|
||
#: lazarusidestrconsts.dlgautodel
|
||
msgid "Auto delete file"
|
||
msgstr "Автом. видалити файл"
|
||
|
||
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
||
msgid "Auto Display Function Prototypes"
|
||
msgstr "Автоматично показувати прототипи функцій"
|
||
|
||
#: lazarusidestrconsts.dlgautohidecursor
|
||
msgid "Hide mouse when typing"
|
||
msgstr "Сховати мишку при наборі тексту"
|
||
|
||
#: lazarusidestrconsts.dlgautoindent
|
||
msgctxt "lazarusidestrconsts.dlgautoindent"
|
||
msgid "Auto indent"
|
||
msgstr "Автоматичний відступ"
|
||
|
||
#: lazarusidestrconsts.dlgautoindentlink
|
||
msgid "(Set up smart indent)"
|
||
msgstr "(Задати розумні відступи)"
|
||
|
||
#: lazarusidestrconsts.dlgautoindenttype
|
||
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
||
msgid "Auto indent"
|
||
msgstr "Автоматичний відступ"
|
||
|
||
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
||
msgid "Auto remove empty methods"
|
||
msgstr "Автом. видаляти порожні методи"
|
||
|
||
#: lazarusidestrconsts.dlgautoren
|
||
msgid "Auto rename file lowercase"
|
||
msgstr "Автоперейменування у нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
||
msgid "Auto save active desktop"
|
||
msgstr "Автоматично зберігати активну стільницю"
|
||
|
||
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
||
msgid ""
|
||
"Save active desktop on IDE close\n"
|
||
"Save debug desktop on IDE close and debug end\n"
|
||
msgstr ""
|
||
"Зберегти активну стільницю при закриванні ІСР\n"
|
||
"Зберегти стільницю зневадження при закриванні ІСР і при завершенні зневадження\n"
|
||
|
||
#: lazarusidestrconsts.dlgavailableforms
|
||
msgid "Available forms:"
|
||
msgstr "Доступні форми:"
|
||
|
||
#: lazarusidestrconsts.dlgavailableformshint
|
||
msgid "These forms must be created and freed in the program code."
|
||
msgstr "Ці форми мають створюватись і вивільняти пам'ять програмним шляхом."
|
||
|
||
#: lazarusidestrconsts.dlgbackcolor
|
||
msgid "Background"
|
||
msgstr "Тло"
|
||
|
||
#: lazarusidestrconsts.dlgbaknosubdirectory
|
||
msgid "(no subdirectory)"
|
||
msgstr "(немає підтеки)"
|
||
|
||
#: lazarusidestrconsts.dlgbckupsubdir
|
||
msgid "Same name (in subdirectory)"
|
||
msgstr "Та ж сама назва (в підтеці)"
|
||
|
||
#: lazarusidestrconsts.dlgbehindmethods
|
||
msgid "Behind methods"
|
||
msgstr "Після методів"
|
||
|
||
#: lazarusidestrconsts.dlgblockgroupoptions
|
||
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: lazarusidestrconsts.dlgblockindent
|
||
msgid "Block indent (spaces)"
|
||
msgstr "Відступ блоку (пробіли)"
|
||
|
||
#: lazarusidestrconsts.dlgblockindentkeys
|
||
msgid "Block indent"
|
||
msgstr "Відступ блоку"
|
||
|
||
#: lazarusidestrconsts.dlgblockindentlink
|
||
msgid "(edit keys)"
|
||
msgstr "(змінити клавіші)"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypecopy
|
||
msgid "Space/tab as prev Line"
|
||
msgstr "Пробіл/Таб як в попередньому рядку"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypepos
|
||
msgid "Position only"
|
||
msgstr "Лише позиція"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypespace
|
||
msgid "Spaces"
|
||
msgstr "Пробіли"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
||
msgid "Tabs, cut off"
|
||
msgstr "Таби, обрізати"
|
||
|
||
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
||
msgid "Tabs, then spaces"
|
||
msgstr "Таби, потім пробіли"
|
||
|
||
#: lazarusidestrconsts.dlgblocktabindent
|
||
msgid "Block indent (tabs)"
|
||
msgstr "Відступ блоку (таби)"
|
||
|
||
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
||
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
||
msgstr "Зазор можна встановити у редакторі прив'язок. Якщо зазор > 0, виводиться червона лінія."
|
||
|
||
#: lazarusidestrconsts.dlgbrackethighlight
|
||
msgid "Bracket highlight"
|
||
msgstr "Підсвічування дужок"
|
||
|
||
#: lazarusidestrconsts.dlgbracketmatchgroup
|
||
msgid "Matching bracket pairs"
|
||
msgstr "Підбір пар дужок"
|
||
|
||
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
||
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
||
msgstr "Неможливо використати стільницю зі стикуванням в оточенні без стикування, і навпаки."
|
||
|
||
#: lazarusidestrconsts.dlgcasesensitive
|
||
msgctxt "lazarusidestrconsts.dlgcasesensitive"
|
||
msgid "&Case sensitive"
|
||
msgstr "&Чутливий до регістру"
|
||
|
||
#: lazarusidestrconsts.dlgccocaption
|
||
msgid "Checking compiler options"
|
||
msgstr "Перевіряю параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
||
msgid "orphaned file found: %s"
|
||
msgstr "втрачений файл знайдений: %s"
|
||
|
||
#: lazarusidestrconsts.dlgccoresults
|
||
msgid "Results"
|
||
msgstr "Результати"
|
||
|
||
#: lazarusidestrconsts.dlgccotest
|
||
msgctxt "lazarusidestrconsts.dlgccotest"
|
||
msgid "Test"
|
||
msgstr "Тест"
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
||
msgid "Test: Checking compiler ..."
|
||
msgstr "Тест: Перевіряю компілятор ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
||
msgid "Test: Checking compiler configuration ..."
|
||
msgstr "Тест: Перевіряю конфігурацію компілятора ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilerdate
|
||
msgid "Test: Checking compiler date ..."
|
||
msgstr "Тест: Перевіряю дату компілятора ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
||
msgid "Test: Compiling an empty file ..."
|
||
msgstr "Тест: Компілюю порожній файл ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestmissingppu
|
||
msgid "Test: Checking missing fpc ppu ..."
|
||
msgstr "Тест: Перевіряю відсутній fpc ppu ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||
msgstr "Тест: Перевіряю поч. код за шляхами пошуку fpc ppu ..."
|
||
|
||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||
msgid "Test: Compiling an empty file"
|
||
msgstr "Тест: Компілюю порожній файл"
|
||
|
||
#: lazarusidestrconsts.dlgccousingconfigfile
|
||
msgid "using config file %s"
|
||
msgstr "використовую файл конфігурації %s"
|
||
|
||
#: lazarusidestrconsts.dlgcdtclassorder
|
||
msgid "Class order"
|
||
msgstr "Порядок класів"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlast
|
||
msgid "Last"
|
||
msgstr "Остання"
|
||
|
||
#: lazarusidestrconsts.dlgcdtlower
|
||
msgid "lowercase"
|
||
msgstr "нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgcdtpreview
|
||
msgid "Preview (max line length = 1)"
|
||
msgstr "Попередній перегляд (max довжина=1)"
|
||
|
||
#: lazarusidestrconsts.dlgcdtreadprefix
|
||
msgid "Read prefix"
|
||
msgstr "Префікс READ"
|
||
|
||
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
||
msgid "Stored postfix"
|
||
msgstr "Постфікс STORED"
|
||
|
||
#: lazarusidestrconsts.dlgcdtuppercase
|
||
msgid "UPPERCASE"
|
||
msgstr "ВЕРХНІЙ РЕГІСТР"
|
||
|
||
#: lazarusidestrconsts.dlgcdtvariableprefix
|
||
msgid "Variable prefix"
|
||
msgstr "Префікс змінної"
|
||
|
||
#: lazarusidestrconsts.dlgcdtwriteprefix
|
||
msgid "Write prefix"
|
||
msgstr "Префікс WRITE"
|
||
|
||
#: lazarusidestrconsts.dlgcentercursorline
|
||
msgid "Center cursor line"
|
||
msgstr "Рядок з курсором у центр"
|
||
|
||
#: lazarusidestrconsts.dlgcharcasefileact
|
||
msgid "Save As - auto rename Pascal files lower case"
|
||
msgstr "Зберегти як - автоперейменування Pascal-файлів у нижній регістр"
|
||
|
||
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
||
msgid "Check and Auto Save Files"
|
||
msgstr "Перевірка і автозапис файлів"
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
||
msgid "Check packages on form create"
|
||
msgstr "Перевірити пакунки при створенні форми"
|
||
|
||
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
||
msgid "The form may require a package to work. Install such a package automatically."
|
||
msgstr "Формі для роботи може знадобитись пакунок. Встановити такий пакунок автоматично."
|
||
|
||
#: lazarusidestrconsts.dlgchscodetempl
|
||
msgid "Choose code template file (*.dci)"
|
||
msgstr "Виберіть файл шаблонів коду (*.dci)"
|
||
|
||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||
msgid "Show close buttons in notebook"
|
||
msgstr "Кнопки закриття в записнику"
|
||
|
||
#: lazarusidestrconsts.dlgclrscheme
|
||
msgid "Color Scheme"
|
||
msgstr "Кольорова схема"
|
||
|
||
#: lazarusidestrconsts.dlgcmacro
|
||
msgid "C style macros (global)"
|
||
msgstr "Макроси стилю C (глобально)"
|
||
|
||
#: lazarusidestrconsts.dlgcoansistr
|
||
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
||
msgid "Use Ansistrings"
|
||
msgstr "Використовувати рядки ansistring"
|
||
|
||
#: lazarusidestrconsts.dlgcoasmstyle
|
||
msgid "Assembler style"
|
||
msgstr "Стиль асемблера"
|
||
|
||
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
||
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts.dlgcochecksandassertion
|
||
msgid "Checks and assertion"
|
||
msgstr "Перевірки і умови"
|
||
|
||
#: lazarusidestrconsts.dlgcocompilercommands
|
||
msgid "Compiler Commands"
|
||
msgstr "Команди компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgcocops
|
||
msgid "C style operators (*=, +=, /= and -=)"
|
||
msgstr "Оператори стилю C (*=, +=, /= and -=)"
|
||
|
||
#: lazarusidestrconsts.dlgcocreatemakefile
|
||
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Створити Makefile"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugging
|
||
msgctxt "lazarusidestrconsts.dlgcodebugging"
|
||
msgid "Debugging"
|
||
msgstr "Зневадження"
|
||
|
||
#: lazarusidestrconsts.dlgcodebugpath
|
||
msgid "Debugger path addition (none):"
|
||
msgstr "Додавання до шляхів зневаджувача (немає):"
|
||
|
||
#: lazarusidestrconsts.dlgcodecreation
|
||
msgid "Code Creation"
|
||
msgstr "Створення коду"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenableboth
|
||
msgid "Both"
|
||
msgstr "Обидва"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablefold
|
||
msgid "Fold"
|
||
msgstr "Згорнути"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldenablehide
|
||
msgid "Hide"
|
||
msgstr "Сховати"
|
||
|
||
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
||
msgid "Reverse fold-order in Popup"
|
||
msgstr "Зворотній порядок згортання в спливному меню"
|
||
|
||
#: lazarusidestrconsts.dlgcogdb
|
||
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
||
msgstr "Створити інформацію для GDB (повільніше / збільшує розмір exe)"
|
||
|
||
#: lazarusidestrconsts.dlgcoheaptrc
|
||
msgid "Use Heaptrc unit (check for mem-leaks)"
|
||
msgstr "Викор-ти модуль Heaptrc (перевіряє витоки пам'яті)"
|
||
|
||
#: lazarusidestrconsts.dlgcoincfiles
|
||
msgid "Include files (-Fi):"
|
||
msgstr "Включені файли (-Fi):"
|
||
|
||
#: lazarusidestrconsts.dlgcoinfoforgdb
|
||
msgid "Info for GDB"
|
||
msgstr "Інформація для GDB"
|
||
|
||
#: lazarusidestrconsts.dlgcolibraries
|
||
msgid "Libraries (-Fl):"
|
||
msgstr "Бібліотеки (-Fl)"
|
||
|
||
#: lazarusidestrconsts.dlgcolinking
|
||
msgid "Linking"
|
||
msgstr "Компонування"
|
||
|
||
#: lazarusidestrconsts.dlgcoloadsavehint
|
||
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
|
||
msgid "Compiler options can be saved to an XML file."
|
||
msgstr "Параметри компілятора можна зберегти до файлу XML."
|
||
|
||
#: lazarusidestrconsts.dlgcolor
|
||
msgid "Color"
|
||
msgstr "Колір"
|
||
|
||
#: lazarusidestrconsts.dlgcolorlink
|
||
msgid "(Edit Color)"
|
||
msgstr "(Змінити колір)"
|
||
|
||
#: lazarusidestrconsts.dlgcolornotmodified
|
||
msgid "Not modified"
|
||
msgstr "Не змінено"
|
||
|
||
#: lazarusidestrconsts.dlgcolors
|
||
msgctxt "lazarusidestrconsts.dlgcolors"
|
||
msgid "Colors"
|
||
msgstr "Кольори"
|
||
|
||
#: lazarusidestrconsts.dlgcommandlineparams
|
||
msgid "Command line parameters (without application name)"
|
||
msgstr "Параметри командного рядка (без назви застосунку)"
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
||
msgid "Make default indent for new line if comment opens at column:"
|
||
msgstr "Зробити типовий відступ у новому рядку, якщо коментар відкривається на стовпці:"
|
||
|
||
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
||
msgid "Limit indent to"
|
||
msgstr "Обмежити відступ"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinue
|
||
msgid "Prefix comments on linebreak"
|
||
msgstr "Додавати префікс у новий рядок коментаря"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematch
|
||
msgid "Match current line"
|
||
msgstr "Відповідність поточному рядку"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
||
msgid "Match text including \"*\" of token \"(*\""
|
||
msgstr "Відповідність тексту включно з \"*\" з позначки \"(*\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
||
msgid "Match whole line"
|
||
msgstr "Відповідність цілому рядку"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
||
msgid "Match text after token \"%s\""
|
||
msgstr "Відповідність тексту після елемента \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
||
msgid "Match text including token \"%s\""
|
||
msgstr "Відповідність тексту включно з елементом \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
||
msgid "Prefix new line"
|
||
msgstr "Префікс нового рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
||
msgid "Align Prefix at indent of previous line"
|
||
msgstr "Вирівняти префікс за відступом попереднього рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
||
msgid "Align Prefix below start of comment on first comment line"
|
||
msgstr "Вирівняти префікс за початком коментаря у першому рядку"
|
||
|
||
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
||
msgid "Do not indent prefix"
|
||
msgstr "Не робити відступ префікса"
|
||
|
||
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
||
msgid "Comments"
|
||
msgstr "Коментарі"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
||
msgid "Extend, if matched or not matched"
|
||
msgstr "Розширювати у будь-якому разі"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
||
msgid "Extend, if matched or not matched (not at EOL)"
|
||
msgstr "Розширювати, якщо курсор не в кінці рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
||
msgid "Extend, if matched"
|
||
msgstr "Розширювати при відповідності"
|
||
|
||
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
||
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
||
msgstr "Розширювати, якщо є відповідність і курсор не в кінці рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcompilationandlinking
|
||
msgid "Compilation and Linking"
|
||
msgstr "Компіляція і компонування"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessage
|
||
msgid "Compiler messages"
|
||
msgstr "Повідомлення компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgcompilermessages
|
||
msgid "Compiler messages language file (*.msg)"
|
||
msgstr "Мовний файл повідомлень компілятора (*.msg)"
|
||
|
||
#: lazarusidestrconsts.dlgcompileroptions
|
||
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
||
msgid "Compiler Options"
|
||
msgstr "Параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgcompleteproperties
|
||
msgid "Complete properties"
|
||
msgstr "Завершити властивості"
|
||
|
||
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
||
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
||
msgstr "Спочатку компонент під вказівником вибирається, і лише потім на ньому діють команди контекстного меню."
|
||
|
||
#: lazarusidestrconsts.dlgconfigandtarget
|
||
msgid "Config and Target"
|
||
msgstr "Конфігурація і ціль"
|
||
|
||
#: lazarusidestrconsts.dlgconfigfiles
|
||
msgid "Config files"
|
||
msgstr "Файли налаштувань"
|
||
|
||
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
||
msgid "Other debugging info"
|
||
msgstr "Інша зневаджувальна інформація"
|
||
|
||
#: lazarusidestrconsts.dlgcooverflow
|
||
msgid "Overflow"
|
||
msgstr "Переповнення"
|
||
|
||
#: lazarusidestrconsts.dlgcoparsing
|
||
msgid "Parsing"
|
||
msgstr "Обробка"
|
||
|
||
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
||
msgid "Copy/Paste with fold info"
|
||
msgstr "Копіювати/Вставляти зі згорненням"
|
||
|
||
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
||
msgid "Copy word on copy none"
|
||
msgstr "Копіювати слово при порожньому копіюванні"
|
||
|
||
#: lazarusidestrconsts.dlgcorange
|
||
msgctxt "lazarusidestrconsts.dlgcorange"
|
||
msgid "Range"
|
||
msgstr "Діапазон"
|
||
|
||
#: lazarusidestrconsts.dlgcorelocatable
|
||
msgid "Relocatable"
|
||
msgstr "Переміщуваний"
|
||
|
||
#: lazarusidestrconsts.dlgcosetasdefault
|
||
msgid "Set compiler options as default"
|
||
msgstr "Зробити параметри компілятора типовими"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowerr
|
||
msgid "Show errors"
|
||
msgstr "Показувати помилки"
|
||
|
||
#: lazarusidestrconsts.dlgcoshowoptions
|
||
msgid "&Show Options"
|
||
msgstr "По&казати параметри"
|
||
|
||
#: lazarusidestrconsts.dlgcosmartlinkable
|
||
msgid "Smart linkable"
|
||
msgstr "Розумне компонування"
|
||
|
||
#: lazarusidestrconsts.dlgcosources
|
||
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
||
msgstr "Інші сирці (.pp/.pas-файли, що використовуються ІСР, але не компілятором)"
|
||
|
||
#: lazarusidestrconsts.dlgcostack
|
||
msgid "Stack"
|
||
msgstr "Стек"
|
||
|
||
#: lazarusidestrconsts.dlgcostrip
|
||
msgid "Strip symbols from executable"
|
||
msgstr "Вирізати символи з виконуваного файлу"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltype
|
||
msgid "Type of debug info"
|
||
msgstr "Тип даних зневадження"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypeauto
|
||
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
||
msgid "Automatic"
|
||
msgstr "Автоматично"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
||
msgid "Dwarf2"
|
||
msgstr "Dwarf2"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
||
msgid "Dwarf with sets"
|
||
msgstr "Dwarf з наборами"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
||
msgid "Dwarf3 (beta)"
|
||
msgstr "Dwarf3 (бета)"
|
||
|
||
#: lazarusidestrconsts.dlgcosymboltypestabs
|
||
msgid "Stabs"
|
||
msgstr "Удари"
|
||
|
||
#: lazarusidestrconsts.dlgcotrashvariables
|
||
msgid "Trash variables"
|
||
msgstr "Засмітити змінні"
|
||
|
||
#: lazarusidestrconsts.dlgcounitstyle
|
||
msgid "Unit style"
|
||
msgstr "Стиль модуля"
|
||
|
||
#: lazarusidestrconsts.dlgcovalgrind
|
||
msgid "Generate code for valgrind"
|
||
msgstr "Створити код для valgrind"
|
||
|
||
#: lazarusidestrconsts.dlgcoverbosity
|
||
msgid "Verbosity"
|
||
msgstr "Подробиці виводу"
|
||
|
||
#: lazarusidestrconsts.dlgcppinline
|
||
msgid "C++ styled INLINE"
|
||
msgstr "INLINE стилю C++"
|
||
|
||
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
||
msgid "Ctrl-middle-click on tab closes all others"
|
||
msgstr "Натискання Ctrl-Середня Кнопка на вкладці закриває інші"
|
||
|
||
#: lazarusidestrconsts.dlgcurlycommenttab
|
||
msgid "Curly { }"
|
||
msgstr "Фігурні { }"
|
||
|
||
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
||
msgid "Currently respected by messages window, jump history and search results."
|
||
msgstr "Наразі впливає на вікно повідомлень, історію переходів і результатів пошуку."
|
||
|
||
#: lazarusidestrconsts.dlgcursorbeyondeol
|
||
msgid "Cursor beyond EOL"
|
||
msgstr "Курсор за межею рядка"
|
||
|
||
#: lazarusidestrconsts.dlgcursorgroupoptions
|
||
msgid "Cursor"
|
||
msgstr "Курсор"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipsselection
|
||
msgid "Cursor skips selection"
|
||
msgstr "Курсор пропускає вибране"
|
||
|
||
#: lazarusidestrconsts.dlgcursorskipstab
|
||
msgid "Cursor skips tabs"
|
||
msgstr "Курсор пропускає Таби"
|
||
|
||
#: lazarusidestrconsts.dlgcustomext
|
||
msgid "User defined extension (.pp.xxx)"
|
||
msgstr "Розширення користувача (.pp.xxx)"
|
||
|
||
#: lazarusidestrconsts.dlgdebugdesktop
|
||
msgid "debug"
|
||
msgstr "зневадити"
|
||
|
||
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
||
msgid "Path Editor"
|
||
msgstr "Редактор Шляху"
|
||
|
||
#: lazarusidestrconsts.dlgdebugtype
|
||
msgid "Debugger type and path"
|
||
msgstr "Тип зневаджувача і шлях"
|
||
|
||
#: lazarusidestrconsts.dlgdefaulteditorfont
|
||
msgid "Default editor font"
|
||
msgstr "Типовий шрифт редактора"
|
||
|
||
#: lazarusidestrconsts.dlgdefvaluecolor
|
||
msgid "Default Value"
|
||
msgstr "Типове значення"
|
||
|
||
#: lazarusidestrconsts.dlgdeltemplate
|
||
msgid "Delete template "
|
||
msgstr "Видалити шаблон "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopbuttons
|
||
msgid "Buttons - "
|
||
msgstr "Кнопки - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktophints
|
||
msgid "Hints"
|
||
msgstr "Підказки"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopmenus
|
||
msgid "Menus - "
|
||
msgstr "Меню - "
|
||
|
||
#: lazarusidestrconsts.dlgdesktopname
|
||
msgid "Desktop name"
|
||
msgstr "Назва стільниці"
|
||
|
||
#: lazarusidestrconsts.dlgdesktopsexported
|
||
msgid "%d desktop(s) successfully exported to \"%s\""
|
||
msgstr "%d стільниця(ь) успішно експортовано до \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgdesktopsimported
|
||
msgid "%d desktop(s) successfully imported from \"%s\""
|
||
msgstr "%d стільниця(ь) успішно імпортовано з \"%s\""
|
||
|
||
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
||
msgid "Different values background"
|
||
msgstr "Тло відмінних значень"
|
||
|
||
#: lazarusidestrconsts.dlgdirection
|
||
msgid "Direction"
|
||
msgstr "Напрямок"
|
||
|
||
#: lazarusidestrconsts.dlgdisableantialiasing
|
||
msgid "Disable anti-aliasing"
|
||
msgstr "Вимкнути згладжування"
|
||
|
||
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
||
msgid "Distance between grid points is the smallest step when moving a control."
|
||
msgstr "Відстань між точками сітки - це найменший крок при переміщенні елемента керування."
|
||
|
||
#: lazarusidestrconsts.dlgdividercolordefault
|
||
msgid "Use right margin color"
|
||
msgstr "Використовувати колір правої межі"
|
||
|
||
#: lazarusidestrconsts.dlgdividerdrawdepth
|
||
msgid "Draw divider level"
|
||
msgstr "Малювати рівень роздільника"
|
||
|
||
#: lazarusidestrconsts.dlgdividernestcolor
|
||
msgid "Nested line color"
|
||
msgstr "Колір вкладеного рядка"
|
||
|
||
#: lazarusidestrconsts.dlgdividertopcolor
|
||
msgid "Line color"
|
||
msgstr "Колір лінії"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasbeginendname
|
||
msgid "Begin/End"
|
||
msgstr "Початок/Кінець"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasprocedurename
|
||
msgid "Procedure/Function"
|
||
msgstr "Процедура/Функція"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
||
msgid "Class/Struct"
|
||
msgstr "Class/Struct"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
||
msgid "Class/Struct (local)"
|
||
msgstr "Class/Struct (локальні)"
|
||
|
||
#: lazarusidestrconsts.dlgdivpastryname
|
||
msgid "Try/Except"
|
||
msgstr "Try/Except"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
||
msgid "Unit sections"
|
||
msgstr "Секції модуля"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasusesname
|
||
msgid "Uses clause"
|
||
msgstr "Вираз Uses"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
||
msgid "Var/Type"
|
||
msgstr "Var/Type"
|
||
|
||
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
||
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (локальні)"
|
||
|
||
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
||
msgid "Draw the component's name below it."
|
||
msgstr "Писати під компонентом його назву."
|
||
|
||
#: lazarusidestrconsts.dlgedback
|
||
msgid "Back"
|
||
msgstr "Назад"
|
||
|
||
#: lazarusidestrconsts.dlgedbold
|
||
msgid "Bold"
|
||
msgstr "Жирний"
|
||
|
||
#: lazarusidestrconsts.dlgedbsubdir
|
||
msgid "Sub directory"
|
||
msgstr "Підтека"
|
||
|
||
#: lazarusidestrconsts.dlgedcodetempl
|
||
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
||
msgid "Code Templates"
|
||
msgstr "Кодові Шаблони"
|
||
|
||
#: lazarusidestrconsts.dlgedcompleteblocks
|
||
msgid "Add close statement for Pascal blocks"
|
||
msgstr "Додавати до блоків Pascal завершення інструкцій"
|
||
|
||
#: lazarusidestrconsts.dlgedcustomext
|
||
msgid "User defined extension"
|
||
msgstr "Розшир. користувача"
|
||
|
||
#: lazarusidestrconsts.dlgeddelayinsec
|
||
msgid "(%s sec delay)"
|
||
msgstr "(%s сек затримка)"
|
||
|
||
#: lazarusidestrconsts.dlgeddisplay
|
||
msgid "Display"
|
||
msgstr "Показати"
|
||
|
||
#: lazarusidestrconsts.dlgedfiles
|
||
msgid "Editor Files"
|
||
msgstr "Файли Редактора"
|
||
|
||
#: lazarusidestrconsts.dlgedidcomlet
|
||
msgctxt "lazarusidestrconsts.dlgedidcomlet"
|
||
msgid "Identifier completion"
|
||
msgstr "Завершення ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgedinvert
|
||
msgid "Invert"
|
||
msgstr "Інвертувати"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
||
msgid "Ignore Locks, use longest unused editor"
|
||
msgstr "Знехтувати фіксуванням, використати найдовше невикористовуваний редактор"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
||
msgid "Ignore Locks, if editor is current"
|
||
msgstr "Знехтувати фіксуванням, якщо редактор є поточним"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
||
msgid "Ignore Locks, if editor in current window"
|
||
msgstr "Знехтувати фіксуванням якщо редактор у поточному вікні"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
||
msgid "Locked, if text in view"
|
||
msgstr "Фіксовано якщо тест в області перегляду"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
||
msgid "Unlocked"
|
||
msgstr "Розблоковано"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
||
msgid "Unlocked, if text in centered view"
|
||
msgstr "Незафіксований якщо текст в центрі області перегляду"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
||
msgid "New tab, existing or new window"
|
||
msgstr "Нова вкладка, наявне або нове вікно"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
||
msgid "New tab in new window"
|
||
msgstr "Нова вкладка в новому вікні"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
||
msgid "New tab in existing window"
|
||
msgstr "Нова вкладка в наявному вікні"
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
||
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
||
msgstr "Опція вибирає найдовше не використовуваний редактор для файлу, навіть якщо він зафіксований і/або потребує прокрутки. При цьому не враховується порядок переведення фокусу у вікна, навіть якщо вибраний параметр \"той самий порядок критеріїв\". Ця опція завжди працює, наступні за нею не аналізуються."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
||
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Опція перевіряє чи поточний активний редактор має цільовий файл. Якщо так то він використає поточний редактор, навіть якщо той зафіксований і/або потребує прокрутки."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
||
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
||
msgstr "Опція перевіряє чи існує редактор для цільового файлу в поточному вікні. Якщо так то він використає цей редактор, навіть якщо той зафіксований і/або потребує прокрутки."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
||
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
||
msgstr "Опція вибирає зафіксований (і лише зафіксований) Редактор, який не потребує прокрутки для показу цільової точки переходу (вона вже знаходиться в видимій області)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
||
msgid "This option will use any not locked Editor."
|
||
msgstr "Опція вибирає будь-який не зафіксований Редактор."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
||
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
||
msgstr "Опція вибирає незафіксований редактор, якому не потрібна прокрутка для показу цільової точки переходу (вона вже знаходиться в центрі області перегляду, виключаючи 2-5 рядків зверху і знизу)."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
||
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
||
msgstr "Опція відкриває нову Вкладку в наявному або новому Вікні, якщо не знайдено незафіксованої вкладки. Опція завжди спрацює, наступні за нею не перевіряються."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
||
msgstr "Якщо не знайдено незафіксованої вкладки, використання цієї опції призводить до відкриття нової Вкладки в новому Вікні (навіть якщо для цього можуть бути використані наявні вікна). Опція завжди спрацює, наступні за нею не перевіряються."
|
||
|
||
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
||
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
||
msgstr "Якщо не знайдено незафіксованої вкладки, використання цієї опції призводить до відкриття нової Вкладки в наявному (і лише в наявному) Вікні. Вкладка відкривається лише при наявності вікна, що не має редактора для цільового файлу."
|
||
|
||
#: lazarusidestrconsts.dlgedital
|
||
msgid "Italic"
|
||
msgstr "Курсив"
|
||
|
||
#: lazarusidestrconsts.dlgeditorfontsize
|
||
msgid "Editor font size"
|
||
msgstr "Розмір шрифту редактора"
|
||
|
||
#: lazarusidestrconsts.dlgeditoroptions
|
||
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
||
msgid "Editor options"
|
||
msgstr "Налаштування редактора"
|
||
|
||
#: lazarusidestrconsts.dlgeditschemdefaults
|
||
msgid "Scheme globals"
|
||
msgstr "Глобальні параметри схеми"
|
||
|
||
#: lazarusidestrconsts.dlgedmisc
|
||
msgid "Misc"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgedoff
|
||
msgid "Off"
|
||
msgstr "Вимкн."
|
||
|
||
#: lazarusidestrconsts.dlgedon
|
||
msgid "On"
|
||
msgstr "Увімкн."
|
||
|
||
#: lazarusidestrconsts.dlgedtabindent
|
||
msgid "Tab and Indent"
|
||
msgstr "Таби і відступи"
|
||
|
||
#: lazarusidestrconsts.dlgedunder
|
||
msgid "Underline"
|
||
msgstr "Підкреслений"
|
||
|
||
#: lazarusidestrconsts.dlgelementattributes
|
||
msgid "Element Attributes"
|
||
msgstr "Атрибути Елементу"
|
||
|
||
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
||
msgid "End key jumps to nearest end"
|
||
msgstr "End переводить до найближчого кінця"
|
||
|
||
#: lazarusidestrconsts.dlgenvask
|
||
msgid "Ask"
|
||
msgstr "Запитати"
|
||
|
||
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
||
msgid "Notes: Project files are all files in the project directory"
|
||
msgstr "Зауваження: Файлами проекту є всі файли у теці проекту"
|
||
|
||
#: lazarusidestrconsts.dlgenvbckup
|
||
msgid "Backup"
|
||
msgstr "Резервування"
|
||
|
||
#: lazarusidestrconsts.dlgenvfiles
|
||
msgid "Files"
|
||
msgstr "Файли"
|
||
|
||
#: lazarusidestrconsts.dlgenvgrid
|
||
msgid "Grid"
|
||
msgstr "Сітка"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguage
|
||
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: lazarusidestrconsts.dlgenvlanguagehint
|
||
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
||
msgstr "Мова всіх рядків ІСР. Краще після зміни перезапустити ІСР."
|
||
|
||
#: lazarusidestrconsts.dlgenvlguidelines
|
||
msgid "Guide lines"
|
||
msgstr "Лінійки допомоги"
|
||
|
||
#: lazarusidestrconsts.dlgenvmisc
|
||
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgenvnone
|
||
msgctxt "lazarusidestrconsts.dlgenvnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.dlgenvotherfiles
|
||
msgid "Other Files"
|
||
msgstr "Інші Файли"
|
||
|
||
#: lazarusidestrconsts.dlgenvproject
|
||
msgid "Tabs for project"
|
||
msgstr "Вкладки для проекту"
|
||
|
||
#: lazarusidestrconsts.dlgenvtype
|
||
msgctxt "lazarusidestrconsts.dlgenvtype"
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
||
msgid "Focus messages at compilation"
|
||
msgstr "Фокусувати при компіляції на вікні повідомлень"
|
||
|
||
#: lazarusidestrconsts.dlgextracharspacing
|
||
msgid "Extra char spacing"
|
||
msgstr "Додат. міжсимвольний інтервал"
|
||
|
||
#: lazarusidestrconsts.dlgextralinespacing
|
||
msgid "Extra line spacing"
|
||
msgstr "Міжрядковий інтервал"
|
||
|
||
#: lazarusidestrconsts.dlgextsymb
|
||
msgid "Use external gdb debug symbols file"
|
||
msgstr "Використовувати зовнішній файл зневаджувальних символів gdb"
|
||
|
||
#: lazarusidestrconsts.dlgfileexts
|
||
msgid "File extensions"
|
||
msgstr "Файлові розширення"
|
||
|
||
#: lazarusidestrconsts.dlgfiles
|
||
msgid "%s files"
|
||
msgstr "%s файлів"
|
||
|
||
#: lazarusidestrconsts.dlgfilterall
|
||
msgctxt "lazarusidestrconsts.dlgfilterall"
|
||
msgid "All files"
|
||
msgstr "Всі файли"
|
||
|
||
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
||
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
|
||
msgid "CodeTools template file"
|
||
msgstr "Файл шаблону CodeTools"
|
||
|
||
#: lazarusidestrconsts.dlgfilterdcifile
|
||
msgid "DCI file"
|
||
msgstr "Файл DCI"
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiform
|
||
msgid "Delphi form"
|
||
msgstr "Форма Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphipackage
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
||
msgid "Delphi package"
|
||
msgstr "Пакунок Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiproject
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
||
msgid "Delphi project"
|
||
msgstr "Проект Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgfilterdelphiunit
|
||
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
||
msgid "Delphi unit"
|
||
msgstr "Модуль Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgfilterexecutable
|
||
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
||
msgid "Executable"
|
||
msgstr "Виконуваний"
|
||
|
||
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
||
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
|
||
msgid "FPC message file"
|
||
msgstr "Файл повідомлень FPC"
|
||
|
||
#: lazarusidestrconsts.dlgfilterhtml
|
||
msgid "HTML files"
|
||
msgstr "Файли HTML"
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
||
msgid "Bitmap images"
|
||
msgstr "Зображення Bitmap"
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagespixmap
|
||
msgid "Pixmap images"
|
||
msgstr "Зображення Pixmap"
|
||
|
||
#: lazarusidestrconsts.dlgfilterimagespng
|
||
msgid "PNG images"
|
||
msgstr "Зображення PNG"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
|
||
msgid "Lazarus Desktop Settings"
|
||
msgstr "Налаштування стільниці Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
|
||
msgid "Editor file types"
|
||
msgstr "Типи файлів Редактора"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
|
||
msgid "Lazarus file"
|
||
msgstr "Файл Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusform
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
|
||
msgid "Lazarus form"
|
||
msgstr "Форма Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
|
||
msgid "Lazarus include file"
|
||
msgstr "Lazarus-файли для включення"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
|
||
msgid "Lazarus other file"
|
||
msgstr "Інші файли Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
|
||
msgid "Lazarus package"
|
||
msgstr "Пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusproject
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
|
||
msgid "Lazarus project"
|
||
msgstr "Проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
|
||
msgid "Lazarus project source"
|
||
msgstr "Сирець проекту Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarussession
|
||
msgid "Lazarus session"
|
||
msgstr "Сеанс Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterlazarusunit
|
||
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
|
||
msgid "Lazarus unit"
|
||
msgstr "Модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgfilterpascalfile
|
||
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
|
||
msgid "Pascal file"
|
||
msgstr "Файл Pascal"
|
||
|
||
#: lazarusidestrconsts.dlgfilterprograms
|
||
msgctxt "lazarusidestrconsts.dlgfilterprograms"
|
||
msgid "Programs"
|
||
msgstr "Програми"
|
||
|
||
#: lazarusidestrconsts.dlgfilterxml
|
||
msgctxt "lazarusidestrconsts.dlgfilterxml"
|
||
msgid "XML files"
|
||
msgstr "Файли XML"
|
||
|
||
#: lazarusidestrconsts.dlgfindtextatcursor
|
||
msgid "Find text at cursor"
|
||
msgstr "Знайти текст над курсором"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunk
|
||
msgid "Chunk"
|
||
msgstr "Шматок"
|
||
|
||
#: lazarusidestrconsts.dlgfolddiffchunksect
|
||
msgid "Chunk section"
|
||
msgstr "Вибір шматка"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlasp
|
||
msgid "ASP"
|
||
msgstr "ASP"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Коментар"
|
||
|
||
#: lazarusidestrconsts.dlgfoldhtmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
||
msgid "Node"
|
||
msgstr "Вузол"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmitem
|
||
msgid "Item"
|
||
msgstr "Елемент"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmlist
|
||
msgid "List <>"
|
||
msgstr "Список <>"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlfmobject
|
||
msgid "Object (inherited, inline)"
|
||
msgstr "Об'єкт (успадкований, вбудований)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
||
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
||
msgid "Var/Type (local)"
|
||
msgstr "Var/Type (локальні)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasansicomment
|
||
msgid "Comment (* *)"
|
||
msgstr "Коментар (* *)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasasm
|
||
msgid "Asm"
|
||
msgstr "Asm"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasbeginend
|
||
msgid "Begin/End (nested)"
|
||
msgstr "Begin/End (вкладені)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasborcomment
|
||
msgid "Comment { }"
|
||
msgstr "Коментар { }"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpascase
|
||
msgid "Case"
|
||
msgstr "Case"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclass
|
||
msgid "Class/Object"
|
||
msgstr "Class/Object"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasclasssection
|
||
msgid "public/private"
|
||
msgstr "public/private"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasexcept
|
||
msgid "Except/Finally"
|
||
msgstr "Except/Finally"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasfordo
|
||
msgid "For/Do"
|
||
msgstr "For/Do"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifdef
|
||
msgid "{$IfDef}"
|
||
msgstr "{$IfDef}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasifthen
|
||
msgid "If/Then/Else"
|
||
msgstr "If/Then/Else"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
||
msgid "Nested Comment"
|
||
msgstr "Вкладений Коментар"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
||
msgid "Begin/End (procedure)"
|
||
msgstr "Begin/End (процедура)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprocedure
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Процедура"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasprogram
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
||
msgid "Program"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrecord
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
||
msgid "Record"
|
||
msgstr "Record"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasrepeat
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
||
msgid "Comment //"
|
||
msgstr "Коментар //"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpastry
|
||
msgid "Try"
|
||
msgstr "Try"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunit
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasunitsection
|
||
msgid "Unit section"
|
||
msgstr "Секції модуля"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuserregion
|
||
msgid "{%Region}"
|
||
msgstr "{%Region}"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasuses
|
||
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpasvartype
|
||
msgid "Var/Type (global)"
|
||
msgstr "Var/Type (глобальні)"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
||
msgid "While/Do"
|
||
msgstr "While/Do"
|
||
|
||
#: lazarusidestrconsts.dlgfoldpaswithdo
|
||
msgid "With/Do"
|
||
msgstr "With/Do"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcdata
|
||
msgid "CData"
|
||
msgstr "CData"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlcomment
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
||
msgid "Comment"
|
||
msgstr "Коментар"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmldoctype
|
||
msgid "DocType"
|
||
msgstr "DocType"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlnode
|
||
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
||
msgid "Node"
|
||
msgstr "Вузол"
|
||
|
||
#: lazarusidestrconsts.dlgfoldxmlprocess
|
||
msgid "Processing Instruction"
|
||
msgstr "Інструкція Обробки"
|
||
|
||
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
||
msgid "The running Lazarus instance cannot accept any files."
|
||
msgstr "Запущений примірник Lazarus не має доступу до жодних файлів."
|
||
|
||
#: lazarusidestrconsts.dlgforecolor
|
||
msgid "Foreground"
|
||
msgstr "Колір переднього плану"
|
||
|
||
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
||
msgid "Change Object Inspector contents on clicking form title bar"
|
||
msgstr "Змінювати вміст Інспектора об'єктів при клацанні заголовка форми"
|
||
|
||
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
||
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
||
msgstr "Показувати в Інспекторі об'єктів властивості форми при клацанні її заголовка.Показувати в Інспекторі об'єктів властивості форми при клацанні її заголовка."
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
||
msgid "Procedure insert policy"
|
||
msgstr "Політика вставки процедур"
|
||
|
||
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
||
msgid "Keep order of procedures"
|
||
msgstr "Залишати порядок процедур"
|
||
|
||
#: lazarusidestrconsts.dlgfpcexecutable
|
||
msgid "Compiler executable (e.g. %s)"
|
||
msgstr "Виконуваний файл компілятора (наприклад, %s)"
|
||
|
||
#: lazarusidestrconsts.dlgfpcsrcpath
|
||
msgid "FPC source directory"
|
||
msgstr "Тека кодів FPC"
|
||
|
||
#: lazarusidestrconsts.dlgframecolor
|
||
msgid "Text-mark"
|
||
msgstr "Відмітка"
|
||
|
||
#: lazarusidestrconsts.dlgfrmeditor
|
||
msgid "Form Editor"
|
||
msgstr "Редактор форм"
|
||
|
||
#: lazarusidestrconsts.dlgfrombeginning
|
||
msgid "From b&eginning"
|
||
msgstr "З по&чатку"
|
||
|
||
#: lazarusidestrconsts.dlgfromcursor
|
||
msgid "&From cursor"
|
||
msgstr "&Від курсора"
|
||
|
||
#: lazarusidestrconsts.dlggetposition
|
||
msgid "Get position"
|
||
msgstr "Задіяти позицію"
|
||
|
||
#: lazarusidestrconsts.dlgglobal
|
||
msgid "&Global"
|
||
msgstr "&Глобально"
|
||
|
||
#: lazarusidestrconsts.dlggprof
|
||
msgid "Generate code for gprof"
|
||
msgstr "Створити код для gprof"
|
||
|
||
#: lazarusidestrconsts.dlggrabbercolor
|
||
msgid "Grabber color"
|
||
msgstr "Колір виділення"
|
||
|
||
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
||
msgid "Grayed desktops are for undocked environment."
|
||
msgstr "Сірим позначено стільниці для оточення без стикування."
|
||
|
||
#: lazarusidestrconsts.dlggridcolor
|
||
msgid "Grid color"
|
||
msgstr "Колір сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
||
msgid "Grid consists of small dots which help aligning controls."
|
||
msgstr "Сітка складається з крапочок, які допомагають вирівнювати елементи керування."
|
||
|
||
#: lazarusidestrconsts.dlggridx
|
||
msgid "Grid size X"
|
||
msgstr "Розмір X сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridxhint
|
||
msgid "Horizontal grid step size"
|
||
msgstr "Крок сітки по горизонталі"
|
||
|
||
#: lazarusidestrconsts.dlggridy
|
||
msgid "Grid size Y"
|
||
msgstr "Розмір Y сітки"
|
||
|
||
#: lazarusidestrconsts.dlggridyhint
|
||
msgid "Vertical grid step size"
|
||
msgstr "Вертикальний крок сітки"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodeexplorer
|
||
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Провідник Коду"
|
||
|
||
#: lazarusidestrconsts.dlggroupcodetools
|
||
msgid "Codetools"
|
||
msgstr "Codetools"
|
||
|
||
#: lazarusidestrconsts.dlggroupdebugger
|
||
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Зневаджувач"
|
||
|
||
#: lazarusidestrconsts.dlggroupeditor
|
||
msgid "Editor"
|
||
msgstr "Редактор"
|
||
|
||
#: lazarusidestrconsts.dlggroupenvironment
|
||
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
||
msgid "Environment"
|
||
msgstr "Середовище"
|
||
|
||
#: lazarusidestrconsts.dlggroupundo
|
||
msgid "Group Undo"
|
||
msgstr "Груповий відкот"
|
||
|
||
#: lazarusidestrconsts.dlgguidelines
|
||
msgid "Show Guide Lines"
|
||
msgstr "Показувати лінійки"
|
||
|
||
#: lazarusidestrconsts.dlgguidelineshint
|
||
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
||
msgstr "Коли елемент керування вирівняно по горизонталі чи по вертикалі з іншим, з'являється синя напрямна лінія."
|
||
|
||
#: lazarusidestrconsts.dlggutter
|
||
msgctxt "lazarusidestrconsts.dlggutter"
|
||
msgid "Gutter"
|
||
msgstr "Смужка"
|
||
|
||
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
||
msgid "Collapsed"
|
||
msgstr "Згорнуто"
|
||
|
||
#: lazarusidestrconsts.dlgguttercolor
|
||
msgid "Gutter Color"
|
||
msgstr "Колір смужки"
|
||
|
||
#: lazarusidestrconsts.dlggutteredgecolor
|
||
msgid "Gutter Edge Color"
|
||
msgstr "Колір краю смужки"
|
||
|
||
#: lazarusidestrconsts.dlggutterseparatorindex
|
||
msgid "Gutter separator index"
|
||
msgstr "Показник роздільної смужки"
|
||
|
||
#: lazarusidestrconsts.dlghalfpagescroll
|
||
msgid "Half page scroll"
|
||
msgstr "Прокрутка на півсторінки"
|
||
|
||
#: lazarusidestrconsts.dlgheapandstacksize
|
||
msgid "Heap and stack sizes"
|
||
msgstr "Розміри купи і стеку"
|
||
|
||
#: lazarusidestrconsts.dlgheapsize
|
||
msgid "Heap size"
|
||
msgstr "Розмір купи"
|
||
|
||
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
||
msgid "Height of one property in the grid."
|
||
msgstr "Висота однієї властивості на сітці."
|
||
|
||
#: lazarusidestrconsts.dlgheightpos
|
||
msgid "Height:"
|
||
msgstr "Висота:"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrun
|
||
msgid "Hide IDE windows on run"
|
||
msgstr "Приховати вікна ІСР при пуску"
|
||
|
||
#: lazarusidestrconsts.dlghideideonrunhint
|
||
msgid "Do not show the IDE at all while program is running."
|
||
msgstr "Зовсім не показувати ІСР при запущеній програмі."
|
||
|
||
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
||
msgid "Hide tab in single page windows"
|
||
msgstr "Ховати заголовок одиничної вкладки"
|
||
|
||
#: lazarusidestrconsts.dlghighlightcolor
|
||
msgid "Highlight Color"
|
||
msgstr "Підсвічувати Колір"
|
||
|
||
#: lazarusidestrconsts.dlghighlightfontcolor
|
||
msgid "Highlight Font Color"
|
||
msgstr "Підсвічувати Колір Шрифту"
|
||
|
||
#: lazarusidestrconsts.dlghighlightleftofcursor
|
||
msgid "Left Of Cursor"
|
||
msgstr "Зліва від курсора"
|
||
|
||
#: lazarusidestrconsts.dlghighlightrightofcursor
|
||
msgid "Right Of Cursor"
|
||
msgstr "Справа від курсора"
|
||
|
||
#: lazarusidestrconsts.dlghintsparametersendernotused
|
||
msgid "Show hints for parameter \"Sender\" not used"
|
||
msgstr "Показ порад до параметру \"Відправник\" не використаний"
|
||
|
||
#: lazarusidestrconsts.dlghintsunused
|
||
msgid "Show hints for unused units in main"
|
||
msgstr "Довідки для непотрібних модулів в головному коді"
|
||
|
||
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
||
msgid "Home key jumps to nearest start"
|
||
msgstr "Home переводить до найближчого старту"
|
||
|
||
#: lazarusidestrconsts.dlghostapplication
|
||
msgid "Host application"
|
||
msgstr "Основний застосунок"
|
||
|
||
#: lazarusidestrconsts.dlgidentifiercompletion
|
||
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
|
||
msgid "Identifier Completion"
|
||
msgstr "Завершення ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgidentifierpolicy
|
||
msgid "Identifier policy"
|
||
msgstr "Політика ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.dlgideoptions
|
||
msgid "IDE Options"
|
||
msgstr "Параметри ІСР"
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockactive
|
||
msgid "Active $IFDEF code"
|
||
msgstr "Активний код $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgifdefblockinactive
|
||
msgid "Inactive $IFDEF code"
|
||
msgstr "Неактивний код $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
||
msgid "Included mixed state $IFDEF code"
|
||
msgstr "Умовно активний код, що підключається в $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeactive
|
||
msgid "Active $IFDEF node"
|
||
msgstr "Активний вузол $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodeinactive
|
||
msgid "Inactive $IFDEF node"
|
||
msgstr "Неактивний вузол $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
||
msgid "Included mixed state $IFDEF node"
|
||
msgstr "Включений умовно активний вузол $IFDEF"
|
||
|
||
#: lazarusidestrconsts.dlgimportdesktopexists
|
||
msgid ""
|
||
"A desktop with the same name already exists.\n"
|
||
"Please confirm the desktop name:\n"
|
||
msgstr ""
|
||
"Стільниця з такою назвою вже існує.\n"
|
||
"Підтвердьте назву стільниці:\n"
|
||
|
||
#: lazarusidestrconsts.dlgincludesystemvariables
|
||
msgid "Include system variables"
|
||
msgstr "Включити системні змінні"
|
||
|
||
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
||
msgid "Indent"
|
||
msgstr "Відступ"
|
||
|
||
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
||
msgid "Tabs"
|
||
msgstr "Таби"
|
||
|
||
#: lazarusidestrconsts.dlginfrontofmethods
|
||
msgid "In front of methods"
|
||
msgstr "Перед методами"
|
||
|
||
#: lazarusidestrconsts.dlginitdoneonly
|
||
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
||
msgstr "Конструктор має бути 'init' (деструктор має бути 'done')"
|
||
|
||
#: lazarusidestrconsts.dlginsertclassparts
|
||
msgid "Insert class parts"
|
||
msgstr "Вставити частини класу"
|
||
|
||
#: lazarusidestrconsts.dlginsertimplementation
|
||
msgid "Implementation"
|
||
msgstr "Реалізація"
|
||
|
||
#: lazarusidestrconsts.dlginsertinterface
|
||
msgid "Interface"
|
||
msgstr "Інтерфейс"
|
||
|
||
#: lazarusidestrconsts.dlginsertmethods
|
||
msgid "Insert method implementations"
|
||
msgstr "Вставити реалізацію методів"
|
||
|
||
#: lazarusidestrconsts.dlginsertsection
|
||
msgid "Insert into Uses section of"
|
||
msgstr "Вставити в секцію Uses в"
|
||
|
||
#: lazarusidestrconsts.dlginsspaceafter
|
||
msgid "Insert space after"
|
||
msgstr "Вставляти пробіл після"
|
||
|
||
#: lazarusidestrconsts.dlginsspacefront
|
||
msgid "Insert space in front of"
|
||
msgstr "Вставляти пробіл перед"
|
||
|
||
#: lazarusidestrconsts.dlgintvinsec
|
||
msgid "Interval in secs"
|
||
msgstr "Інтервал в сек"
|
||
|
||
#: lazarusidestrconsts.dlgjumpingetc
|
||
msgid "Jumping (e.g. Method Jumping)"
|
||
msgstr "Перехід (напр. Метод Переходу)"
|
||
|
||
#: lazarusidestrconsts.dlgjumptomethodbody
|
||
msgid "Jump directly to method body"
|
||
msgstr "Перейти прямо до тіла методу"
|
||
|
||
#: lazarusidestrconsts.dlgkeepcursorx
|
||
msgid "Keep cursor X position"
|
||
msgstr "Зберігати позицію курсору по осі X"
|
||
|
||
#: lazarusidestrconsts.dlgkeylink
|
||
msgid "(Edit Key)"
|
||
msgstr "(Змінити клавіші)"
|
||
|
||
#: lazarusidestrconsts.dlgkeymapping
|
||
msgid "Key Mappings"
|
||
msgstr "Клавіші"
|
||
|
||
#: lazarusidestrconsts.dlgkeymappingerrors
|
||
msgid "Key mapping errors"
|
||
msgstr "Помилки комбінацій клавіш"
|
||
|
||
#: lazarusidestrconsts.dlgkeywordpolicy
|
||
msgid "Keyword policy"
|
||
msgstr "Політика ключових слів"
|
||
|
||
#: lazarusidestrconsts.dlglabelgoto
|
||
msgid "Allow LABEL and GOTO"
|
||
msgstr "Дозволити LABEL і GOTO"
|
||
|
||
#: lazarusidestrconsts.dlglang
|
||
msgctxt "lazarusidestrconsts.dlglang"
|
||
msgid "Language"
|
||
msgstr "Мова"
|
||
|
||
#: lazarusidestrconsts.dlglast
|
||
msgid "Last (i.e. at end of source)"
|
||
msgstr "Останній (напр. в кінці коду)"
|
||
|
||
#: lazarusidestrconsts.dlglazarusdir
|
||
msgid "Lazarus directory (default for all projects)"
|
||
msgstr "Тека Lazarus (за замовчуванням для всіх проектів)"
|
||
|
||
#: lazarusidestrconsts.dlgleftpos
|
||
msgid "Left:"
|
||
msgstr "Зліва:"
|
||
|
||
#: lazarusidestrconsts.dlglefttopclr
|
||
msgid "Guide lines Left,Top"
|
||
msgstr "Напрямні лінії ліва,верхня"
|
||
|
||
#: lazarusidestrconsts.dlglevel1opt
|
||
msgid "1 (quick, debugger friendly)"
|
||
msgstr "1 (швидко та дружньо до зневаджувача)"
|
||
|
||
#: lazarusidestrconsts.dlglevel2opt
|
||
msgid "2 (-O1 + quick optimizations)"
|
||
msgstr "2 (Рівень 1 + швидкі оптимізації)"
|
||
|
||
#: lazarusidestrconsts.dlglevel3opt
|
||
msgid "3 (-O2 + slow optimizations)"
|
||
msgstr "3 (Рівень 2 + повільні оптимізації)"
|
||
|
||
#: lazarusidestrconsts.dlglevel4opt
|
||
msgid "4 (-O3 + aggressive optimizations, beware)"
|
||
msgstr "4 (Рівень 3 + агресивні оптимізації, обережно)"
|
||
|
||
#: lazarusidestrconsts.dlglevelnoneopt
|
||
msgid "0 (no optimization)"
|
||
msgstr " 0 (без оптимізації)"
|
||
|
||
#: lazarusidestrconsts.dlglinesplitting
|
||
msgid "Line Splitting"
|
||
msgstr "Розчіплювання рядка"
|
||
|
||
#: lazarusidestrconsts.dlglinksmart
|
||
msgid "Link smart"
|
||
msgstr "Розумне компонування"
|
||
|
||
#: lazarusidestrconsts.dlglnumsbct
|
||
msgid "Display line numbers in run-time error backtraces"
|
||
msgstr "Вивести номери рядків в помилках часу виконання"
|
||
|
||
#: lazarusidestrconsts.dlgmainmenu
|
||
msgid "Main Menu"
|
||
msgstr "Головне меню"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewforms
|
||
msgid "View Project Forms"
|
||
msgstr "Показати форми проекту"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewframes
|
||
msgid "View Project Frames"
|
||
msgstr "Показати фрейми проекту"
|
||
|
||
#: lazarusidestrconsts.dlgmainviewunits
|
||
msgctxt "lazarusidestrconsts.dlgmainviewunits"
|
||
msgid "View Project Units"
|
||
msgstr "Показувати Модулі Проекту"
|
||
|
||
#: lazarusidestrconsts.dlgmakeexecutable
|
||
msgid "\"Make\" executable"
|
||
msgstr "Виконуваний файл \"Make\""
|
||
|
||
#: lazarusidestrconsts.dlgmanagedesktops
|
||
msgid "Manage desktops"
|
||
msgstr "Керування стільницями"
|
||
|
||
#: lazarusidestrconsts.dlgmargingutter
|
||
msgid "Margin and gutter"
|
||
msgstr "Межі і смужка"
|
||
|
||
#: lazarusidestrconsts.dlgmarkercolor
|
||
msgid "Marker color"
|
||
msgstr "Колір маркера"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupgroup
|
||
msgid "Highlight of Word under Caret"
|
||
msgstr "Підсвітка Слова під Курсором"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupoutline
|
||
msgid "Outline (global)"
|
||
msgstr "Контур (глобально)"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefined
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
||
msgid "User defined markup"
|
||
msgstr "Користувацька розмітка"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
||
msgid "Delete list \"%s\"?"
|
||
msgstr "Вилучити список \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
||
msgid "Add Word or Term"
|
||
msgstr "Додати слово або термін"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
||
msgid "Remove Word or Term"
|
||
msgstr "Вилучити слово або термін"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
||
msgid "Toggle Word or Term"
|
||
msgstr "Перемкнути слово або термін"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
||
msgid "Duplicate Term"
|
||
msgstr "Дублювати термін"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
||
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
||
msgstr "Термін %s вже існує. При збереженні списку дублі буде вилучено."
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
||
msgid "Add/Remove in all editors"
|
||
msgstr "Додати/вилучити у всіх редакторах"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
||
msgid "Delete list"
|
||
msgstr "Видалити список"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
||
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
||
msgid "Add list"
|
||
msgstr "Додати список"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
||
msgid "Case sensitive"
|
||
msgstr "Враховувати регістр"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
||
msgid "Set bound at term end"
|
||
msgstr "Встановити межу в кінці терму"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
||
msgid "Set bound at term start"
|
||
msgstr "Встановити межу на початку терму"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
||
msgid "Ignore bounds for terms longer than"
|
||
msgstr "Нехтувати межі термів довші, ніж"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
||
msgid "selection"
|
||
msgstr "вибране"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
||
msgid "current word"
|
||
msgstr "поточне слово"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
||
msgid "Settings for terms added by key"
|
||
msgstr "Параметри термів, доданих клавішами"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
||
msgid "Smart match selection bounds"
|
||
msgstr "Розумні межі вибору відповідності"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
||
msgid "New list"
|
||
msgstr "Новий список"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
||
msgid "No lists"
|
||
msgstr "Немає списків"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
||
msgid "Select ..."
|
||
msgstr "Виберіть ..."
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
||
msgid "Key Settings"
|
||
msgstr "Параметри клавіш"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
||
msgid "Main settings"
|
||
msgstr "Головні параметри"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordbracket
|
||
msgid "Word Brackets on caret (global)"
|
||
msgstr "Операторні дужки біля курсора (глобально)"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
||
msgid "Match word boundaries for words up to this length:"
|
||
msgstr "Шукати межі для слів не довше:"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
||
msgid "Ignore keywords"
|
||
msgstr "Ігнорувати ключові слова"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
||
msgid "Disable timer for markup current word"
|
||
msgstr "Вимкнути таймер для підсвітки поточного слова"
|
||
|
||
#: lazarusidestrconsts.dlgmarkupwordtrim
|
||
msgid "Trim spaces (when highlighting current selection)"
|
||
msgstr "Обрізати пробіли (при підсвічуванні поточного вибору)"
|
||
|
||
#: lazarusidestrconsts.dlgmaxcntr
|
||
msgid "Maximum counter"
|
||
msgstr "Максимум лічильника"
|
||
|
||
#: lazarusidestrconsts.dlgmaxlinelength
|
||
msgid "Max line length:"
|
||
msgstr "Максимальна довжина рядка"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentfiles
|
||
msgid "Max recent files"
|
||
msgstr "Максимум останніх файлів"
|
||
|
||
#: lazarusidestrconsts.dlgmaxrecentprojs
|
||
msgid "Max recent project files"
|
||
msgstr "Максимум останніх файлів проектів"
|
||
|
||
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
||
msgid "Mix methods and properties"
|
||
msgstr "Змішування методів і властивостей"
|
||
|
||
#: lazarusidestrconsts.dlgmouseaction
|
||
msgid "Mouse Action"
|
||
msgstr "Дія мишею"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
||
msgid "Single"
|
||
msgstr "Одинарний"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
||
msgid "Double"
|
||
msgstr "Подвійний"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn3
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
||
msgid "Triple"
|
||
msgstr "Потрійний"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtn4
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
||
msgid "Quad"
|
||
msgstr "Почетвірний"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnany
|
||
msgid "Any"
|
||
msgstr "Будь-який"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
||
msgid "Extra 1"
|
||
msgstr "Екстра 1"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
||
msgid "Extra 2"
|
||
msgstr "Екстра 2"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||
msgid "Middle"
|
||
msgstr "Середина"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
||
msgid "Make Fallback"
|
||
msgstr "Зробити відкот"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
||
msgid "Wheel down"
|
||
msgstr "Колесо вниз"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
||
msgid "Wheel up"
|
||
msgstr "Колесо вверх"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcapture
|
||
msgid "Capture"
|
||
msgstr "Захоплення"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
||
msgid "Move Caret (extra)"
|
||
msgstr "Перемістити курсор (додатково)"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
||
msgid "Act on Mouse up"
|
||
msgstr "При відпусканні кнопки"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescaction
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
||
msgid "Action"
|
||
msgstr "Дія"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
||
msgid "Click"
|
||
msgstr "Клацання"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
||
msgid "Edit Mouse"
|
||
msgstr "Параметри Мишки"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrordup
|
||
msgid "Duplicate Entry"
|
||
msgstr "Дублювати Запис"
|
||
|
||
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
||
msgid "This entry conflicts with an existing entry"
|
||
msgstr "Цей елемент суперечить вже наявному"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
||
msgid "Button"
|
||
msgstr "Кнопка"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
||
msgid "Caret"
|
||
msgstr "Каретка"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
||
msgid "Context"
|
||
msgstr "Контекст"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadcount
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
||
msgid "Click"
|
||
msgstr "Клацання"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
||
msgid "Action"
|
||
msgstr "Дія"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheaddir
|
||
msgid "Up/Down"
|
||
msgstr "Вверх/Вниз"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadopt
|
||
msgid "Option"
|
||
msgstr "Параметр"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadorder
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
||
msgid "Order"
|
||
msgstr "Порядок"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
||
msgid "Priority"
|
||
msgstr "Пріоритет"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptheadshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptions
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
||
msgid "Mouse"
|
||
msgstr "Мишка"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsadv
|
||
msgid "Advanced"
|
||
msgstr "Розширені"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
||
msgid "IDE-Command"
|
||
msgstr "Команда ІСР"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodalt
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
||
msgid "Alt"
|
||
msgstr "Alt"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
||
msgid "Ctrl"
|
||
msgstr "Ctrl"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
||
msgid "n"
|
||
msgstr "n"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
||
msgid "-"
|
||
msgstr "-"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmodshift
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
||
msgid "Shift"
|
||
msgstr "Shift"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
||
msgid "Y"
|
||
msgstr "Y"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeall
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
||
msgid "All"
|
||
msgstr "Всі"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
||
msgid "Gutter"
|
||
msgstr "Смужка"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
||
msgid "Line Changes"
|
||
msgstr "Маркери змін"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
||
msgid "Fold Tree"
|
||
msgstr "Згорнути дерево"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
||
msgid "Collapsed [+]"
|
||
msgstr "Згорнуто [+]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
||
msgid "Expanded [-]"
|
||
msgstr "Розгорнуто [-]"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
||
msgid "Overview"
|
||
msgstr "Огляд"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
||
msgid "Overview Mark"
|
||
msgstr "Мітка огляду"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
||
msgid "Line Numbers"
|
||
msgstr "Номери Рядів"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodemain
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
||
msgid "Selection"
|
||
msgstr "Виділення"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptopt2label
|
||
msgid "Opt"
|
||
msgstr "Опц"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheract
|
||
msgid "Other actions using the same button"
|
||
msgstr "Інші дії з використанням тієї ж кнопки"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
||
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
||
msgstr "Вони можуть бути виконані в залежності від натискання клавіш-модифікаторів, параметрів провалювання, Один/Два натискання, Вверх/Вниз ..."
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
||
msgid "Filter Mod-Keys"
|
||
msgstr "Фільтрувати клавіші-модифікатори"
|
||
|
||
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
||
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
||
msgid "Priority"
|
||
msgstr "Пріоритет"
|
||
|
||
#: lazarusidestrconsts.dlgmsgs
|
||
msgctxt "lazarusidestrconsts.dlgmsgs"
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
||
msgid "Debug"
|
||
msgstr "Зневадження"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
||
msgid "Fatal"
|
||
msgstr "Фатальна помилка"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
||
msgid "Hint"
|
||
msgstr "Підказка"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
||
msgid "Important"
|
||
msgstr "Важливо"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
||
msgid "Normal"
|
||
msgstr "Звичайне"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
||
msgid "Note"
|
||
msgstr "Зауваження"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
||
msgid "Panic"
|
||
msgstr "Паніка"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
||
msgid "Time and statistics"
|
||
msgstr "Час і статистика"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
||
msgid "Verbose"
|
||
msgstr "Детально"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
||
msgid "Verbose 2"
|
||
msgstr "Детально 2"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
||
msgid "Verbose 3"
|
||
msgstr "Детально 3"
|
||
|
||
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
||
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
||
msgid "Warning"
|
||
msgstr "Попередження"
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
||
msgid "Multi-caret (column-select) move with cursor"
|
||
msgstr "Переміщувати всі курсори за основним при виборі стовпця"
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretmode
|
||
msgid "Multi-caret move with cursor"
|
||
msgstr "Переміщувати всі курсори за основним"
|
||
|
||
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
||
msgid "Enable multi caret for column selection"
|
||
msgstr "Увімкнути декілька курсорів при виборі стовпців"
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances
|
||
msgid "Multiple Lazarus instances"
|
||
msgstr "Декілька примірників Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
||
msgid "always start a new instance"
|
||
msgstr "завжди запускати новий примірник"
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
||
msgid "do not allow multiple instances"
|
||
msgstr "не допускати декількох примірників"
|
||
|
||
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
||
msgid "open files in a running instance"
|
||
msgstr "відкривати файли у запущеному примірнику"
|
||
|
||
#: lazarusidestrconsts.dlgmultiselect
|
||
msgid "Multi Select"
|
||
msgstr "Множинний вибір"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
||
msgid "Find Editor for Jump Targets"
|
||
msgstr "Знайти редактор для цілей переходу"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
||
msgid "Order to use for editors matching the same criteria"
|
||
msgstr "Порядок використання редакторів, що відповідають однаковим критеріям"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
||
msgid "Most recent focused editor for this file"
|
||
msgstr "Останній вибраний редактор для даного файлу"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
||
msgid "Editor (for file) in most recent focused window"
|
||
msgstr "Редактор (для файлу) в останньому вибраному вікні"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
||
msgid "Priority list of criteria to choose an editor:"
|
||
msgstr "Список критеріїв вибору редактора за пріоритетом:"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwinoptions
|
||
msgid "Pages and Windows"
|
||
msgstr "Сторінки та вікна"
|
||
|
||
#: lazarusidestrconsts.dlgmultiwintabgroup
|
||
msgid "Notebook Tabs"
|
||
msgstr "Вкладки Блокноту"
|
||
|
||
#: lazarusidestrconsts.dlgnaming
|
||
msgid "Naming"
|
||
msgstr "Надання назви"
|
||
|
||
#: lazarusidestrconsts.dlgnewdesktop
|
||
msgid "New desktop ..."
|
||
msgstr "Нова стільниця ..."
|
||
|
||
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
||
msgid "No automatic renaming"
|
||
msgstr "Без автоперейменування"
|
||
|
||
#: lazarusidestrconsts.dlgnoavailableunits
|
||
msgid "No available units to add."
|
||
msgstr "Немає наявних модулів щоб додати."
|
||
|
||
#: lazarusidestrconsts.dlgnobrackethighlight
|
||
msgid "No Highlight"
|
||
msgstr "Без підсвічування"
|
||
|
||
#: lazarusidestrconsts.dlgnotebooktabpos
|
||
msgid "Source notebook tabs position"
|
||
msgstr "Початкове положення вкладок блокноту"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlineafter
|
||
msgid "Do not split line after"
|
||
msgstr "Не розривати рядок після"
|
||
|
||
#: lazarusidestrconsts.dlgnotsplitlinefront
|
||
msgid "Do not split line in front of"
|
||
msgstr "Не розривати рядок перед"
|
||
|
||
#: lazarusidestrconsts.dlgobjinsp
|
||
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
||
msgid "Object Inspector"
|
||
msgstr "Інспектор об'єктів"
|
||
|
||
#: lazarusidestrconsts.dlgoiitemheight
|
||
msgid "Item height (0 = auto)"
|
||
msgstr "Висота елемента (0 = автоматично)"
|
||
|
||
#: lazarusidestrconsts.dlgoimiscellaneous
|
||
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgoispeedsettings
|
||
msgid "Speed settings"
|
||
msgstr "Параметри Швидкості"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
||
msgid "Use default Delphi settings"
|
||
msgstr "Викор. типові параметри Delphi"
|
||
|
||
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
||
msgid "Use default Lazarus settings"
|
||
msgstr "Викор. типові параметри Lazarus"
|
||
|
||
#: lazarusidestrconsts.dlgoptimizationlevels
|
||
msgid "Optimization levels"
|
||
msgstr "Рівні оптимізації"
|
||
|
||
#: lazarusidestrconsts.dlgotheroptimizations
|
||
msgid "Other optimizations"
|
||
msgstr "Інші оптимізації"
|
||
|
||
#: lazarusidestrconsts.dlgotherunitfiles
|
||
msgid "Other unit files (-Fu):"
|
||
msgstr "Інші файли модулів (-Fu):"
|
||
|
||
#: lazarusidestrconsts.dlgoverwriteblock
|
||
msgid "Overwrite block"
|
||
msgstr "Переписати блок"
|
||
|
||
#: lazarusidestrconsts.dlgoverwritedesktop
|
||
msgid ""
|
||
"Desktop with the name \"%s\" was found.\n"
|
||
"Should the old desktop be overwritten?\n"
|
||
msgstr ""
|
||
"Знайдено стільницю з назвою \"%s\".\n"
|
||
"Перезаписати стару стільницю?\n"
|
||
|
||
#: lazarusidestrconsts.dlgpalhints
|
||
msgid "Hints for component palette"
|
||
msgstr "Довідки до палітри компонентів"
|
||
|
||
#: lazarusidestrconsts.dlgpasext
|
||
msgid "Default Pascal extension"
|
||
msgstr "Стандартне розширення Pascal"
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywords
|
||
msgid "Highlight control statements as keywords"
|
||
msgstr "Підсвічувати оператори управління як ключові слова"
|
||
|
||
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
||
msgid "Extended Pascal Keyword Options"
|
||
msgstr "Розширені Параметри Ключових слів Паскаля"
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
||
msgid "Markup (on caret)"
|
||
msgstr "Підсвічувати (біля курсора)"
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
||
msgid "Matching Keywords"
|
||
msgstr "Відповідні ключові слова"
|
||
|
||
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
||
msgid "Outline"
|
||
msgstr "Контур"
|
||
|
||
#: lazarusidestrconsts.dlgpassoptslinker
|
||
msgid "Pass options to linker with \"-k\", delimiter is space"
|
||
msgstr "Передати параметри компонувальнику з \"-k\", розділяючи пробілами"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywords
|
||
msgid "Highlight \"String\" keyword(s)"
|
||
msgstr "Підсвічувати ключові слова \"String\""
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
||
msgid "Default"
|
||
msgstr "Типовий"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
||
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
||
msgid "Only \"String\""
|
||
msgstr "Лише \"String\""
|
||
|
||
#: lazarusidestrconsts.dlgpersistentblock
|
||
msgid "Persistent block"
|
||
msgstr "Постійний блок"
|
||
|
||
#: lazarusidestrconsts.dlgpersistentcursor
|
||
msgid "Persistent cursor"
|
||
msgstr "Постійний курсор"
|
||
|
||
#: lazarusidestrconsts.dlgpoapplication
|
||
msgid "Application"
|
||
msgstr "Застосунок"
|
||
|
||
#: lazarusidestrconsts.dlgpoasinvoker
|
||
msgid "as invoker (asInvoker)"
|
||
msgstr "як викликач (asInvoker)"
|
||
|
||
#: lazarusidestrconsts.dlgpoclearicon
|
||
msgid "&Clear Icon"
|
||
msgstr "&Очистити Значок"
|
||
|
||
#: lazarusidestrconsts.dlgpocreateappbundle
|
||
msgid "Create Application Bundle"
|
||
msgstr "Створити пакет застосунків"
|
||
|
||
#: lazarusidestrconsts.dlgpodefaulticon
|
||
msgid "Load &Default"
|
||
msgstr "Завантажити &типові"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawareness
|
||
msgid "DPI awareness"
|
||
msgstr "Підтримка ТНД"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
||
msgid "off"
|
||
msgstr "вимкнути"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
||
msgid "Vista-8: off, 8.1+: per monitor"
|
||
msgstr "Vista-8: вимкн., 8.1+: на монітор"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
||
msgid "Vista-8: on, 8.1+: per monitor"
|
||
msgstr "Vista-8: увімкн., 8.1+: на монітор"
|
||
|
||
#: lazarusidestrconsts.dlgpodpiawarenesson
|
||
msgid "on"
|
||
msgstr "увімкнути"
|
||
|
||
#: lazarusidestrconsts.dlgpoexecutionlevel
|
||
msgid "Execution Level"
|
||
msgstr "Рівень виконання"
|
||
|
||
#: lazarusidestrconsts.dlgpofroms
|
||
msgid "Forms"
|
||
msgstr "Форми"
|
||
|
||
#: lazarusidestrconsts.dlgpohighestavailable
|
||
msgid "highest available (highestAvailable)"
|
||
msgstr "найвищий доступний (highestAvailable)"
|
||
|
||
#: lazarusidestrconsts.dlgpoi18n
|
||
msgid "i18n"
|
||
msgstr "i18n"
|
||
|
||
#: lazarusidestrconsts.dlgpoicon
|
||
msgid "Icon:"
|
||
msgstr "Значок:"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondesc
|
||
msgid "(size: %d:%d, bpp: %d)"
|
||
msgstr "(розмір: %d:%d, bpp: %d)"
|
||
|
||
#: lazarusidestrconsts.dlgpoicondescnone
|
||
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
||
msgid "(none)"
|
||
msgstr "(немає)"
|
||
|
||
#: lazarusidestrconsts.dlgpoloadicon
|
||
msgid "&Load Icon"
|
||
msgstr "&Завантажити значок"
|
||
|
||
#: lazarusidestrconsts.dlgpomisc
|
||
msgctxt "lazarusidestrconsts.dlgpomisc"
|
||
msgid "Miscellaneous"
|
||
msgstr "Різне"
|
||
|
||
#: lazarusidestrconsts.dlgporequireadministrator
|
||
msgid "require administrator (requireAdministrator)"
|
||
msgstr "потрібен адміністратор (requireAdministrator)"
|
||
|
||
#: lazarusidestrconsts.dlgporesources
|
||
msgid "Resources"
|
||
msgstr "Ресурси"
|
||
|
||
#: lazarusidestrconsts.dlgposaveicon
|
||
msgid "&Save Icon"
|
||
msgstr "&Зберегти значок"
|
||
|
||
#: lazarusidestrconsts.dlgposavesession
|
||
msgid "Session"
|
||
msgstr "Сесія"
|
||
|
||
#: lazarusidestrconsts.dlgpotitle
|
||
msgid "Title:"
|
||
msgstr "Заголовок:"
|
||
|
||
#: lazarusidestrconsts.dlgpouiaccess
|
||
msgid "UI Access (uiAccess)"
|
||
msgstr "Доступ UI (uiAccess)"
|
||
|
||
#: lazarusidestrconsts.dlgpouseappbundle
|
||
msgid "Use Application Bundle for running and debugging"
|
||
msgstr "Використовувати пакет застосунків для запуску і зневадження"
|
||
|
||
#: lazarusidestrconsts.dlgpouselclscaling
|
||
msgid "Use LCL scaling (Hi-DPI)"
|
||
msgstr "Використати масштабування LCL (Hi-DPI)"
|
||
|
||
#: lazarusidestrconsts.dlgpousemanifest
|
||
msgid "Use manifest resource (and enable themes)"
|
||
msgstr "Використати manifest-ресурс (і увімкнути теми)"
|
||
|
||
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
||
msgid "Prefer double-click over single-click"
|
||
msgstr "Перевага подвійного клацання над одинарним"
|
||
|
||
#: lazarusidestrconsts.dlgpriorities
|
||
msgid "Priorities"
|
||
msgstr "Пріоритети"
|
||
|
||
#: lazarusidestrconsts.dlgproject
|
||
msgctxt "lazarusidestrconsts.dlgproject"
|
||
msgid "Project"
|
||
msgstr "Проект"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptions
|
||
msgid "Project Options"
|
||
msgstr "Параметри проекту"
|
||
|
||
#: lazarusidestrconsts.dlgprojectoptionsfor
|
||
msgid "Options for Project: %s"
|
||
msgstr "Параметри для Проекту: %s"
|
||
|
||
#: lazarusidestrconsts.dlgprojfiles
|
||
msgid "Project Files"
|
||
msgstr "Файли проекту"
|
||
|
||
#: lazarusidestrconsts.dlgpromptonreplace
|
||
msgid "&Prompt on replace"
|
||
msgstr "Пи&тати при заміні"
|
||
|
||
#: lazarusidestrconsts.dlgpropertycompletion
|
||
msgid "Property completion"
|
||
msgstr "Розширення властивості"
|
||
|
||
#: lazarusidestrconsts.dlgpropnamecolor
|
||
msgid "Property Name"
|
||
msgstr "Назва властивості"
|
||
|
||
#: lazarusidestrconsts.dlgqopenlastprj
|
||
msgid "Open last project and packages at start"
|
||
msgstr "При старті відкрити останній проект і пакунки"
|
||
|
||
#: lazarusidestrconsts.dlgqshowborderspacing
|
||
msgid "Show border spacing"
|
||
msgstr "Показувати ширину бордюру"
|
||
|
||
#: lazarusidestrconsts.dlgqshowgrid
|
||
msgid "Show grid"
|
||
msgstr "Показувати сітку"
|
||
|
||
#: lazarusidestrconsts.dlgqsnaptogrid
|
||
msgid "Snap to grid"
|
||
msgstr "Прилипання до сітки"
|
||
|
||
#: lazarusidestrconsts.dlgreallydeletedesktop
|
||
msgid "Really delete desktop \"%s\"?"
|
||
msgstr "Справді видалити стільницю \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.dlgreferencecolor
|
||
msgid "Reference"
|
||
msgstr "Посилання"
|
||
|
||
#: lazarusidestrconsts.dlgregularexpressions
|
||
msgid "Regular e&xpressions"
|
||
msgstr "&Регулярні вирази"
|
||
|
||
#: lazarusidestrconsts.dlgrenamedesktop
|
||
msgid "Rename desktop"
|
||
msgstr "Перейменувати стільницю"
|
||
|
||
#: lazarusidestrconsts.dlgreplaceall
|
||
msgid "Replace &All"
|
||
msgstr "Замінити &всі"
|
||
|
||
#: lazarusidestrconsts.dlgreplacewith
|
||
msgid "&Replace with"
|
||
msgstr "&Замінити на"
|
||
|
||
#: lazarusidestrconsts.dlgreport
|
||
msgid "Report"
|
||
msgstr "Звіт"
|
||
|
||
#: lazarusidestrconsts.dlgrightbottomclr
|
||
msgid "Guide lines Right,Bottom"
|
||
msgstr "Напрямні лінії права,нижня"
|
||
|
||
#: lazarusidestrconsts.dlgrightclickselects
|
||
msgid "Right click selects"
|
||
msgstr "Вибір правим клацанням"
|
||
|
||
#: lazarusidestrconsts.dlgrightmargin
|
||
msgid "Right margin"
|
||
msgstr "Праве поле"
|
||
|
||
#: lazarusidestrconsts.dlgroworkingdirectory
|
||
msgid "Working directory"
|
||
msgstr "Робоча тека"
|
||
|
||
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
||
msgid "Select grandchildren"
|
||
msgstr "Вибрати онука"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
||
msgid "Rubberband Creation"
|
||
msgstr "Створення гумки"
|
||
|
||
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
||
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
|
||
msgid "Rubberband Selection"
|
||
msgstr "Вибір гумки"
|
||
|
||
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
||
msgid ""
|
||
"The running Lazarus instance cannot accept any files.\n"
|
||
"Do you want to open them in a new IDE instance?\n"
|
||
"\n"
|
||
"%s\n"
|
||
msgstr ""
|
||
"Запущений примірник Lazarus немає доступу до файлів.\n"
|
||
"Відкрити їх у новому примірнику ІСР?\n"
|
||
"\n"
|
||
"%s\n"
|
||
|
||
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
||
msgid "Lazarus instance is running but not responding."
|
||
msgstr "Примірник Lazarus працює, але не відповідає."
|
||
|
||
#: lazarusidestrconsts.dlgrunodisplay
|
||
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"
|
||
|
||
#: lazarusidestrconsts.dlgrunoenvironment
|
||
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
||
msgid "Environment"
|
||
msgstr "Середовище"
|
||
|
||
#: lazarusidestrconsts.dlgrunolocal
|
||
msgid "Local"
|
||
msgstr "Локальні"
|
||
|
||
#: lazarusidestrconsts.dlgrunosystemvariables
|
||
msgid "System variables"
|
||
msgstr "Системні змінні"
|
||
|
||
#: lazarusidestrconsts.dlgrunousedisplay
|
||
msgid "Use display"
|
||
msgstr "Використовувати дисплей"
|
||
|
||
#: lazarusidestrconsts.dlgrunouseroverrides
|
||
msgid "User overrides"
|
||
msgstr "Користувацькі перекриття"
|
||
|
||
#: lazarusidestrconsts.dlgrunparameters
|
||
msgid "Run Parameters"
|
||
msgstr "Параметри виконання"
|
||
|
||
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
||
msgid "Save current desktop as"
|
||
msgstr "Зберегти поточну стільницю як"
|
||
|
||
#: lazarusidestrconsts.dlgsavedlinecolor
|
||
msgid "Saved line"
|
||
msgstr "Збережений рядок"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfo
|
||
msgid "Save editor info for closed files"
|
||
msgstr "Зберігати відомості про закриті файли"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
||
msgid "The files are available in the \"Open Recent\" history list."
|
||
msgstr "Файли доступні у списку історії \"Відкрити недавні\"."
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
||
msgid "Save editor info only for project files"
|
||
msgstr "Зберігати відомості тільки про файли проекту"
|
||
|
||
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
||
msgid "Only files that belong to this project."
|
||
msgstr "Лише файли, що належать до цього проекту."
|
||
|
||
#: lazarusidestrconsts.dlgscrollbyoneless
|
||
msgid "Scroll by one less"
|
||
msgstr "Прокрутити на один вниз"
|
||
|
||
#: lazarusidestrconsts.dlgscrollgroupoptions
|
||
msgid "Scrolling"
|
||
msgstr "Прокрутка"
|
||
|
||
#: lazarusidestrconsts.dlgscrollhint
|
||
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
||
msgid "Show scroll hint"
|
||
msgstr "Показувати пораду з прокрут."
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendfile
|
||
msgid "Scroll past end of file"
|
||
msgstr "Прокрутити до кінця файлу"
|
||
|
||
#: lazarusidestrconsts.dlgscrollpastendline
|
||
msgid "Caret past end of line"
|
||
msgstr "Каретку в кінець рядка"
|
||
|
||
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
||
msgid "Search directory \"%s\" not found."
|
||
msgstr "Тека пошуку \"%s\" не знайдена."
|
||
|
||
#: lazarusidestrconsts.dlgsearchabort
|
||
msgid "Search terminated by user."
|
||
msgstr "Пошук перервано користувачем."
|
||
|
||
#: lazarusidestrconsts.dlgsearchcaption
|
||
msgid "Searching ..."
|
||
msgstr "Пошук ..."
|
||
|
||
#: lazarusidestrconsts.dlgsearchpaths
|
||
msgid "Paths"
|
||
msgstr "Шляхи"
|
||
|
||
#: lazarusidestrconsts.dlgsearchscope
|
||
msgid "Search scope"
|
||
msgstr "Область пошуку"
|
||
|
||
#: lazarusidestrconsts.dlgselectallchildcontrols
|
||
msgid "Select all child controls together with their parent."
|
||
msgstr "Вибирати дочірні елементи керування разом з предком"
|
||
|
||
#: lazarusidestrconsts.dlgselectedtext
|
||
msgid "&Selected text"
|
||
msgstr "&Виділений текст"
|
||
|
||
#: lazarusidestrconsts.dlgsetactivedesktop
|
||
msgid "Set active"
|
||
msgstr "Зробити активним"
|
||
|
||
#: lazarusidestrconsts.dlgsetallelementdefault
|
||
msgid "Set all elements to default"
|
||
msgstr "Встановити всі елементи за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgsetelementdefault
|
||
msgid "Set element to default"
|
||
msgstr "Встановити елемент за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariable
|
||
msgid "Set property Variable"
|
||
msgstr "Встановити змінну властивості"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
||
msgid "The parameter name for the default setter procedure."
|
||
msgstr "Назва параметра для типової процедури встановлення значення властивості."
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
||
msgid "is prefix"
|
||
msgstr "є префіксом"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
||
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
||
msgstr "Якщо позначено, \"Set property Variable\" є префіксом. Інакше - це фіксована назва."
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
||
msgid "use const"
|
||
msgstr "використати const"
|
||
|
||
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
||
msgid "If checked, the setter parameter is marked with \"const\"."
|
||
msgstr "Якщо позначено, параметри процедури встановлення значення властивості позначаються \"const\"."
|
||
|
||
#: lazarusidestrconsts.dlgshowallunits
|
||
msgid "Show all units"
|
||
msgstr "Показати всі модулі"
|
||
|
||
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
||
msgid "Show captions of non-visual components"
|
||
msgstr "Показувати підписи не візуальних компонентів"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
||
msgid "Show compiled procedures"
|
||
msgstr "Показувати скомпільовані процедури"
|
||
|
||
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Показувати номери рядків"
|
||
|
||
#: lazarusidestrconsts.dlgshowconditionals
|
||
msgid "Show conditionals"
|
||
msgstr "Показувати умови"
|
||
|
||
#: lazarusidestrconsts.dlgshowdebuginfo
|
||
msgid "Show debug info"
|
||
msgstr "Показувати зневаджувальну інф-ю"
|
||
|
||
#: lazarusidestrconsts.dlgshowdesignerhints
|
||
msgid "Show designer hints"
|
||
msgstr "Показувати підказки дизайнера"
|
||
|
||
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
||
msgid "Hint shows control's position or size while moving or resizing it."
|
||
msgstr "Підказка, при переміщенні чи зміненні розмірів елемента керування, показує його позицію або розміри."
|
||
|
||
#: lazarusidestrconsts.dlgshoweverything
|
||
msgid "Show everything"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.dlgshowexecutableinfo
|
||
msgid "Show executable info (Win32 only)"
|
||
msgstr "Показ. викон. інф. (для Win32)"
|
||
|
||
#: lazarusidestrconsts.dlgshowfilenameincaption
|
||
msgid "Show file name in caption"
|
||
msgstr "Показувати назву файлу у заголовку"
|
||
|
||
#: lazarusidestrconsts.dlgshowgeneralinfo
|
||
msgid "Show general info"
|
||
msgstr "Показувати загальні відомості"
|
||
|
||
#: lazarusidestrconsts.dlgshowgutterhints
|
||
msgid "Show gutter hints"
|
||
msgstr "Показувати підказки для смужки"
|
||
|
||
#: lazarusidestrconsts.dlgshowhint
|
||
msgctxt "lazarusidestrconsts.dlgshowhint"
|
||
msgid "Show hints"
|
||
msgstr "Показувати підказки"
|
||
|
||
#: lazarusidestrconsts.dlgshowingwindows
|
||
msgid "Showing Windows"
|
||
msgstr "Показ вікон"
|
||
|
||
#: lazarusidestrconsts.dlgshowlinenumbers
|
||
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
||
msgid "Show line numbers"
|
||
msgstr "Показувати номери рядків"
|
||
|
||
#: lazarusidestrconsts.dlgshowmessagesicons
|
||
msgid "Show Messages Icons"
|
||
msgstr "Показувати значки повідомлень"
|
||
|
||
#: lazarusidestrconsts.dlgshownotes
|
||
msgid "Show notes"
|
||
msgstr "Показувати зауваження"
|
||
|
||
#: lazarusidestrconsts.dlgshowsummary
|
||
msgid "Show summary"
|
||
msgstr "Показувати підсумкове"
|
||
|
||
#: lazarusidestrconsts.dlgshowtriedfiles
|
||
msgid "Show tried files"
|
||
msgstr "Показувати випробувальні файли"
|
||
|
||
#: lazarusidestrconsts.dlgshowusedfiles
|
||
msgid "Show used files"
|
||
msgstr "Показувати використані файли"
|
||
|
||
#: lazarusidestrconsts.dlgshowwarnings
|
||
msgid "Show warnings"
|
||
msgstr "Показувати попередження"
|
||
|
||
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
||
msgid "Show single button in TaskBar"
|
||
msgstr "Показувати одну кнопку на панелі завдань"
|
||
|
||
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
||
msgid "Skip forward class declarations"
|
||
msgstr "Пропускати попередні оголошення класів"
|
||
|
||
#: lazarusidestrconsts.dlgslashcommenttab
|
||
msgid "Slash //"
|
||
msgstr "Коса риска //"
|
||
|
||
#: lazarusidestrconsts.dlgsmarttabs
|
||
msgid "Smart tabs"
|
||
msgstr "Розумна табуляція"
|
||
|
||
#: lazarusidestrconsts.dlgsmbbehind
|
||
msgid "Symbol behind (.pp~)"
|
||
msgstr "Символ позаду (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbcounter
|
||
msgid "Counter (.pp;1)"
|
||
msgstr "Лічильник (.pp;1)"
|
||
|
||
#: lazarusidestrconsts.dlgsmbfront
|
||
msgid "Symbol in front (.~pp)"
|
||
msgstr "Символ попереду (.~pp)"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelines
|
||
msgid "Snap to Guide Lines"
|
||
msgstr "Защіпнутись за лінійками"
|
||
|
||
#: lazarusidestrconsts.dlgsnapguidelineshint
|
||
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
||
msgstr "Коли елемент керування майже порівнявся з іншим, він прилипає до позиції вирівнювання."
|
||
|
||
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
||
msgid "Multiline tabs"
|
||
msgstr "Багаторядковий список вкладок"
|
||
|
||
#: lazarusidestrconsts.dlgspacenotcosmos
|
||
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
||
msgid "Space"
|
||
msgstr "Пробіл"
|
||
|
||
#: lazarusidestrconsts.dlgspbhints
|
||
msgid "Hints for main speed buttons (open, save, ...)"
|
||
msgstr "Довідки до командних кнопок (відкрити, зберегти тощо)"
|
||
|
||
#: lazarusidestrconsts.dlgsrcedit
|
||
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор коду"
|
||
|
||
#: lazarusidestrconsts.dlgsrorigin
|
||
msgid "Origin"
|
||
msgstr "Походження"
|
||
|
||
#: lazarusidestrconsts.dlgstacksize
|
||
msgid "Stack size"
|
||
msgstr "Розмір стеку"
|
||
|
||
#: lazarusidestrconsts.dlgstatickeyword
|
||
msgid "Static keyword in objects"
|
||
msgstr "Ключове слово Static в об'єктах"
|
||
|
||
#: lazarusidestrconsts.dlgstopafternrerr
|
||
msgid "Stop after number of errors:"
|
||
msgstr "Завершити після купи помилок"
|
||
|
||
#: lazarusidestrconsts.dlgstringautoappend
|
||
msgid "Append text to close string"
|
||
msgstr "Додати текст для закриття рядка"
|
||
|
||
#: lazarusidestrconsts.dlgstringautoprefix
|
||
msgid "Prefix string on new line"
|
||
msgstr "Префікс нового рядка"
|
||
|
||
#: lazarusidestrconsts.dlgstringbreakindenttab
|
||
msgid "String ''"
|
||
msgstr "Рядок ''"
|
||
|
||
#: lazarusidestrconsts.dlgstringenableautocontinue
|
||
msgid "Extend strings on linebreak"
|
||
msgstr "Додавати новий рядок при розриві поточного"
|
||
|
||
#: lazarusidestrconsts.dlgsubpropcolor
|
||
msgid "SubProperties"
|
||
msgstr "Вкладені Властивості"
|
||
|
||
#: lazarusidestrconsts.dlgsyntaxoptions
|
||
msgid "Syntax options"
|
||
msgstr "Параметри синтаксису"
|
||
|
||
#: lazarusidestrconsts.dlgtabindent
|
||
msgid "Tab indents blocks"
|
||
msgstr "ТАБ зсуває блоки вправо"
|
||
|
||
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
||
msgid "Show tab numbers in notebook"
|
||
msgstr "Показувати номери вкладок у блокноті"
|
||
|
||
#: lazarusidestrconsts.dlgtabstospaces
|
||
msgid "Tabs to spaces"
|
||
msgstr "ТАБ у пробіли"
|
||
|
||
#: lazarusidestrconsts.dlgtabwidths
|
||
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
||
msgid "Tab widths"
|
||
msgstr "Ширина ТАБа"
|
||
|
||
#: lazarusidestrconsts.dlgtargetcpufamily
|
||
msgid "Target CPU family"
|
||
msgstr "Сімейство цільового ЦП"
|
||
|
||
#: lazarusidestrconsts.dlgtargetos
|
||
msgctxt "lazarusidestrconsts.dlgtargetos"
|
||
msgid "Target OS"
|
||
msgstr "Цільова ОС"
|
||
|
||
#: lazarusidestrconsts.dlgtargetplatform
|
||
msgid "Target platform"
|
||
msgstr "Платформа"
|
||
|
||
#: lazarusidestrconsts.dlgtargetproc
|
||
msgid "Target processor"
|
||
msgstr "Цільовий процесор"
|
||
|
||
#: lazarusidestrconsts.dlgtargetspecificoptions
|
||
msgid "Target-specific options"
|
||
msgstr "Параметри для цілі"
|
||
|
||
#: lazarusidestrconsts.dlgtestprjdir
|
||
msgid "Directory for building test projects"
|
||
msgstr "Тека для збирання пробних проектів"
|
||
|
||
#: lazarusidestrconsts.dlgtexttofind
|
||
msgctxt "lazarusidestrconsts.dlgtexttofind"
|
||
msgid "&Text to find"
|
||
msgstr "&Текст для пошуку"
|
||
|
||
#: lazarusidestrconsts.dlgtoggledebugdesktop
|
||
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
|
||
msgid "Toggle as debug desktop"
|
||
msgstr "Перемкнути як стільницю зневадження"
|
||
|
||
#: lazarusidestrconsts.dlgtopinfohint
|
||
msgid "Current Class/Proc Hint"
|
||
msgstr "Підказка поточного класу/процесу"
|
||
|
||
#: lazarusidestrconsts.dlgtoppos
|
||
msgid "Top:"
|
||
msgstr "Верх:"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
||
msgid "Trim spaces style"
|
||
msgstr "Стиль обрізання пробілів"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
||
msgid "Caret or Edit"
|
||
msgstr "Курсор або редагування"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
||
msgid "Line Edited"
|
||
msgstr "Змінений рядок"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
||
msgid "Leave line"
|
||
msgstr "Залишити рядок"
|
||
|
||
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
||
msgid "Position Only"
|
||
msgstr "Лише позиція"
|
||
|
||
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
||
msgid "Trim trailing spaces"
|
||
msgstr "Обрізати кінцеві пробіли"
|
||
|
||
#: lazarusidestrconsts.dlgundoaftersave
|
||
msgid "Undo after save"
|
||
msgstr "Скасування після збереження"
|
||
|
||
#: lazarusidestrconsts.dlgundogroupoptions
|
||
msgid "Undo / Redo"
|
||
msgstr "Скасувати / Повернути"
|
||
|
||
#: lazarusidestrconsts.dlgundolimit
|
||
msgid "Undo limit"
|
||
msgstr "Межа скасувань:"
|
||
|
||
#: lazarusidestrconsts.dlgunitdepcaption
|
||
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Залежності модуля"
|
||
|
||
#: lazarusidestrconsts.dlgunitdeprefresh
|
||
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
||
msgid "Refresh"
|
||
msgstr "Оновити"
|
||
|
||
#: lazarusidestrconsts.dlgunitoutp
|
||
msgid "Unit output directory (-FU):"
|
||
msgstr "Вихідна тека модулів (-FU):"
|
||
|
||
#: lazarusidestrconsts.dlgunsavedlinecolor
|
||
msgid "Unsaved line"
|
||
msgstr "Незбережений рядок"
|
||
|
||
#: lazarusidestrconsts.dlgusecodefolding
|
||
msgid "Code Folding"
|
||
msgstr "Згортання коду"
|
||
|
||
#: lazarusidestrconsts.dlgusecustomconfig
|
||
msgid "Use additional compiler config file"
|
||
msgstr "Використовувати додатковий файл налаштувань компілятора"
|
||
|
||
#: lazarusidestrconsts.dlgusedividerdraw
|
||
msgid "Divider Drawing"
|
||
msgstr "Показ роздільника"
|
||
|
||
#: lazarusidestrconsts.dlgusefpccfg
|
||
msgid "Use standard compiler config file (fpc.cfg)"
|
||
msgstr "Використовувати стандартний файл налаштувань (fpc.cfg)"
|
||
|
||
#: lazarusidestrconsts.dlguselaunchingapp
|
||
msgid "Use launching application"
|
||
msgstr "Використовувати застосунок для запуску"
|
||
|
||
#: lazarusidestrconsts.dlguseminimumime
|
||
msgid "IME handled by System"
|
||
msgstr "Системний редактор методу введення"
|
||
|
||
#: lazarusidestrconsts.dlguserschemeerror
|
||
msgid "Failed to load user-scheme file %s"
|
||
msgstr "Не вдалося завантажити файл користувацької схеми %s"
|
||
|
||
#: lazarusidestrconsts.dlguseschemedefaults
|
||
msgid "Use (and edit) global scheme settings"
|
||
msgstr "Використовувати (і змінювати) параметри глобальної схеми"
|
||
|
||
#: lazarusidestrconsts.dlguseschemelocal
|
||
msgid "Use local scheme settings"
|
||
msgstr "Використовувати параметри локальної схеми"
|
||
|
||
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
||
msgid "Use syntax highlight"
|
||
msgstr "Підсвітка синтаксису"
|
||
|
||
#: lazarusidestrconsts.dlgusetabshistory
|
||
msgid "Use tab history when closing tabs"
|
||
msgstr "Врахов. історію вкладок при їх закритті"
|
||
|
||
#: lazarusidestrconsts.dlguseunitcaption
|
||
msgid "Add unit to Uses section"
|
||
msgstr "Додати модуль в секцію Uses"
|
||
|
||
#: lazarusidestrconsts.dlgvaluecolor
|
||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||
msgid "Value"
|
||
msgstr "Значення"
|
||
|
||
#: lazarusidestrconsts.dlgverbosity
|
||
msgid "Verbosity during compilation:"
|
||
msgstr "Подробиці при компіляції:"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblegutter
|
||
msgid "Visible gutter"
|
||
msgstr "Видима смужка"
|
||
|
||
#: lazarusidestrconsts.dlgvisiblerightmargin
|
||
msgid "Visible right margin"
|
||
msgstr "Права видима границя"
|
||
|
||
#: lazarusidestrconsts.dlgwholewordsonly
|
||
msgid "&Whole words only"
|
||
msgstr "&Лише цілі слова"
|
||
|
||
#: lazarusidestrconsts.dlgwidthpos
|
||
msgid "Width:"
|
||
msgstr "Ширина:"
|
||
|
||
#: lazarusidestrconsts.dlgwin32guiapp
|
||
msgid "Win32 gui application"
|
||
msgstr "Графічний застосунок Win32"
|
||
|
||
#: lazarusidestrconsts.dlgwindow
|
||
msgctxt "lazarusidestrconsts.dlgwindow"
|
||
msgid "Window"
|
||
msgstr "Вікно"
|
||
|
||
#: lazarusidestrconsts.dlgwinpos
|
||
msgid "Window positions"
|
||
msgstr "Позиції вікна"
|
||
|
||
#: lazarusidestrconsts.dlgwordexceptions
|
||
msgid "Exceptions"
|
||
msgstr "Винятки"
|
||
|
||
#: lazarusidestrconsts.dlgwordspolicies
|
||
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
||
msgid "Words"
|
||
msgstr "Слова"
|
||
|
||
#: lazarusidestrconsts.dlgwrdpreview
|
||
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.dlgwritefpclogo
|
||
msgid "Write FPC logo"
|
||
msgstr "Писати логотип FPC"
|
||
|
||
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
||
msgid "Multiselected components must be of a single form."
|
||
msgstr "Виділені компоненти мають належати одній формі"
|
||
|
||
#: lazarusidestrconsts.fdmalignmenu
|
||
msgid "Align ..."
|
||
msgstr "Вирівняти ..."
|
||
|
||
#: lazarusidestrconsts.fdmdeleteselection
|
||
msgid "Delete Selection"
|
||
msgstr "Стерти вибране"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorhorizontal
|
||
msgid "Mirror Horizontal"
|
||
msgstr "Віддзеркалити горизонтально"
|
||
|
||
#: lazarusidestrconsts.fdmmirrorvertical
|
||
msgid "Mirror Vertical"
|
||
msgstr "Віддзеркалити вертикально"
|
||
|
||
#: lazarusidestrconsts.fdmorderbackone
|
||
msgid "Back One"
|
||
msgstr "На один назад"
|
||
|
||
#: lazarusidestrconsts.fdmorderforwardone
|
||
msgid "Forward One"
|
||
msgstr "На один Вперед"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetoback
|
||
msgid "Move to Back"
|
||
msgstr "До попереднього"
|
||
|
||
#: lazarusidestrconsts.fdmordermovetofront
|
||
msgid "Move to Front"
|
||
msgstr "Перемістити наперед"
|
||
|
||
#: lazarusidestrconsts.fdmresetmenu
|
||
msgid "Reset ..."
|
||
msgstr "Скинути ..."
|
||
|
||
#: lazarusidestrconsts.fdmsaveformasxml
|
||
msgid "Save Form as XML"
|
||
msgstr "Зберегти форму як XML"
|
||
|
||
#: lazarusidestrconsts.fdmscalemenu
|
||
msgid "Scale ..."
|
||
msgstr "Масштабувати ..."
|
||
|
||
#: lazarusidestrconsts.fdmscaleword
|
||
msgid "Scale"
|
||
msgstr "Масштаб"
|
||
|
||
#: lazarusidestrconsts.fdmselectall
|
||
msgctxt "lazarusidestrconsts.fdmselectall"
|
||
msgid "Select All"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts.fdmsizemenu
|
||
msgid "Size ..."
|
||
msgstr "Розмір ..."
|
||
|
||
#: lazarusidestrconsts.fdmsizeword
|
||
msgid "Size"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptogridoption
|
||
msgid "Option: Snap to grid"
|
||
msgstr "Параметр: Прилипання до сітки"
|
||
|
||
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
||
msgid "Option: Snap to guide lines"
|
||
msgstr "Параметр: Прилипання до напрямних"
|
||
|
||
#: lazarusidestrconsts.fdmzorder
|
||
msgid "Z-order"
|
||
msgstr "Z-порядок"
|
||
|
||
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
||
msgid "On Both Sides"
|
||
msgstr "На обох сторонах"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnclearhint
|
||
msgid "Clear all snapshots"
|
||
msgstr "Очистити всі знімки"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnenablehint
|
||
msgid "Toggle view snapshot or current"
|
||
msgstr "Перемкнути перегляд між знімком та поточним"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
||
msgid "Take Snapshot"
|
||
msgstr "Зробити знімок"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnpowerhint
|
||
msgid "Switch on/off automatic snapshots"
|
||
msgstr "Ввімкнути/Вимкнути автоматичні знімки"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnremovehint
|
||
msgid "Remove selected entry"
|
||
msgstr "Видалити вибраний елемент"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
||
msgid "View history"
|
||
msgstr "Переглянути історію"
|
||
|
||
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
||
msgid "View Snapshots"
|
||
msgstr "Переглянути знімки"
|
||
|
||
#: lazarusidestrconsts.histdlgcolumnloc
|
||
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
|
||
msgid "Location"
|
||
msgstr "Розміщення"
|
||
|
||
#: lazarusidestrconsts.histdlgcolumntime
|
||
msgid "Time"
|
||
msgstr "Час"
|
||
|
||
#: lazarusidestrconsts.histdlgformname
|
||
msgctxt "lazarusidestrconsts.histdlgformname"
|
||
msgid "History"
|
||
msgstr "Історія"
|
||
|
||
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
||
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
||
msgstr "0 = немає, 1 = малювати лінії роздільника лише для верхнього рівня, 2 = малювати лінії для перших двох рівнів, ..."
|
||
|
||
#: lazarusidestrconsts.lisa2paddfiles
|
||
msgid "Add Files"
|
||
msgstr "Додати файли"
|
||
|
||
#: lazarusidestrconsts.lisa2paddfilestopackage
|
||
msgid "Add Files to Package"
|
||
msgstr "Додати файли до пакунка"
|
||
|
||
#: lazarusidestrconsts.lisa2paddtopackage
|
||
msgid "Add to package"
|
||
msgstr "Додати до пакунка"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
||
msgid "Ambiguous Ancestor Type"
|
||
msgstr "Двозначний тип предка"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousclassname
|
||
msgid "Ambiguous Class Name"
|
||
msgstr "Двозначна назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pambiguousunitname
|
||
msgid "Ambiguous Unit Name"
|
||
msgstr "Двозначна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lisa2pancestortype
|
||
msgid "Ancestor Type"
|
||
msgstr "Тип предка"
|
||
|
||
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
||
msgid "A Pascal unit must have the extension .pp or .pas"
|
||
msgstr "Модуль Pascal повинен мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2pbrokendependencies
|
||
msgid "Broken Dependencies"
|
||
msgstr "Порушення залежностей"
|
||
|
||
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
||
msgid "Class Name already exists"
|
||
msgstr "Назва класу вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
||
msgid "Create New Component"
|
||
msgstr "Створити новий компонент"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewfile
|
||
msgid "Create New File"
|
||
msgstr "Створити новий файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pcreatenewreq
|
||
msgid "Create New Requirement"
|
||
msgstr "Створити нову вимогу"
|
||
|
||
#: lazarusidestrconsts.lisa2pdependency
|
||
msgid "Dependency"
|
||
msgstr "Залежність"
|
||
|
||
#: lazarusidestrconsts.lisa2pexistingfile2
|
||
msgid "Existing file: \"%s\""
|
||
msgstr "Наявний файл: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
||
msgid "File already exists"
|
||
msgstr "Файл вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
||
msgid "File \"%s\" already exists in the package."
|
||
msgstr "Файл \"%s\" вже є у пакунку."
|
||
|
||
#: lazarusidestrconsts.lisa2pfileisused
|
||
msgid "File is used"
|
||
msgstr "Файл вже використовується"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilename2
|
||
msgid "Filename"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2pfilenotunit
|
||
msgid "File not unit"
|
||
msgstr "Файл не є модулем"
|
||
|
||
#: lazarusidestrconsts.lisa2piconandsize
|
||
msgid "Icon (maximum 24x24):"
|
||
msgstr "Значок (найбільше 24x24):"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
||
msgid "Invalid Ancestor Type"
|
||
msgstr "Неправильний тип предка"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
||
msgid "Invalid Circular Dependency"
|
||
msgstr "Неправильна кільцева залежність"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidclassname
|
||
msgid "Invalid Class Name"
|
||
msgstr "Неправильна назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfile
|
||
msgid "Invalid file"
|
||
msgstr "Неправильний файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidfilename
|
||
msgid "Invalid filename"
|
||
msgstr "Неправильна назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2pinvalidunitname
|
||
msgid "Invalid Unit Name"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
||
msgid "\"%s\" is not a valid unit name."
|
||
msgstr "\"%s\" не є правильною назвою модуля."
|
||
|
||
#: lazarusidestrconsts.lisa2pnewclassname
|
||
msgid "New class name:"
|
||
msgstr "Нова назва класу"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewcomponent
|
||
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
||
msgid "New Component"
|
||
msgstr "Новий компонент"
|
||
|
||
#: lazarusidestrconsts.lisa2pnewfile
|
||
msgid "New File"
|
||
msgstr "Новий файл"
|
||
|
||
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
||
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
||
msgstr "Не знайдено пакунка для залежності \"%s\".%sВиберіть наявний пакунок."
|
||
|
||
#: lazarusidestrconsts.lisa2ppackageorproject
|
||
msgid "Package/Project"
|
||
msgstr "Пакунок/проект"
|
||
|
||
#: lazarusidestrconsts.lisa2ppagenametoolong
|
||
msgid "Page Name too long"
|
||
msgstr "Задовга назва сторінки"
|
||
|
||
#: lazarusidestrconsts.lisa2ppalettepage
|
||
msgid "Palette Page:"
|
||
msgstr "Сторінка палітри:"
|
||
|
||
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
||
msgid "Pascal units must have the extension .pp or .pas"
|
||
msgstr "Модулі паскаля повинні мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts.lisa2psavefiledialog
|
||
msgid "Save file dialog"
|
||
msgstr "Зберегти файл діалогу"
|
||
|
||
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
||
msgid "Shorten or expand filename"
|
||
msgstr "Скоротити або розширити назву файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2pshowall
|
||
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.lisa2pswitchpaths
|
||
msgid "Switch Paths"
|
||
msgstr "Перемкнути шляхи"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
||
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
||
msgstr "Назва типу предка \"%s\" збігається з%sназвою модуля \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
||
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
||
msgstr "Тип предка \"%s\" є неправильним ідентифікатором Pascal"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
||
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
||
msgstr "Назва класу \"%s\" і його предка \"%s\" збігаються."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
||
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
||
msgstr "Назва класу \"%s\" вже є у%sПакунок %s%sФайл: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
||
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
||
msgstr "Назва класу \"%s\" збігається з %s назвою модуля \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
||
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
||
msgstr "Назва класу \"%s\" не є припустимим ідентифікатором Pascal"
|
||
|
||
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
||
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
||
msgstr "Файл \"%s\" є частиною поточного проекту.%sНе краща ідея ділити файли між проектами і пакунками."
|
||
|
||
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
||
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
||
msgstr "Файл \"%s\" виглядає невизначеним, тому що пакунок не має теки за замовчуванням.%sВкажіть будь ласка назву файлу з повним шляхом."
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr "Максимальна версія \"%s\" некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "Максимальна Версія є меншою за Мінімальну Версію."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
||
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
||
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr "Мінімальна версія \"%s\" некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
||
msgid "The package already has a dependency on the package \"%s\"."
|
||
msgstr "Пакунок вже має залежність від пакунка \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
||
msgid "The page name \"%s\" is too long (max 100 chars)."
|
||
msgstr "Назва пакунка \"%s\" занадто довга (до 100 симв.)."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
||
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
||
msgstr "Така назва модуля \"%s\" вже є у цьому пакунку:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
||
msgid "The unitname \"%s\" already exists in this package."
|
||
msgstr "Така назва модуля \"%s\" вже є у цьому пакунку."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
||
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
||
msgstr "Назва модуля \"%s\"%sі назва файлу \"%s\" різні."
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
||
msgid "The unit name \"%s\" does not correspond to the filename."
|
||
msgstr "Назва модуля \"%s\" не відповідає назві файлу"
|
||
|
||
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
||
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
||
msgstr "Назва модуля \"%s\" збігається із зареєстрованим компонентом.%sЦе може призвести до непередбачуваних повідомлень про помилки."
|
||
|
||
#: lazarusidestrconsts.lisa2punitfilename2
|
||
msgid "Unit File Name:"
|
||
msgstr "Назва файлу модуля:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitname
|
||
msgid "Unit Name:"
|
||
msgstr "Назва модуля:"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
||
msgid "Unitname already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts.lisa2punitnameinvalid
|
||
msgid "Unit Name Invalid"
|
||
msgstr "Назва модуля є неприпустимою"
|
||
|
||
#: lazarusidestrconsts.lisabandonchanges
|
||
msgid "Abandon changes?"
|
||
msgstr "Скасувати зміни?"
|
||
|
||
#: lazarusidestrconsts.lisabort
|
||
msgctxt "lazarusidestrconsts.lisabort"
|
||
msgid "Abort"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts.lisabortall
|
||
msgid "Abort all"
|
||
msgstr "Перервати все"
|
||
|
||
#: lazarusidestrconsts.lisabortallloading
|
||
msgid "Abort all loading"
|
||
msgstr "Перервати всі завантаження"
|
||
|
||
#: lazarusidestrconsts.lisaborted
|
||
msgid "Aborted"
|
||
msgstr "Перервано"
|
||
|
||
#: lazarusidestrconsts.lisabortloadingproject
|
||
msgid "Abort loading project"
|
||
msgstr "Перервати завантаження проекту"
|
||
|
||
#: lazarusidestrconsts.lisabortwholeloading
|
||
msgid "Abort whole loading"
|
||
msgstr "Повністю перервати завантаження"
|
||
|
||
#: lazarusidestrconsts.lisabout
|
||
msgctxt "lazarusidestrconsts.lisabout"
|
||
msgid "About"
|
||
msgstr "Про"
|
||
|
||
#: lazarusidestrconsts.lisabout2
|
||
msgid "About %s"
|
||
msgstr "Про %s"
|
||
|
||
#: lazarusidestrconsts.lisaboutdocumentation
|
||
msgid "Documentation:"
|
||
msgstr "Документація:"
|
||
|
||
#: lazarusidestrconsts.lisaboutide
|
||
msgid "About IDE"
|
||
msgstr "Про ІСР"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarus
|
||
msgid "About Lazarus"
|
||
msgstr "Про проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisaboutlazarusmsg
|
||
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
||
msgstr "Ліцензія: GPL/LGPL. Див. початкові коди Lazarus та Free Pascal для деталей ліцензії.%sLazarus це ІСР для створення графічних та консольних застосунків, написаних на Free Pascal. Free Pascal це компілятор Pascal та Object Pascal, що працює на Windows, Linux, Mac OS X, FreeBSD та інших.%sLazarus є втраченим шматком пазлу, що дозволить розробляти програми для всіх перелічених платформ в Delphi-подібному оточенні. ІСР - це RAD-інструмент що включає в себе дизайнер форм.%sОскільки Lazarus росте, нам потрібно більше розробників."
|
||
|
||
#: lazarusidestrconsts.lisaboutnocontributors
|
||
msgid "Cannot find contributors list."
|
||
msgstr "Неможливо знайти список авторів"
|
||
|
||
#: lazarusidestrconsts.lisaboutofficial
|
||
msgid "Official:"
|
||
msgstr "Офіційний сайт:"
|
||
|
||
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
||
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
||
msgstr "%s не може вміщувати компоненти TControl.%sУ ньому можна розміщувати тільки не візуальні компоненти."
|
||
|
||
#: lazarusidestrconsts.lisacknowledgements
|
||
msgid "Acknowledgements"
|
||
msgstr "Подяки"
|
||
|
||
#: lazarusidestrconsts.lisaction
|
||
msgid "Action:"
|
||
msgstr "Дія:"
|
||
|
||
#: lazarusidestrconsts.lisactions
|
||
msgid "Actions:"
|
||
msgstr "Дії:"
|
||
|
||
#: lazarusidestrconsts.lisactivate
|
||
msgid "Activate"
|
||
msgstr "Активувати"
|
||
|
||
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
||
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
||
msgstr "Активувати синтаксис регулярних виразів для тексту і заміни (майже як в perl)"
|
||
|
||
#: lazarusidestrconsts.lisactivateselected
|
||
msgid "Activate Selected"
|
||
msgstr "Активувати вибране"
|
||
|
||
#: lazarusidestrconsts.lisactive
|
||
msgid "Active"
|
||
msgstr "Активний"
|
||
|
||
#: lazarusidestrconsts.lisactivefilter
|
||
msgid "Active Filter"
|
||
msgstr "Активний фільтр"
|
||
|
||
#: lazarusidestrconsts.lisadd
|
||
msgctxt "lazarusidestrconsts.lisadd"
|
||
msgid "Add"
|
||
msgstr "Додати"
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefine
|
||
msgid "Add defines simulating Delphi7"
|
||
msgstr "Додати визначення, що імітують Delphi7"
|
||
|
||
#: lazarusidestrconsts.lisadddelphidefinehint
|
||
msgid "Useful when the code has checks for supported compiler versions"
|
||
msgstr "Корисно, якщо код містить перевірки підтримуваних версій компілятора"
|
||
|
||
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
||
msgid "Added missing object \"%s\" to pascal source."
|
||
msgstr "До pascal-тексту додано відсутній об'єкт \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisaddedpropertysfors
|
||
msgid "Added property \"%s\" for %s."
|
||
msgstr "Додано властивість \"%s\" для %s."
|
||
|
||
#: lazarusidestrconsts.lisaddfcutf8
|
||
msgid "Add -FcUTF8"
|
||
msgstr "Додати -FcUTF8"
|
||
|
||
#: lazarusidestrconsts.lisaddfcutf8hint
|
||
msgid "May be needed if source files have non-ansistring literals."
|
||
msgstr "Може знадобитись, якщо сирцеві файли містять не-ansistring літерали."
|
||
|
||
#: lazarusidestrconsts.lisaddfilesindirectory
|
||
msgid "Add Files in Directory"
|
||
msgstr "Додати файли у теку"
|
||
|
||
#: lazarusidestrconsts.lisaddfilter
|
||
msgid "Add Filter ..."
|
||
msgstr "Додати фільтр ..."
|
||
|
||
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
||
msgid "Addition does not fit the current message"
|
||
msgstr "Додаток не відповідає поточному повідомленню"
|
||
|
||
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
||
msgid "Addition fits the current message"
|
||
msgstr "Додаток відповідає поточному повідомленню"
|
||
|
||
#: lazarusidestrconsts.lisadditions
|
||
msgid "Additions"
|
||
msgstr "Додатки"
|
||
|
||
#: lazarusidestrconsts.lisaddkeyworddo
|
||
msgid "Add keyword \"do\""
|
||
msgstr "Додати ключове слово \"do\""
|
||
|
||
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
||
msgid "Add new build mode, copying settings from \"%s\""
|
||
msgstr "Додати новий режим збирання, скопіювавши налаштування з \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisaddnewmacro
|
||
msgid "Add new macro"
|
||
msgstr "Додати новий макрос"
|
||
|
||
#: lazarusidestrconsts.lisaddnewset
|
||
msgid "Add new set"
|
||
msgstr "Додати новий набір"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagerequirement
|
||
msgid "Add package requirement?"
|
||
msgstr "Додати залежності пакунка?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
||
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
||
msgstr "додати пакунки до списку встановлених пакунків (комбінуйте з --build-ide для перезбирання ІСР)."
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject
|
||
msgid "Add package %s to project?"
|
||
msgstr "Додати пакунок %s до проекту?"
|
||
|
||
#: lazarusidestrconsts.lisaddpackagetoproject2
|
||
msgid "Add package to project"
|
||
msgstr "Додати пакунок до проекту"
|
||
|
||
#: lazarusidestrconsts.lisaddparameterbrackets
|
||
msgid "Add parameter brackets"
|
||
msgstr "Додати параметричні дужки"
|
||
|
||
#: lazarusidestrconsts.lisaddress
|
||
msgid "Address:"
|
||
msgstr "Адреса:"
|
||
|
||
#: lazarusidestrconsts.lisaddressbreakpoint
|
||
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
|
||
msgid "&Address Breakpoint ..."
|
||
msgstr "&Точка зупинки за адресою ..."
|
||
|
||
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
||
msgid "Add to include search path?"
|
||
msgstr "Додати до шляхів пошуку файлів для включення?"
|
||
|
||
#: lazarusidestrconsts.lisaddtoproject
|
||
msgid "Add %s to project?"
|
||
msgstr "Додати %s до проекту?"
|
||
|
||
#: lazarusidestrconsts.lisaddtostartupcomponents
|
||
msgid "Add to startup components?"
|
||
msgstr "Додати до компонентів запуску?"
|
||
|
||
#: lazarusidestrconsts.lisaddtounitsearchpath
|
||
msgid "Add to unit search path?"
|
||
msgstr "Додати до шляхів пошуку модулів?"
|
||
|
||
#: lazarusidestrconsts.lisaddunitinterfaces
|
||
msgid "Add unit interfaces"
|
||
msgstr "Додати інтерфейси модулів"
|
||
|
||
#: lazarusidestrconsts.lisaddunitnotrecommended
|
||
msgid "Add unit (not recommended)"
|
||
msgstr "Додати модуль (не рекомендовано)"
|
||
|
||
#: lazarusidestrconsts.lisaddvaluetomacro
|
||
msgid "Add value to macro %s"
|
||
msgstr "Додати значення в макрос %s"
|
||
|
||
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
||
msgid "Add File to Package"
|
||
msgstr "Додати файл до пакунка"
|
||
|
||
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
||
msgid "Destination package"
|
||
msgstr "Пакунок призначення"
|
||
|
||
#: lazarusidestrconsts.lisaf2pfiletype
|
||
msgid "File type"
|
||
msgstr "Тип файлу"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
||
msgid "Invalid Package"
|
||
msgstr "Неправильний пакунок"
|
||
|
||
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
||
msgid "Invalid package ID: \"%s\""
|
||
msgstr "Неправильний ідентифікатор пакунка: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
||
msgid "Package is read only"
|
||
msgstr "Пакунок тільки для читання"
|
||
|
||
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
||
msgid "Package \"%s\" not found."
|
||
msgstr "Пакунок \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.lisaf2pshowall
|
||
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
||
msgid "Show all"
|
||
msgstr "Показувати всі"
|
||
|
||
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
||
msgid "The package %s is read only."
|
||
msgstr "Пакунок %s тільки для читання."
|
||
|
||
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
||
msgid "A file \"%s\" already exists.%sReplace it?"
|
||
msgstr "Файл \"%s\" вже існує.%s Замінити?"
|
||
|
||
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
||
msgid "A filter with the name \"%s\" already exists."
|
||
msgstr "Фільтр з назвою \"%s\" вже існує."
|
||
|
||
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
||
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
||
msgstr "Після очищення (очищення всіх або загальних файлів), перейти до чистої автоматично"
|
||
|
||
#: lazarusidestrconsts.lisalignment
|
||
msgid "Alignment"
|
||
msgstr "Вирівнювання"
|
||
|
||
#: lazarusidestrconsts.lisallblockslooksok
|
||
msgid "All blocks look ok."
|
||
msgstr "Всі блоки виглядають правильно."
|
||
|
||
#: lazarusidestrconsts.lisallbuildmodes
|
||
msgid "<All build modes>"
|
||
msgstr "<Всі режими збирання>"
|
||
|
||
#: lazarusidestrconsts.lisallinheritedoptions
|
||
msgid "All inherited options"
|
||
msgstr "Всі успадковані параметри"
|
||
|
||
#: lazarusidestrconsts.lisalloptions
|
||
msgid "All Options"
|
||
msgstr "Всі параметри"
|
||
|
||
#: lazarusidestrconsts.lisallowfunctio
|
||
msgid "Allow Function Calls"
|
||
msgstr "Дозволити виклики функцій"
|
||
|
||
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
||
msgid "Allow searching for multiple lines"
|
||
msgstr "Дозволити пошук для декількох рядків"
|
||
|
||
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
||
msgid "All parameters of this function are already set at this call. Nothing to add."
|
||
msgstr "Всі параметри у виклику даної функції вже визначені. Додавати нічого."
|
||
|
||
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
||
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
||
msgstr "Всі ваші зміни у \"%s\"%sбудуть втрачені і файл відкриється повторно."
|
||
|
||
#: lazarusidestrconsts.lisalpha
|
||
msgid "Alpha"
|
||
msgstr "Альфа"
|
||
|
||
#: lazarusidestrconsts.lisalternativekey
|
||
msgid "Alternative key"
|
||
msgstr "Альтернативна кнопка"
|
||
|
||
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
||
msgid "Alternative key (or 2 key sequence)"
|
||
msgstr "Альтернативна клавіша (або двоклавішна комбінація)"
|
||
|
||
#: lazarusidestrconsts.lisalways
|
||
msgid "Always"
|
||
msgstr "Завжди"
|
||
|
||
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
||
msgid "Always convert suggested default file name to lowercase"
|
||
msgstr "Завжди конвертувати пропоновану назву файлу в нижній регістр"
|
||
|
||
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
||
msgid "Always draw selected items focused"
|
||
msgstr "Завжди зображати вибраний елемент у фокусі"
|
||
|
||
#: lazarusidestrconsts.lisalwaysignore
|
||
msgid "Always ignore"
|
||
msgstr "Завжди ігнорувати"
|
||
|
||
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
||
msgid "A macro with this name already exists."
|
||
msgstr "Макрос із такою назвою вже існує."
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefound
|
||
msgid "Ambiguous file found"
|
||
msgstr "Знайдено двозначний файл"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
||
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
||
msgstr "Знайдено двозначний файл: \"%s\"%sЙого можна сплутати з \"%s\"%sВидалити цей файл?"
|
||
|
||
#: lazarusidestrconsts.lisambiguousfilesfound
|
||
msgid "Ambiguous files found"
|
||
msgstr "Знайдено двозначні файли"
|
||
|
||
#: lazarusidestrconsts.lisambiguousunitfound
|
||
msgid "Ambiguous unit found"
|
||
msgstr "Знайдено двозначний модуль"
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
||
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Якорити нижній край до нижнього краю брата. Використовуйте BorderSpacing, щоб задати відстань. BorderSpacing брата ігнорується."
|
||
|
||
#: lazarusidestrconsts.lisanchorbottomtotopside
|
||
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Якорити нижній край до верхнього краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
|
||
|
||
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
||
msgid "Anchor Editor - no control selected"
|
||
msgstr "Редактор якорів - не вибрано елемент керування"
|
||
|
||
#: lazarusidestrconsts.lisanchorenabledhint
|
||
msgid "Enabled = Include %s in Anchors"
|
||
msgstr "Ввімкнено = Включити %s в якорі"
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttoleftside
|
||
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Якорити лівий край до лівого краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."
|
||
|
||
#: lazarusidestrconsts.lisanchorlefttorightside
|
||
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Якорити лівий край до правого краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttoleftside
|
||
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Якорити правий край до лівого краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
|
||
|
||
#: lazarusidestrconsts.lisanchorrighttorightside
|
||
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Якорити правий край до правого краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."
|
||
|
||
#: lazarusidestrconsts.lisanchorsof
|
||
msgid "Anchors of %s"
|
||
msgstr "Якорі %s"
|
||
|
||
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
||
msgid "Anchors of selected controls"
|
||
msgstr "Якорі вибраних елементів керування"
|
||
|
||
#: lazarusidestrconsts.lisanchortoptobottomside
|
||
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
||
msgstr "Якорити верхній край до нижнього краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
|
||
|
||
#: lazarusidestrconsts.lisanchortoptotopside
|
||
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
||
msgstr "Якорити верхній край до верхнього краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата ігнорується."
|
||
|
||
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
||
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
||
msgstr "При останньому запуску виникла помилка при завантаженні %s!%sЗавантажити цей проект знову?"
|
||
|
||
#: lazarusidestrconsts.lisapplicationclassname
|
||
msgid "&Application class name"
|
||
msgstr "&Назва класу застосунку"
|
||
|
||
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
||
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
||
msgstr "Графічний застосунок Free Pascal, що використовує кросплатформову бібліотеку LCL для свого ГІК."
|
||
|
||
#: lazarusidestrconsts.lisapply
|
||
msgctxt "lazarusidestrconsts.lisapply"
|
||
msgid "Apply"
|
||
msgstr "Застосувати"
|
||
|
||
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
||
msgid "apply build flags (-B) to dependencies too"
|
||
msgstr "застосовувати прапорці збирання (-B) також до залежностей"
|
||
|
||
#: lazarusidestrconsts.lisapplyconventions
|
||
msgid "Apply conventions"
|
||
msgstr "Застосувати умови"
|
||
|
||
#: lazarusidestrconsts.lisapplyconventionshint
|
||
msgid "Adjust name extension and character case for platform and file type."
|
||
msgstr "Скоригувати розширення назв і регістр символів для платформ і типів файлів."
|
||
|
||
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
||
msgid "A project unit can not be used by other packages/projects"
|
||
msgstr "Модуль проекту не може бути використаний іншими пакунками/проектами"
|
||
|
||
#: lazarusidestrconsts.lisaroundborderspacehint
|
||
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
||
msgstr "Ширина бордюру навколо елемента керування. Інші чотири бордюри додаються до цієї величини."
|
||
|
||
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
||
msgid "Ask before replacing each found text"
|
||
msgstr "Запитати перед заміною кожного фрагменту"
|
||
|
||
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
||
msgid "Ask before saving project's session"
|
||
msgstr "Запитати перед збереженням сеансу проекту"
|
||
|
||
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
||
msgid "Ask for component name after putting it on a designer form."
|
||
msgstr "Запитати назву компонента після встановлення його на формі дизайнера"
|
||
|
||
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
||
msgid "Ask for file name on new file"
|
||
msgstr "Питати назву файлу для нового файлу"
|
||
|
||
#: lazarusidestrconsts.lisasknameoncreate
|
||
msgid "Ask name on create"
|
||
msgstr "Спитати назву при створенні"
|
||
|
||
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
||
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
||
msgstr "Для систем Windows зручно встановити: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheight
|
||
msgid "Automatically adjust IDE main window height"
|
||
msgstr "Автоматично коригувати висоту головного вікна ІСР"
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
||
msgid "Show complete component palette"
|
||
msgstr "Показати повну палітру компонентів"
|
||
|
||
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
||
msgid "If component palette spans over more lines, show them all and not only one."
|
||
msgstr "Якщо палітра компонентів ділиться на декілька рядків, показувати їх всі, а не лише один."
|
||
|
||
#: lazarusidestrconsts.lisautocheckmodifiedfiles
|
||
msgid "Automatically check (select) modified files"
|
||
msgstr "Автоматично перевіряти (вибирати) змінені файли"
|
||
|
||
#: lazarusidestrconsts.lisautocompletionoff
|
||
msgid "Auto completion: off"
|
||
msgstr "Автозавершення: вимкн."
|
||
|
||
#: lazarusidestrconsts.lisautocompletionon
|
||
msgid "Auto completion: on"
|
||
msgstr "Автозавершення: увімкн."
|
||
|
||
#: lazarusidestrconsts.lisautocontinueafter
|
||
msgid "Auto continue after:"
|
||
msgstr "Автопродовження після:"
|
||
|
||
#: lazarusidestrconsts.lisautomarkup
|
||
msgid "Markup and Matches"
|
||
msgstr "Розмітка і збіги"
|
||
|
||
#: lazarusidestrconsts.lisautomatic
|
||
msgctxt "lazarusidestrconsts.lisautomatic"
|
||
msgid "Automatic"
|
||
msgstr "Автоматично"
|
||
|
||
#: lazarusidestrconsts.lisautomatically
|
||
msgid "Automatically"
|
||
msgstr "Автоматично"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
||
msgid "Automatically convert .lfm files to .lrs resource files"
|
||
msgstr "Автоматично перетворювати файли .lfm на файли ресурсів .lrs"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
||
msgid "do not complete selection"
|
||
msgstr "не завершувати вибір"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
||
msgid "Automatically invoke after point"
|
||
msgstr "Автовиклик після крапки"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
||
msgid "line break"
|
||
msgstr "розрив рядка"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonspace
|
||
msgid "space"
|
||
msgstr "пробіл"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyontab
|
||
msgid "tab"
|
||
msgstr "табуляція"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyonwordend
|
||
msgid "word end"
|
||
msgstr "кінець слова"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
||
msgid "do not add character"
|
||
msgstr "не додавати символ"
|
||
|
||
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
||
msgid "Automatically use single possible identifier"
|
||
msgstr "Автоматично використовувати один можливий ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisautomaticfeatures
|
||
msgid "Completion and Hints"
|
||
msgstr "Завершення і підказки"
|
||
|
||
#: lazarusidestrconsts.lisautoshowobjectinspector
|
||
msgid "Auto show"
|
||
msgstr "Автоматичний показ"
|
||
|
||
#: lazarusidestrconsts.lisavailableforinstallation
|
||
msgid "Available for installation"
|
||
msgstr "Доступний для встановлення"
|
||
|
||
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
||
msgid "Available project build modes:"
|
||
msgstr "Доступні режими збирання проекту:"
|
||
|
||
#: lazarusidestrconsts.lisbackupchangedfiles
|
||
msgid "Make backup of changed files"
|
||
msgstr "Зробити резервну копію змінених файлів"
|
||
|
||
#: lazarusidestrconsts.lisbackupfilefailed
|
||
msgid "Backup file failed"
|
||
msgstr "Резервування не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisbackuphint
|
||
msgid "Creates a Backup directory under project directory"
|
||
msgstr "Створює резервний каталог в каталозі проекту"
|
||
|
||
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
||
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
||
msgstr "Зміна назви пакунка або версії порушить залежності. Змінити ці залежності як правило?%sВиберіть Так для заміни всіх перерахованих залежностей.%sВиберіть Знехтувати для розриву залежностей і продовження."
|
||
|
||
#: lazarusidestrconsts.lisbegins
|
||
msgid "begins"
|
||
msgstr "починається"
|
||
|
||
#: lazarusidestrconsts.lisbehindrelated
|
||
msgid "Behind related"
|
||
msgstr "Після пов'язаних"
|
||
|
||
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
||
msgid "be less verbose, can be given multiple times"
|
||
msgstr "виводити менше подробиць, може задаватися декілька разів"
|
||
|
||
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
||
msgid "be more verbose, can be given multiple times"
|
||
msgstr "виводити більше подробиць, може задаватися декілька разів"
|
||
|
||
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
||
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
||
msgstr "Переглядатиметься найкраще, якщо встановити елемент керування HTML, як напр. turbopoweriprodsgn"
|
||
|
||
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
||
msgid "Always build before run"
|
||
msgstr "Завжди збирати перед виконанням"
|
||
|
||
#: lazarusidestrconsts.lisbfbuildcommand
|
||
msgid "Build Command"
|
||
msgstr "Команда збирання"
|
||
|
||
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
||
msgid "On build project execute the Build File command instead"
|
||
msgstr "Замість виконання після збирання проекту використати команду Зібрати файл"
|
||
|
||
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
||
msgid "On run project execute the Run File command instead"
|
||
msgstr "Замість виконання проекту використати команду Виконати файл"
|
||
|
||
#: lazarusidestrconsts.lisbfruncommand
|
||
msgid "Run Command"
|
||
msgstr "Виконати команду"
|
||
|
||
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
||
msgid "When this file is active in source editor"
|
||
msgstr "Коли цей файл активний в редакторі коду"
|
||
|
||
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
||
msgid "Working directory (leave empty for file path)"
|
||
msgstr "Робоча тека (залишити порожньою для файлового шляху)"
|
||
|
||
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
||
msgid "Bold non default values"
|
||
msgstr "Нестандартні значення жирним"
|
||
|
||
#: lazarusidestrconsts.lisborderspace
|
||
msgid "Border space"
|
||
msgstr "Простір межі"
|
||
|
||
#: lazarusidestrconsts.lisbottom
|
||
msgctxt "lazarusidestrconsts.lisbottom"
|
||
msgid "Bottom"
|
||
msgstr "Нижній"
|
||
|
||
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
||
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
||
msgstr "Нижній бордюр. Ця величина додається до базового бордюру і використовується для відступу під контролем."
|
||
|
||
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
||
msgid "Bottom anchoring"
|
||
msgstr "Зафіксувати кнопку"
|
||
|
||
#: lazarusidestrconsts.lisbottoms
|
||
msgid "Bottoms"
|
||
msgstr "Нижні"
|
||
|
||
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr "Це елемент керування одного рівня, за яким фіксується нижня сторона. Залишити порожнім для фіксації за батьківським,як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
|
||
|
||
#: lazarusidestrconsts.lisbottomspaceequally
|
||
msgid "Bottom space equally"
|
||
msgstr "Вниз з еквівалентним відступом"
|
||
|
||
#: lazarusidestrconsts.lisbreak
|
||
msgctxt "lazarusidestrconsts.lisbreak"
|
||
msgid "Break"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts.lisbreakpointproperties
|
||
msgid "Breakpoint Properties"
|
||
msgstr "Властивості точки зупинки"
|
||
|
||
#: lazarusidestrconsts.lisbtnadd
|
||
msgctxt "lazarusidestrconsts.lisbtnadd"
|
||
msgid "&Add"
|
||
msgstr "&Додати"
|
||
|
||
#: lazarusidestrconsts.lisbtnclose
|
||
msgctxt "lazarusidestrconsts.lisbtnclose"
|
||
msgid "&Close"
|
||
msgstr "&Закрити"
|
||
|
||
#: lazarusidestrconsts.lisbtndelete
|
||
msgctxt "lazarusidestrconsts.lisbtndelete"
|
||
msgid "&Delete"
|
||
msgstr "&Видалити"
|
||
|
||
#: lazarusidestrconsts.lisbtndlgadd
|
||
msgid "&Add ..."
|
||
msgstr "&Додати ..."
|
||
|
||
#: lazarusidestrconsts.lisbtndlgreplace
|
||
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
||
msgid "&Replace ..."
|
||
msgstr "За&мінити ..."
|
||
|
||
#: lazarusidestrconsts.lisbtnenabled
|
||
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
||
msgid "&Enabled"
|
||
msgstr "&Доступний"
|
||
|
||
#: lazarusidestrconsts.lisbtnfind
|
||
msgid "&Find"
|
||
msgstr "&Знайти"
|
||
|
||
#: lazarusidestrconsts.lisbtnquit
|
||
msgctxt "lazarusidestrconsts.lisbtnquit"
|
||
msgid "&Quit"
|
||
msgstr "Ви&хід"
|
||
|
||
#: lazarusidestrconsts.lisbtnremove
|
||
msgctxt "lazarusidestrconsts.lisbtnremove"
|
||
msgid "&Remove"
|
||
msgstr "&Видалити"
|
||
|
||
#: lazarusidestrconsts.lisbtnreplace
|
||
msgid "&Replace"
|
||
msgstr "За&мінити"
|
||
|
||
#: lazarusidestrconsts.lisbuild
|
||
msgctxt "lazarusidestrconsts.lisbuild"
|
||
msgid "Build"
|
||
msgstr "Зібрати"
|
||
|
||
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
||
msgid "build all files of project/package/IDE"
|
||
msgstr "зібрати всі файли проекту/пакунка/ІСР"
|
||
|
||
#: lazarusidestrconsts.lisbuildcaption
|
||
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
||
msgid "Build"
|
||
msgstr "Зібрати"
|
||
|
||
#: lazarusidestrconsts.lisbuildfollowingmodes
|
||
msgid "Build the following modes"
|
||
msgstr "Зібрати у таких режимах"
|
||
|
||
#: lazarusidestrconsts.lisbuildide
|
||
msgid "Build IDE"
|
||
msgstr "Зібрати ІСР"
|
||
|
||
#: lazarusidestrconsts.lisbuildidewithpackages
|
||
msgid "build IDE with packages"
|
||
msgstr "будувати ІСР з пакунками"
|
||
|
||
#: lazarusidestrconsts.lisbuilding
|
||
msgid "Building"
|
||
msgstr "Збирання"
|
||
|
||
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
||
msgid "Building Lazarus failed"
|
||
msgstr "Не вдалось зібрати Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisbuildmode
|
||
msgid "Build Mode: %s"
|
||
msgstr "Режим збирання: %s"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
||
msgid "Differences between build modes"
|
||
msgstr "Відмінності між режимами збирання"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
||
msgid "Differences from other build modes"
|
||
msgstr "Відмінності від інших режимів збирання"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodediffmode
|
||
msgid "Mode:"
|
||
msgstr "Режим:"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
||
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
||
msgstr "Назва на панелі завдань, наприклад: project1.lpi - Release - Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisbuildmodes
|
||
msgid "Build modes"
|
||
msgstr "Режими збирання"
|
||
|
||
#: lazarusidestrconsts.lisbuildnewproject
|
||
msgid "Build new project"
|
||
msgstr "Зібрати новий проект"
|
||
|
||
#: lazarusidestrconsts.lisbuildnumber
|
||
msgid "Build number"
|
||
msgstr "Номер збірки"
|
||
|
||
#: lazarusidestrconsts.lisbuildstage
|
||
msgctxt "lazarusidestrconsts.lisbuildstage"
|
||
msgid "Build"
|
||
msgstr "Зібрати"
|
||
|
||
#: lazarusidestrconsts.lisbusy
|
||
msgid "Busy"
|
||
msgstr "Зайнятий"
|
||
|
||
#: lazarusidestrconsts.lisbyte
|
||
msgid "%s byte"
|
||
msgstr "%s байт"
|
||
|
||
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
||
msgid "Calling %s to create Makefile from %s failed."
|
||
msgstr "Виклик %s для створення Makefile з %s не вдався."
|
||
|
||
#: lazarusidestrconsts.liscallstacknotevaluated
|
||
msgid "Stack not evaluated"
|
||
msgstr "Стек не оцінений"
|
||
|
||
#: lazarusidestrconsts.liscancel
|
||
msgctxt "lazarusidestrconsts.liscancel"
|
||
msgid "Cancel"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
||
msgid "Cancel loading this component"
|
||
msgstr "Скасувати завантаження цього компонента"
|
||
|
||
#: lazarusidestrconsts.liscancelloadingunit
|
||
msgid "Cancel loading unit"
|
||
msgstr "Скасувати завантаження модуля"
|
||
|
||
#: lazarusidestrconsts.liscancelrenaming
|
||
msgid "Cancel renaming"
|
||
msgstr "Скасувати зміну назви"
|
||
|
||
#: lazarusidestrconsts.liscannotcompileproject
|
||
msgid "Cannot compile project"
|
||
msgstr "Неможливо скомпілювати проект"
|
||
|
||
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
||
msgid "Cannot copy top level component."
|
||
msgstr "Неможливо скопіювати компонент верхнього рівня."
|
||
|
||
#: lazarusidestrconsts.liscannotcreatefile
|
||
msgid "Cannot create file \"%s\""
|
||
msgstr "Неможливо створити файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.liscannotexecute
|
||
msgid "cannot execute \"%s\""
|
||
msgstr "неможливо виконати \"%s\""
|
||
|
||
#: lazarusidestrconsts.liscannotfind
|
||
msgid "Cannot find %s"
|
||
msgstr "Не вдалось знайти %s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindexecutable
|
||
msgid "cannot find executable \"%s\""
|
||
msgstr "не вдалось знайти виконуваний файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
||
msgid "Cannot find Lazarus starter:%s%s"
|
||
msgstr "Неможливо знайти пускач Lazarus:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscannotfindunit
|
||
msgid "Cannot find unit %s"
|
||
msgstr "Не вдалось знайти модуль %s"
|
||
|
||
#: lazarusidestrconsts.liscannotopenform
|
||
msgid "Cannot open form \"%s\"."
|
||
msgstr "Не вдалось відкрити форму \"%s\"."
|
||
|
||
#: lazarusidestrconsts.liscannotsaveform
|
||
msgid "Cannot save form \"%s\"."
|
||
msgstr "Не вдалось зберегти форму \"%s\"."
|
||
|
||
#: lazarusidestrconsts.liscannotsubstitutemacros
|
||
msgid "Cannot substitute macro \"%s\"."
|
||
msgstr "Неможливо підставити макрос \"%s\"."
|
||
|
||
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
||
msgid "Cannot test the compiler while debugging or compiling."
|
||
msgstr "Неможливо тестувати компілятор при зневаджуванні чи компілюванні."
|
||
|
||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||
msgid "Can only change the class of TComponents."
|
||
msgstr "Можу змінити тільки клас TComponetns"
|
||
|
||
#: lazarusidestrconsts.liscantfindavalidppu
|
||
msgid "Can't find a valid %s.ppu"
|
||
msgstr "Неможливо знайти правильний %s.ppu"
|
||
|
||
#: lazarusidestrconsts.liscaptioncomparefiles
|
||
msgid "Compare files (not for creating patches)"
|
||
msgstr "Порівняти файли (не для створення латок)"
|
||
|
||
#: lazarusidestrconsts.liscbpfiles
|
||
msgid "%s (%s files)"
|
||
msgstr "%s (%s файлів)"
|
||
|
||
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
||
msgid "Really delete %s source files%s%s"
|
||
msgstr "Справді видалити %s файлів з вих. кодом%s%s"
|
||
|
||
#: lazarusidestrconsts.lisccdchangeclassof
|
||
msgid "Change Class of %s"
|
||
msgstr "Змінити клас для %s"
|
||
|
||
#: lazarusidestrconsts.lisccdnoclass
|
||
msgid "no class"
|
||
msgstr "немає класу"
|
||
|
||
#: lazarusidestrconsts.lisccoambiguouscompiler
|
||
msgid "Ambiguous compiler"
|
||
msgstr "Неоднозначний компілятор"
|
||
|
||
#: lazarusidestrconsts.lisccochecktestdir
|
||
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
||
msgstr "Перевірте теку Тестів в %sІнструменти -> Параметри -> Файли -> Тека для створення тестових проектів"
|
||
|
||
#: lazarusidestrconsts.lisccocompilernotanexe
|
||
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
||
msgstr "Компілятор \"%s\" не є виконуваним файлом.%sДетально: %s"
|
||
|
||
#: lazarusidestrconsts.lisccocontains
|
||
msgid "contains "
|
||
msgstr "містить "
|
||
|
||
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
||
msgid "Copy output to clipboard"
|
||
msgstr "Копіювати вивід в буфер"
|
||
|
||
#: lazarusidestrconsts.lisccodatesdiffer
|
||
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
||
msgstr "Дати файлів .ppu FPC відрізняються більше ніж на годину.%sЦе може означати, що вони з двох різних встановлень.%sФайл1: %s%sФайл2: %s"
|
||
|
||
#: lazarusidestrconsts.lisccoerrorcaption
|
||
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.lisccoerrormsg
|
||
msgid "ERROR: "
|
||
msgstr "ПОМИЛКА: "
|
||
|
||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||
msgid "FPC unit path contains a source: "
|
||
msgstr "Шлях модуля FPC містить джерело: "
|
||
|
||
#: lazarusidestrconsts.lisccohasnewline
|
||
msgid "new line symbols"
|
||
msgstr "символи нового рядка"
|
||
|
||
#: lazarusidestrconsts.lisccohintmsg
|
||
msgid "HINT: "
|
||
msgstr "ПІДКАЗКА:"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidcompiler
|
||
msgid "Invalid compiler"
|
||
msgstr "Неправильний компілятор"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
||
msgid "Invalid search path"
|
||
msgstr "Неправильний шлях пошуку"
|
||
|
||
#: lazarusidestrconsts.lisccoinvalidtestdir
|
||
msgid "Invalid Test Directory"
|
||
msgstr "Неправильна тестова тека"
|
||
|
||
#: lazarusidestrconsts.lisccomissingunit
|
||
msgid "Missing unit"
|
||
msgstr "Втрачений модуль"
|
||
|
||
#: lazarusidestrconsts.lisccomsgppunotfound
|
||
msgid "compiled FPC unit not found: %s.ppu"
|
||
msgstr "зібраний модуль FPC не знайдено: %s.ppu"
|
||
|
||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||
msgid "multiple compiler configs found: "
|
||
msgstr "знайдено кілька конфігурацій компілятора: "
|
||
|
||
#: lazarusidestrconsts.liscconocfgfound
|
||
msgid "no fpc.cfg found"
|
||
msgstr "Не знайдено fpc.cfg"
|
||
|
||
#: lazarusidestrconsts.lisccononascii
|
||
msgid "non ASCII"
|
||
msgstr "не ASCII"
|
||
|
||
#: lazarusidestrconsts.lisccoppuexiststwice
|
||
msgid "ppu exists twice: %s, %s"
|
||
msgstr "ppu наявний двічі: %s, %s"
|
||
|
||
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
||
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
||
msgstr "Зібраний модуль FPC %s.ppu не знайдений.%sЦе зазвичай означає, що ваш fpc.cfg має помилку. Або встановлення вашого FPC зламане."
|
||
|
||
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
||
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
||
msgstr "Існує .ppu файл старший самого компілятора:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisccoseveralcompilers
|
||
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
||
msgstr "За вашим шляхом є кілька компіляторів Free Pascal.%s%s%sМожливо ви забули видалити старий компілятор?"
|
||
|
||
#: lazarusidestrconsts.lisccoskip
|
||
msgid "Skip"
|
||
msgstr "Пропустити"
|
||
|
||
#: lazarusidestrconsts.lisccospecialcharacters
|
||
msgid "special characters"
|
||
msgstr "спеціальні символи"
|
||
|
||
#: lazarusidestrconsts.lisccotestssuccess
|
||
msgid "All tests succeeded."
|
||
msgstr "Всі тести виконано успішно."
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||
msgid "Unable to create Test File"
|
||
msgstr "Неможливо створити тестовий файл"
|
||
|
||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||
msgid "Unable to create Test Pascal file \"%s\"."
|
||
msgstr "Неможливо створити тестовий файл Pascal \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisccounusualchars
|
||
msgid "unusual characters"
|
||
msgstr "незвичайні символи"
|
||
|
||
#: lazarusidestrconsts.lisccowarningcaption
|
||
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
||
msgid "Warning"
|
||
msgstr "Попередження"
|
||
|
||
#: lazarusidestrconsts.lisccowarningmsg
|
||
msgid "WARNING: "
|
||
msgstr "ПОПЕРЕДЖЕННЯ: "
|
||
|
||
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
||
msgid "wrong path delimiter"
|
||
msgstr "неправильний роздільник шляху"
|
||
|
||
#: lazarusidestrconsts.liscecategories
|
||
msgid "Categories"
|
||
msgstr "Категорії"
|
||
|
||
#: lazarusidestrconsts.liscecomplexitygroup
|
||
msgid "Complexity"
|
||
msgstr "Складність"
|
||
|
||
#: lazarusidestrconsts.lisceconstants
|
||
msgid "Constants"
|
||
msgstr "Константи"
|
||
|
||
#: lazarusidestrconsts.lisceemptyblocks
|
||
msgid "Empty blocks"
|
||
msgstr "Порожні блоки"
|
||
|
||
#: lazarusidestrconsts.lisceemptyclasssections
|
||
msgid "Empty class sections"
|
||
msgstr "Порожні класові секції"
|
||
|
||
#: lazarusidestrconsts.lisceemptygroup
|
||
msgid "Empty constructs"
|
||
msgstr "Порожні конструктори"
|
||
|
||
#: lazarusidestrconsts.lisceemptyprocedures
|
||
msgid "Empty procedures"
|
||
msgstr "Порожні процедури"
|
||
|
||
#: lazarusidestrconsts.liscefilter
|
||
msgid "(filter)"
|
||
msgstr "(фільтр)"
|
||
|
||
#: lazarusidestrconsts.liscefollowcursor
|
||
msgid "Follow cursor"
|
||
msgstr "Слідувати за курсором"
|
||
|
||
#: lazarusidestrconsts.liscein
|
||
msgctxt "lazarusidestrconsts.liscein"
|
||
msgid "%s in %s"
|
||
msgstr "%s в %s"
|
||
|
||
#: lazarusidestrconsts.lisceisarootcontrol
|
||
msgid "Is a root control"
|
||
msgstr "Є кореневим елементом керування"
|
||
|
||
#: lazarusidestrconsts.liscelongparamlistcount
|
||
msgid "Parameters count treated as \"many\""
|
||
msgstr "К-сть параметрів розглядається як \"багато\""
|
||
|
||
#: lazarusidestrconsts.liscelongprocedures
|
||
msgid "Long procedures"
|
||
msgstr "Довгі процедури"
|
||
|
||
#: lazarusidestrconsts.liscelongproclinecount
|
||
msgid "Line count of procedure treated as \"long\""
|
||
msgstr "К-сть рядків процедури розглядається як \"багато\""
|
||
|
||
#: lazarusidestrconsts.liscemanynestedprocedures
|
||
msgid "Many nested procedures"
|
||
msgstr "Багато вкладених процедур"
|
||
|
||
#: lazarusidestrconsts.liscemanyparameters
|
||
msgid "Many parameters"
|
||
msgstr "Багато параметрів"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowcategories
|
||
msgid "Show Categories"
|
||
msgstr "Показувати Категорії"
|
||
|
||
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
||
msgid "Show Source Nodes"
|
||
msgstr "Показати вузли сирців"
|
||
|
||
#: lazarusidestrconsts.liscenestedproccount
|
||
msgid "Nested procedures count treated as \"many\""
|
||
msgstr "К-сть вкладених процедур розглядається як \"багато\""
|
||
|
||
#: lazarusidestrconsts.liscenteralostwindow
|
||
msgid "Center a lost window"
|
||
msgstr "Центрувати загублене вікно"
|
||
|
||
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
||
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr "Відцентрувати елемент керування по горизонталі відносно заданого рівня. BorderSpacing нехтується."
|
||
|
||
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
||
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
||
msgstr "Відцентрувати елемент керування по вертикалі відносно заданого рівня. BorderSpacing нехтується."
|
||
|
||
#: lazarusidestrconsts.liscenterform
|
||
msgid "Center Form"
|
||
msgstr "Центрувати форму"
|
||
|
||
#: lazarusidestrconsts.liscenterinwindow
|
||
msgid "Center in window"
|
||
msgstr "Центр вікна"
|
||
|
||
#: lazarusidestrconsts.liscenters
|
||
msgid "Centers"
|
||
msgstr "Центри"
|
||
|
||
#: lazarusidestrconsts.lisceomode
|
||
msgid "Preferred exhibition mode"
|
||
msgstr "Переважний режим показу"
|
||
|
||
#: lazarusidestrconsts.lisceomodecategory
|
||
msgctxt "lazarusidestrconsts.lisceomodecategory"
|
||
msgid "Category"
|
||
msgstr "Категорія"
|
||
|
||
#: lazarusidestrconsts.lisceomodesource
|
||
msgctxt "lazarusidestrconsts.lisceomodesource"
|
||
msgid "Source"
|
||
msgstr "Джерело"
|
||
|
||
#: lazarusidestrconsts.lisceoneveronlymanually
|
||
msgid "Never, only manually"
|
||
msgstr "Ніколи, тільки вручну"
|
||
|
||
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
||
msgid "Only used in category mode"
|
||
msgstr "Використовується лише в режимі категорій"
|
||
|
||
#: lazarusidestrconsts.lisceoonidle
|
||
msgid "On idle"
|
||
msgstr "В паузах"
|
||
|
||
#: lazarusidestrconsts.lisceorefreshautomatically
|
||
msgid "Refresh automatically"
|
||
msgstr "Оновлювати автоматично"
|
||
|
||
#: lazarusidestrconsts.lisceothergroup
|
||
msgctxt "lazarusidestrconsts.lisceothergroup"
|
||
msgid "Other"
|
||
msgstr "Інше"
|
||
|
||
#: lazarusidestrconsts.lisceoupdate
|
||
msgid "Update"
|
||
msgstr "Поновити"
|
||
|
||
#: lazarusidestrconsts.lisceowhenswitchingfile
|
||
msgid "When switching file in source editor"
|
||
msgstr "Коли перемикається файл в редакторі коду"
|
||
|
||
#: lazarusidestrconsts.lisceprocedures
|
||
msgid "Procedures"
|
||
msgstr "Процедури"
|
||
|
||
#: lazarusidestrconsts.lisceproperties
|
||
msgctxt "lazarusidestrconsts.lisceproperties"
|
||
msgid "Properties"
|
||
msgstr "Властивості"
|
||
|
||
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
||
msgid "Published properties without default"
|
||
msgstr "Опубліковані властивості без типових"
|
||
|
||
#: lazarusidestrconsts.lisceshowcodeobserver
|
||
msgid "Show observations about"
|
||
msgstr "Показати зауваження з приводу"
|
||
|
||
#: lazarusidestrconsts.liscestylegroup
|
||
msgctxt "lazarusidestrconsts.liscestylegroup"
|
||
msgid "Style"
|
||
msgstr "Стиль"
|
||
|
||
#: lazarusidestrconsts.liscesurrounding
|
||
msgid "Surrounding"
|
||
msgstr "Навколишні"
|
||
|
||
#: lazarusidestrconsts.liscetodos
|
||
msgid "ToDos"
|
||
msgstr "Записи ToDo"
|
||
|
||
#: lazarusidestrconsts.liscetypes
|
||
msgid "Types"
|
||
msgstr "Типи"
|
||
|
||
#: lazarusidestrconsts.lisceunnamedconstants
|
||
msgid "Unnamed constants"
|
||
msgstr "Неіменовані константи"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedmembers
|
||
msgid "Unsorted members"
|
||
msgstr "Несортовані члени"
|
||
|
||
#: lazarusidestrconsts.lisceunsortedvisibility
|
||
msgid "Unsorted visibility"
|
||
msgstr "Видимість несортованих"
|
||
|
||
#: lazarusidestrconsts.lisceuses
|
||
msgctxt "lazarusidestrconsts.lisceuses"
|
||
msgid "Uses"
|
||
msgstr "Uses"
|
||
|
||
#: lazarusidestrconsts.liscevariables
|
||
msgid "Variables"
|
||
msgstr "Змінні"
|
||
|
||
#: lazarusidestrconsts.liscewrongindentation
|
||
msgid "Wrong indentation"
|
||
msgstr "Неправильні відступи"
|
||
|
||
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
||
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
||
msgstr "Стався виняток під час видалення%s\"%s:%s\"%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
||
msgid "Cancel loading this resource"
|
||
msgstr "Скасувати завантаження цього ресурсу"
|
||
|
||
#: lazarusidestrconsts.liscfeclassnotfound
|
||
msgid "%s%sClass \"%s\" not found."
|
||
msgstr "%s%sКлас \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.liscfecomponent
|
||
msgid "%s%sComponent: %s:%s"
|
||
msgstr "%s%sКомпонент: %s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfecomponentclass
|
||
msgid "%s%sComponent Class: %s"
|
||
msgstr "%s%sКлас компонента: %s"
|
||
|
||
#: lazarusidestrconsts.liscfecontinueloading
|
||
msgid "Continue loading"
|
||
msgstr "Продовжити завантаження"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
||
msgid "Do not know how to copy this form editing selection"
|
||
msgstr "Не знаю, як скопіювати цей вибір форми редагування"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
||
msgid "Do not know how to cut this form editing selection"
|
||
msgstr "Не знаю, як вирізати цей вибір форми редагування"
|
||
|
||
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
||
msgid "Do not know how to delete this form editing selection"
|
||
msgstr "Не знаю, як видалити цей вибір форми редагування"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
||
msgid "Error creating component"
|
||
msgstr "Помилка створення компонента"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
||
msgid "Error creating component: %s%s%s"
|
||
msgstr "Помилка створення компонента: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
||
msgid "Error destroying component"
|
||
msgstr "Помилка знищення компонента"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
||
msgid "Error destroying component of type %s of unit %s:%s%s"
|
||
msgstr "Помилка знищення компонента типу %s модуля %s:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
||
msgid "Error destroying mediator"
|
||
msgstr "Помилка знищення посередника"
|
||
|
||
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
||
msgid "Error destroying mediator %s of unit %s:%s%s"
|
||
msgstr "Помилка знищення посередника %s модуля %s:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscfeerrorreading
|
||
msgid "Error reading %s"
|
||
msgstr "Помилка читання %s"
|
||
|
||
#: lazarusidestrconsts.liscfeinfile
|
||
msgid "In file %s"
|
||
msgstr "У файлі %s"
|
||
|
||
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
||
msgid "Invalid component owner"
|
||
msgstr "Неприпустимий власник компонента"
|
||
|
||
#: lazarusidestrconsts.liscferoot
|
||
msgid "%sRoot=%s:%s"
|
||
msgstr "%sКореневий=%s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfestopallloading
|
||
msgid "Stop all loading"
|
||
msgstr "Зупинити всі завантаження"
|
||
|
||
#: lazarusidestrconsts.liscfestream
|
||
msgid "%sStream=%s"
|
||
msgstr "%sПотік=%s"
|
||
|
||
#: lazarusidestrconsts.liscfestreamposition
|
||
msgid "%s%sStream position: %s"
|
||
msgstr "%s%sПозиція потоку: %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
||
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm вже існує"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
||
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
||
msgstr "TCustomFormEditor.CreateNonFormForm Невідомий тип %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
||
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
||
msgstr "TCustomFormEditor.DeleteComponent Де знаходиться TCustomNonFormDesignerForm? %s"
|
||
|
||
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
||
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
||
msgstr "TCustomFormEditor.RegisterDesignerMediator вже зареєстрований: %s"
|
||
|
||
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
||
msgstr "Редактор компонента класу \"%s\"створив помилку:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
||
msgid "The component of type %s failed to set its owner to %s:%s"
|
||
msgstr "Компонент типу %s не зміг встановити свого власника на %s:%s"
|
||
|
||
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
||
msgid "Unable to clear the form editing selection%s%s"
|
||
msgstr "Не вдалося очистити вибір форми редагування%s%s"
|
||
|
||
#: lazarusidestrconsts.lischange
|
||
msgctxt "lazarusidestrconsts.lischange"
|
||
msgid "Change"
|
||
msgstr "Змінити"
|
||
|
||
#: lazarusidestrconsts.lischangebuildmode
|
||
msgid "Change build mode"
|
||
msgstr "Змінити режим збирання"
|
||
|
||
#: lazarusidestrconsts.lischangeclass
|
||
msgid "Change Class"
|
||
msgstr "Змінити клас"
|
||
|
||
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
||
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
||
msgstr "Змінено координату %s %s з \"%d\" на \"%d\" у %s."
|
||
|
||
#: lazarusidestrconsts.lischangeencoding
|
||
msgid "Change Encoding"
|
||
msgstr "Змінити кодування"
|
||
|
||
#: lazarusidestrconsts.lischangefile
|
||
msgid "Change file"
|
||
msgstr "Змінити файл"
|
||
|
||
#: lazarusidestrconsts.lischangeparent
|
||
msgid "Change Parent"
|
||
msgstr "Змінити предка"
|
||
|
||
#: lazarusidestrconsts.lischangeswerenotsaved
|
||
msgid "Changes were not saved"
|
||
msgstr "Зміни не були збережені"
|
||
|
||
#: lazarusidestrconsts.lischangetounix
|
||
msgid "Change to Unix /"
|
||
msgstr "Змінити на Unix /"
|
||
|
||
#: lazarusidestrconsts.lischangetowindows
|
||
msgid "Change to Windows \\"
|
||
msgstr "Змінити на Windows \\"
|
||
|
||
#: lazarusidestrconsts.lischaracter
|
||
msgid "Character"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts.lischaractermap
|
||
msgid "Character Map"
|
||
msgstr "Таблиця символів"
|
||
|
||
#: lazarusidestrconsts.lischeckall
|
||
msgid "Check All"
|
||
msgstr "Відмітити все"
|
||
|
||
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
||
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
|
||
msgid "Check for disk file changes via content rather than timestamp"
|
||
msgstr "Перевіряти зміни файлу на диску за вмістом, а не за міткою часу"
|
||
|
||
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
||
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
||
msgstr ". Перевірте, що пакунок %s створює %s.ppu і цей файл ніщо не видаляє. Також переконайтесь, що два пакунки одночасно не мають доступу до сирців модуля."
|
||
|
||
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
||
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
|
||
msgid ". Check if package %s is in the dependencies"
|
||
msgstr ". Перевірте, чи є пакунок %s у списку залежностей"
|
||
|
||
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
||
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
||
msgstr "Перевіряти, чи наступний елемент у джерелі є \"end\" і, якщо ні, то повернути \"КінецьРядка + end; + КінецьРядка\"."
|
||
|
||
#: lazarusidestrconsts.lischeckoptions
|
||
msgid "Check options"
|
||
msgstr "Перевірити параметри"
|
||
|
||
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
||
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
|
||
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
||
msgstr ". Перевірте список шляхів пошуку пакунка %s, спробуйте перезібрати з очищенням, перевірте вирази Uses у секціях Implementation."
|
||
|
||
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
||
msgid "Check the next token in source and add a semicolon if needed."
|
||
msgstr "Перевірити наступний елемент у джерелі і, за потреби, додати крапку з комою.Перевірити наступний елемент у джерелі і, за потреби, додати крапку з комою."
|
||
|
||
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
||
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
||
msgstr "%s Перевірити ціль (ОС, ЦП, тип віджету LCL). Можливо вам треба перекомпілювати пакунок для цієї цілі або встановити іншу ціль для проекту."
|
||
|
||
#: lazarusidestrconsts.lischeckuncheckall
|
||
msgid "Check/uncheck all"
|
||
msgstr "Позначити/зняти всі"
|
||
|
||
#: lazarusidestrconsts.lischooseadifferentname
|
||
msgid "Choose a different name"
|
||
msgstr "Виберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
||
msgid "Choose a file with CodeTools templates"
|
||
msgstr "Виберіть файл з шаблонами CodeTools"
|
||
|
||
#: lazarusidestrconsts.lischooseafpdoclink
|
||
msgid "Choose a FPDoc link"
|
||
msgstr "Виберіть посилання FPDoc"
|
||
|
||
#: lazarusidestrconsts.lischooseakey
|
||
msgid "Choose a key ..."
|
||
msgstr "Виберіть клавішу ..."
|
||
|
||
#: lazarusidestrconsts.lischooseanameforthecomponent
|
||
msgid "Choose a name for the component"
|
||
msgstr "Виберіть назву для компонента"
|
||
|
||
#: lazarusidestrconsts.lischooseanexamplefile
|
||
msgid "Choose an example file"
|
||
msgstr "Виберіть файл прикладу"
|
||
|
||
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
||
msgid "Choose an FPC message file"
|
||
msgstr "Виберіть файл повідомлень FPC"
|
||
|
||
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
||
msgid "Choose a Pascal file for indentation examples"
|
||
msgstr "Виберіть Pascal-файл з прикладами відступів"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilerexecutable
|
||
msgid "Choose compiler executable (%s)"
|
||
msgstr "Виберіть виконуваний файл компілятора (%s)"
|
||
|
||
#: lazarusidestrconsts.lischoosecompilermessages
|
||
msgid "Choose compiler messages file"
|
||
msgstr "Виберіть файл повідомлень компілятора"
|
||
|
||
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
||
msgid "Choose debugger executable"
|
||
msgstr "Виберіть виконуваний файл зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphipackage
|
||
msgid "Choose Delphi package (*.dpk)"
|
||
msgstr "Виберіть пакунок Delphi (*.dpk)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiproject
|
||
msgid "Choose Delphi project (*.dpr)"
|
||
msgstr "Виберіть проект Delphi (*.dpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosedelphiunit
|
||
msgid "Choose Delphi unit (*.pas)"
|
||
msgstr "Виберіть модуль Delphi (*.pas)"
|
||
|
||
#: lazarusidestrconsts.lischoosedirectory
|
||
msgid "Choose directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts.lischooseexecutable
|
||
msgid "Choose an executable"
|
||
msgstr "Виберіть виконуваний файл"
|
||
|
||
#: lazarusidestrconsts.lischoosefpcsourcedir
|
||
msgid "Choose FPC source directory"
|
||
msgstr "Виберіть теку коду FPC"
|
||
|
||
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
||
msgid "Choose Lazarus Directory"
|
||
msgstr "Виберіть теку Lazarus"
|
||
|
||
#: lazarusidestrconsts.lischoosemakeexecutable
|
||
msgid "Choose \"make\" executable"
|
||
msgstr "Виберіть виконуваний файл \"make\""
|
||
|
||
#: lazarusidestrconsts.lischoosename
|
||
msgid "Choose name"
|
||
msgstr "Виберіть назву"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
||
msgid "Choose one of these items to create a new File"
|
||
msgstr "Виберіть один із цих пунктів для створення нового файлу"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
||
msgid "Choose one of these items to create a new Package"
|
||
msgstr "Виберіть один із цих пунктів для створення нового пакунка"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
||
msgid "Choose one of these items to create a new Project"
|
||
msgstr "Виберіть один із цих пунктів для створення нового проекту"
|
||
|
||
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
||
msgid "Choose one of these items to inherit from an existing one"
|
||
msgstr "Виберіть один із цих елементів для його успадкування "
|
||
|
||
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
||
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
||
msgstr "Виберіть код програми (*.pp,*.pas,*.lpr)"
|
||
|
||
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
||
msgid "Choose structure to enclose selection"
|
||
msgstr "Виберіть структуру для вміщення у неї вибраного"
|
||
|
||
#: lazarusidestrconsts.lischoosetestbuilddir
|
||
msgid "Choose the directory for tests"
|
||
msgstr "Виберіть теку для тестів"
|
||
|
||
#: lazarusidestrconsts.liscirculardependencydetected
|
||
msgid "Circular dependency detected"
|
||
msgstr "Виявлена кільцева залежність"
|
||
|
||
#: lazarusidestrconsts.lisclass
|
||
msgid "&Class"
|
||
msgstr "&Клас"
|
||
|
||
#: lazarusidestrconsts.lisclasscompletion
|
||
msgid "Class Completion"
|
||
msgstr "Завершення класу"
|
||
|
||
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
||
msgid "Classes and properties exist. Values were not checked."
|
||
msgstr "Класи та властивості існують. Значення не були перевірені."
|
||
|
||
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
||
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
||
msgstr "Клас \"%s\" не є зареєстрованим класом компонента.%sНеможливо вставити."
|
||
|
||
#: lazarusidestrconsts.lisclassnotfound
|
||
msgid "Class not found"
|
||
msgstr "Клас не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisclassnotfoundat
|
||
msgid "Class %s not found at %s(%s,%s)"
|
||
msgstr "Клас %s не знайдено у %s(%s,%s)"
|
||
|
||
#: lazarusidestrconsts.lisclassofmethodnotfound
|
||
msgid "Class \"%s\" of method \"%s\" not found."
|
||
msgstr "Клас \"%s\" методу \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.liscldirclean
|
||
msgid "Clean"
|
||
msgstr "Очистити"
|
||
|
||
#: lazarusidestrconsts.liscldircleandirectory
|
||
msgid "Clean Directory"
|
||
msgstr "Очистити теку"
|
||
|
||
#: lazarusidestrconsts.liscldircleansubdirectories
|
||
msgid "Clean sub directories"
|
||
msgstr "Очистити підтеки"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
||
msgid "Keep all text files"
|
||
msgstr "Залишати всі текстові файли"
|
||
|
||
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
||
msgid "Keep files matching filter"
|
||
msgstr "Залишати файли, що відпов. фільтру"
|
||
|
||
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
||
msgid "Remove files matching filter"
|
||
msgstr "Видалити файли за фільтром"
|
||
|
||
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
||
msgid "Simple Syntax (e.g. * instead of .*)"
|
||
msgstr "Простий синтаксис (напр., * замість .*)"
|
||
|
||
#: lazarusidestrconsts.liscleanall
|
||
msgid "Clean all"
|
||
msgstr "Очистити все"
|
||
|
||
#: lazarusidestrconsts.liscleancommonfiles
|
||
msgid "Clean common files"
|
||
msgstr "Очистити загальні файли"
|
||
|
||
#: lazarusidestrconsts.liscleanlazarussource
|
||
msgid "Clean Lazarus Source"
|
||
msgstr "Очистити коди Lazarus"
|
||
|
||
#: lazarusidestrconsts.liscleanonlyonce
|
||
msgid "Switch after building to automatically"
|
||
msgstr "Перейти після збирання на автоматично"
|
||
|
||
#: lazarusidestrconsts.liscleanup
|
||
msgid "Clean up"
|
||
msgstr "Очистка"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuild
|
||
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
||
msgid "Clean up and build"
|
||
msgstr "Очистити і зібрати"
|
||
|
||
#: lazarusidestrconsts.liscleanupandbuildproject
|
||
msgid "Clean up and build project"
|
||
msgstr "Очистити і зібрати проект"
|
||
|
||
#: lazarusidestrconsts.liscleanuppackage
|
||
msgid "Clean up package \"%s\"."
|
||
msgstr "Очистити пакунок \"%s\"."
|
||
|
||
#: lazarusidestrconsts.liscleanupunitpath
|
||
msgid "Clean up unit path?"
|
||
msgstr "Очистити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts.lisclear
|
||
msgctxt "lazarusidestrconsts.lisclear"
|
||
msgid "Clear"
|
||
msgstr "Очистити"
|
||
|
||
#: lazarusidestrconsts.liscleardirectory
|
||
msgid "Clear Directory?"
|
||
msgstr "Очистити теку?"
|
||
|
||
#: lazarusidestrconsts.lisclearthefilterforoptions
|
||
msgid "Clear the filter for options"
|
||
msgstr "Очистити фільтр параметрів"
|
||
|
||
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
||
msgid "Click here to browse the file"
|
||
msgstr "Клацніть тут для вибору файлу"
|
||
|
||
#: lazarusidestrconsts.lisclicktoseethechoices
|
||
msgid "Click to see the choices"
|
||
msgstr "Клацніть, щоб побачити вибір"
|
||
|
||
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
||
msgid "Click to Select Palette Page"
|
||
msgstr "Клацніть для вибору сторінки палітри"
|
||
|
||
#: lazarusidestrconsts.lisclone
|
||
msgid "Clone"
|
||
msgstr "Клонувати"
|
||
|
||
#: lazarusidestrconsts.lisclose
|
||
msgctxt "lazarusidestrconsts.lisclose"
|
||
msgid "Close"
|
||
msgstr "Закрити"
|
||
|
||
#: lazarusidestrconsts.liscloseall
|
||
msgctxt "lazarusidestrconsts.liscloseall"
|
||
msgid "Close All"
|
||
msgstr "Очистити все"
|
||
|
||
#: lazarusidestrconsts.liscloseallchecked
|
||
msgid "Close All Checked"
|
||
msgstr "Закрити всі відмічені"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsclose
|
||
msgid "Close files"
|
||
msgstr "Закрити файли"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabshide
|
||
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
||
msgid "Hide window"
|
||
msgstr "Сховати вікно"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabsquestion
|
||
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
||
msgstr "Закриття вікна Редактора вихідного коду. Ви хочете закрити всі файли чи сховати вікно?"
|
||
|
||
#: lazarusidestrconsts.lisclosealltabstitle
|
||
msgid "Close Source Editor Window"
|
||
msgstr "Закрити вікно Редактора Коду"
|
||
|
||
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
||
msgid "LCL Interface specific options:"
|
||
msgstr "Параметри LCL, що залежать від інтерфейсу:"
|
||
|
||
#: lazarusidestrconsts.liscmparameter
|
||
msgid "Parameter"
|
||
msgstr "Параметр"
|
||
|
||
#: lazarusidestrconsts.liscmplstcomponents
|
||
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
||
msgid "Components"
|
||
msgstr "Компоненти"
|
||
|
||
#: lazarusidestrconsts.liscmplstinheritance
|
||
msgid "Inheritance"
|
||
msgstr "Успадкування"
|
||
|
||
#: lazarusidestrconsts.liscmplstlist
|
||
msgid "List"
|
||
msgstr "Список"
|
||
|
||
#: lazarusidestrconsts.liscmplstpalette
|
||
msgid "Palette"
|
||
msgstr "Палітра"
|
||
|
||
#: lazarusidestrconsts.liscmppages
|
||
msgid "Pages"
|
||
msgstr "Сторінки"
|
||
|
||
#: lazarusidestrconsts.liscmppalettevisible
|
||
msgid "Palette is &visible"
|
||
msgstr "Палітра &видима"
|
||
|
||
#: lazarusidestrconsts.liscmprestoredefaults
|
||
msgid "&Restore defaults"
|
||
msgstr "&Відновити типові"
|
||
|
||
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
||
msgid "Ambiguous additional compiler config file"
|
||
msgstr "Знайдено двозначний файл налаштування компілятора"
|
||
|
||
#: lazarusidestrconsts.liscocallon
|
||
msgid "Call on:"
|
||
msgstr "Виклик:"
|
||
|
||
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
||
msgid "%s%sClick OK if you definitely want to do that."
|
||
msgstr "%s%sКлацніть ОК, якщо справді впевнені."
|
||
|
||
#: lazarusidestrconsts.liscocommand
|
||
msgctxt "lazarusidestrconsts.liscocommand"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: lazarusidestrconsts.liscode
|
||
msgid "Code"
|
||
msgstr "Код"
|
||
|
||
#: lazarusidestrconsts.liscodebrowser
|
||
msgctxt "lazarusidestrconsts.liscodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Браузер коду"
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialogcaption
|
||
msgid "Code creation options"
|
||
msgstr "Параметри створення коду"
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
||
msgid "Class section"
|
||
msgstr "Розділ класу"
|
||
|
||
#: lazarusidestrconsts.liscodecreationdialoglocation
|
||
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
||
msgid "Location"
|
||
msgstr "Розміщення"
|
||
|
||
#: lazarusidestrconsts.liscodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Провідник Коду"
|
||
|
||
#: lazarusidestrconsts.liscodegenerationoptions
|
||
msgid "Code generation options"
|
||
msgstr "Параметри генерування коду"
|
||
|
||
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
||
msgid "Add path"
|
||
msgstr "Додати шлях"
|
||
|
||
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
||
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
||
msgid "Browse"
|
||
msgstr "Огляд"
|
||
|
||
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
||
msgid "Confirm replace"
|
||
msgstr "Підтвердити заміну"
|
||
|
||
#: lazarusidestrconsts.liscodehelpcreatebutton
|
||
msgid "Create help item"
|
||
msgstr "Створити елемент довідки"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
||
msgid "Remove path"
|
||
msgstr "Видалити шлях"
|
||
|
||
#: lazarusidestrconsts.liscodehelpdescrtag
|
||
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
|
||
msgid "Description"
|
||
msgstr "Опис"
|
||
|
||
#: lazarusidestrconsts.liscodehelperrorstag
|
||
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
||
msgid "Errors"
|
||
msgstr "Помилки"
|
||
|
||
#: lazarusidestrconsts.liscodehelpexampletag
|
||
msgid "Example"
|
||
msgstr "Приклад"
|
||
|
||
#: lazarusidestrconsts.liscodehelpgroupbox
|
||
msgid "FPDoc settings"
|
||
msgstr "Параметри FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintboldformat
|
||
msgid "Insert bold formatting tag"
|
||
msgstr "Вставити тег жирності тексту"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
||
msgid "Insert code formatting tag"
|
||
msgstr "Вставити тег форматування тексту програми"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintitalicformat
|
||
msgid "Insert italic formatting tag"
|
||
msgstr "Вставити тег форматування курсивом"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintremarktag
|
||
msgid "Insert remark formatting tag"
|
||
msgstr "Вставити тег ремарок"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
||
msgid "Insert underline formatting tag"
|
||
msgstr "Вставити тег форматування підкресленням"
|
||
|
||
#: lazarusidestrconsts.liscodehelphintvartag
|
||
msgid "Insert var formatting tag"
|
||
msgstr "Вставити тег форматування для змінних"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinherited
|
||
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
||
msgid "Inherited"
|
||
msgstr "Наслідуваний"
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertalink
|
||
msgid "Insert a link ..."
|
||
msgstr "Вставити посилання ..."
|
||
|
||
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
||
msgid "Insert paragraph formatting tag"
|
||
msgstr "Вставити тег абзацу"
|
||
|
||
#: lazarusidestrconsts.liscodehelpmainformcaption
|
||
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Редактор FPDoc"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
||
msgid "(no inherited description found)"
|
||
msgstr "(не знайдено успадкованого опису)"
|
||
|
||
#: lazarusidestrconsts.liscodehelpnotagcaption
|
||
msgid "<NONE>"
|
||
msgstr "<НІЧОГО>"
|
||
|
||
#: lazarusidestrconsts.liscodehelpseealsotag
|
||
msgid "See also"
|
||
msgstr "Дивись також"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
||
msgid "Short description of"
|
||
msgstr "Короткий опис для"
|
||
|
||
#: lazarusidestrconsts.liscodehelpshorttag
|
||
msgid "Short"
|
||
msgstr "Короткий"
|
||
|
||
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
||
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
|
||
msgid "Ignore constants in next functions"
|
||
msgstr "Ігнорувати константи у наступних функціях"
|
||
|
||
#: lazarusidestrconsts.liscodeobscharconst
|
||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||
msgid "Search for unnamed char constants"
|
||
msgstr "Шукати неіменовані константи-символи"
|
||
|
||
#: lazarusidestrconsts.liscodeobserver
|
||
msgid "Code Observer"
|
||
msgstr "Оглядач Коду"
|
||
|
||
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
||
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
|
||
msgid "Ignore next unnamed constants"
|
||
msgstr "Знехтувати наступні неіменовані константи"
|
||
|
||
#: lazarusidestrconsts.liscodetempladd
|
||
msgctxt "lazarusidestrconsts.liscodetempladd"
|
||
msgid "Add template"
|
||
msgstr "Додати шаблон"
|
||
|
||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||
msgid "Add code template"
|
||
msgstr "Додати шаблон коду"
|
||
|
||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||
msgid " A token \"%s\" already exists! "
|
||
msgstr "Елемент \"%s\" вже існує! "
|
||
|
||
#: lazarusidestrconsts.liscodetemplautocompleteon
|
||
msgid "Auto complete on"
|
||
msgstr "Автозавершення при"
|
||
|
||
#: lazarusidestrconsts.liscodetemplchange
|
||
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
||
msgid "Change"
|
||
msgstr "Змінити"
|
||
|
||
#: lazarusidestrconsts.liscodetemplcomment
|
||
msgid "Comment:"
|
||
msgstr "Коментар:"
|
||
|
||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||
msgid "Edit code template"
|
||
msgstr "Редагувати шаблони коду"
|
||
|
||
#: lazarusidestrconsts.liscodetemplerror
|
||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.liscodetempltoken
|
||
msgid "Token:"
|
||
msgstr "Елемент:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsaction
|
||
msgid "Action: %s"
|
||
msgstr "Дія: %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
||
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
||
msgstr "Автостворені елементи не можуть ані редагуватись,%s ані вміщувати не автостворені дочірні елементи"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
||
msgid "%s, auto generated"
|
||
msgstr "%s, автоматично створене"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
||
msgid "Auto generated nodes cannot be edited."
|
||
msgstr "Автостворені вузли не можуть редагуватись."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsblock
|
||
msgid "Block"
|
||
msgstr "Заблокувати"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor"
|
||
msgstr "Редактор визначень CodeTools"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
||
msgid "Compiler path"
|
||
msgstr "Шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
||
msgid "Convert node"
|
||
msgstr "Перетворити вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
||
msgid "Create Defines for %s Directory"
|
||
msgstr "Створити означення для %s Теки"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
||
msgid "Create Defines for Free Pascal Compiler"
|
||
msgstr "Створити визначення для компілятора Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
||
msgid "Create Defines for Free Pascal SVN Sources"
|
||
msgstr "Створити визначення для текстів програми Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
||
msgid "Create Defines for %s Project"
|
||
msgstr "Створити означення для %s Проекту"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
||
msgid "Create FPC Macros and paths for a fpc project directory"
|
||
msgstr "Створити макроси FPC і шляхи до тек проекту FPC"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
||
msgid "Define"
|
||
msgstr "Визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
||
msgid "Define Recurse"
|
||
msgstr "Визначає рекурсивно"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
||
msgid "Delete node"
|
||
msgstr "Видалити вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s, %sде Borland встановив всі коди %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив всі сирці %s,%sвикористані проектом %s.%sНаприклад: C:/Programme/Borland/Delphi%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
||
msgid "Description:"
|
||
msgstr "Опис:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
||
msgid "%s directory"
|
||
msgstr "тека %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselse
|
||
msgid "Else"
|
||
msgstr "Інакше"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefselseif
|
||
msgid "ElseIf"
|
||
msgstr "ElseIf"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
||
msgid "Exit without Save"
|
||
msgstr "Вихід без збереження"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
||
msgid "FPC SVN source directory"
|
||
msgstr "Тека програм FPC SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsif
|
||
msgid "If"
|
||
msgstr "If"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
||
msgid "IfDef"
|
||
msgstr "IfDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
||
msgid "IfNDef"
|
||
msgstr "IfNDef"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
||
msgid "Directory"
|
||
msgstr "Тека"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
||
msgid "Insert Delphi 5 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
||
msgid "Insert Delphi 5 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
||
msgid "Insert Delphi 5 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 5"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
||
msgid "Insert Delphi 6 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
||
msgid "Insert Delphi 6 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
||
msgid "Insert Delphi 6 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 6"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
||
msgid "Insert Delphi 7 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
||
msgid "Insert Delphi 7 Directory Template"
|
||
msgstr "Вставити шаблон з теки Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
||
msgid "Insert Delphi 7 Project Template"
|
||
msgstr "Вставити шаблон проекту Delphi 7"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
||
msgid "Insert Free Pascal Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
||
msgid "Insert Free Pascal Project Template"
|
||
msgstr "Вставити шаблон проекту Free Pascal"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
||
msgid "Insert Free Pascal SVN Source Template"
|
||
msgstr "Вставте шаблон Free Pascal SVN"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
||
msgid "Insert Kylix 3 Compiler Template"
|
||
msgstr "Вставити шаблон компілятора Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
||
msgid "Insert Kylix 3 Directory Template"
|
||
msgstr "Вставити шаблон з теки Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
||
msgid "Insert Kylix 3 Project Template"
|
||
msgstr "Вставити шаблон проекту Kylix 3"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
||
msgid "Insert node as child"
|
||
msgstr "Вставити вузол як дочірній"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
||
msgid "Insert node below"
|
||
msgstr "Вставити вузол нижче"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
||
msgid "Insert Template"
|
||
msgstr "Вставити шаблон"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
||
msgid "Invalid parent"
|
||
msgstr "Неправильний предок"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
||
msgid "Invalid parent node"
|
||
msgstr "Неправильний вузол-предок"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
||
msgid "Invalid previous node"
|
||
msgstr "Неправильний попередній вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив всі %s коди.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
||
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
||
msgstr "Головна тека %s,%sде Borland встановив %s коди,%sякі використовують цей %s проект.%sНаприклад: /home/user/kylix%s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
||
msgid "Move node down"
|
||
msgstr "Пересунути вузол вниз"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
||
msgid "Move node one level down"
|
||
msgstr "Пересунути вузол на один рівень нижче"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
||
msgid "Move node one level up"
|
||
msgstr "Пересунути вузол на один рівень вище"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
||
msgid "Move node up"
|
||
msgstr "Пересунути вузол вгору"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsname
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
||
msgid "NewNode"
|
||
msgstr "Новий вузол"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
||
msgid "Node is readonly"
|
||
msgstr "Вузол лише для читання"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
||
msgid "none selected"
|
||
msgstr "нічого не вибрано"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
||
msgid "Parent node cannot contain child nodes."
|
||
msgstr "Вузол-предок не може вміщувати дочірніх вузлів."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
||
msgid "Previous node can not contain child nodes."
|
||
msgstr "Попередній вузол не може вміщувати дочірніх вузлів."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
||
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Тека проекту"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
||
msgid "%s project directory"
|
||
msgstr "Тека проекту %s"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
||
msgid "Read error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
||
msgid "Save and Exit"
|
||
msgstr "Зберегти і вийти"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
||
msgid "Selected Node:"
|
||
msgstr "Вибраний вузол:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
||
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
||
msgstr "Тека сирців Free Pascal SVN. Не обов'язково. Це покращить пошук оголошень при зневаджуванні."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
||
msgid "The Free Pascal project directory."
|
||
msgstr "Тека проекту Free Pascal."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
||
msgid "The Free Pascal SVN source directory."
|
||
msgstr "Тека текстів Free Pascal SVN."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
||
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
msgstr "Шлях до компілятора Free Pascal.%s Наприклад, %s/usr/bin%s -n%s або %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
||
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
||
msgstr "Шлях до компілятора проекту Free Pascal. Потрібно лише, якщо Ви встановлюєте нижче програму FPC SVN. Використовується для автостворювання макросів."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
||
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
||
msgstr "Шлях до компілятора Free Pascal для цього джерела.%sВикористаний для автостворення макросів."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
||
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
||
msgstr "Тека %s проекту,%sщо вміщує файли .dpr, dpk."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
||
msgid "Undefine"
|
||
msgstr "Зняти визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
||
msgid "Undefine All"
|
||
msgstr "Зняти визначення зі всіх"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
||
msgid "Undefine Recurse"
|
||
msgstr "Рекурсивно зняти визначення"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
||
msgid "Value as File Paths"
|
||
msgstr "Значення як шляхи до файлів"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
||
msgid "Value as Text"
|
||
msgstr "Значення як текст"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
||
msgid "%s:%svalue \"%s\" is invalid."
|
||
msgstr "%s:%sзначення \"%s\" є неправильним."
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
||
msgid "Variable:"
|
||
msgstr "Змінна:"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
||
msgid "Write error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsat
|
||
msgid "At"
|
||
msgstr "Біля"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
||
msgid "Bracket"
|
||
msgstr "Дужка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscaret
|
||
msgid "Caret (^)"
|
||
msgstr "Знак ^"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscolon
|
||
msgid "Colon"
|
||
msgstr "Колонка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptscomma
|
||
msgid "Comma"
|
||
msgstr "Кома"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
||
msgid "Keyword"
|
||
msgstr "Ключове слово"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
||
msgid "Newline"
|
||
msgstr "Новий рядок"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnone
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
||
msgid "None"
|
||
msgstr "Відсутнє"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
||
msgid "Number"
|
||
msgstr "Номер"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptspoint
|
||
msgid "Point"
|
||
msgstr "Крапка"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
||
msgid "Semicolon"
|
||
msgstr "Крапка з комою"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsspace
|
||
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
||
msgid "Space"
|
||
msgstr "Пробіл"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
||
msgid "String constant"
|
||
msgstr "Рядкова константа"
|
||
|
||
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
||
msgid "Symbol"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts.liscoexecuteafter
|
||
msgid "Execute after"
|
||
msgstr "Виконати після"
|
||
|
||
#: lazarusidestrconsts.liscoexecutebefore
|
||
msgid "Execute before"
|
||
msgstr "Виконати перед"
|
||
|
||
#: lazarusidestrconsts.liscoladdress
|
||
msgid "Address"
|
||
msgstr "Адреса"
|
||
|
||
#: lazarusidestrconsts.liscolclass
|
||
msgid "Class"
|
||
msgstr "Клас"
|
||
|
||
#: lazarusidestrconsts.liscollapseall
|
||
msgid "Collapse All (/)"
|
||
msgstr "Згорнути все (/)"
|
||
|
||
#: lazarusidestrconsts.liscollapseallclasses
|
||
msgid "Collapse all classes"
|
||
msgstr "Колапс всіх класів"
|
||
|
||
#: lazarusidestrconsts.liscollapseallpackages
|
||
msgid "Collapse all packages"
|
||
msgstr "Згорнути всі пакунки"
|
||
|
||
#: lazarusidestrconsts.liscollapseallunits
|
||
msgid "Collapse all units"
|
||
msgstr "Колапс всіх модулів"
|
||
|
||
#: lazarusidestrconsts.liscolreturns
|
||
msgid "Returns"
|
||
msgstr "Повертає"
|
||
|
||
#: lazarusidestrconsts.liscolvisibility
|
||
msgid "Visibility"
|
||
msgstr "Видимість"
|
||
|
||
#: lazarusidestrconsts.liscommandafter
|
||
msgid "Command after"
|
||
msgstr "Команда після"
|
||
|
||
#: lazarusidestrconsts.liscommandafterinvalid
|
||
msgid "Command after invalid"
|
||
msgstr "Некоректна команда \"після\" "
|
||
|
||
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
||
msgid "Command after publishing module"
|
||
msgstr "Команда після установки модуля"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparameters
|
||
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
||
msgid "Command line parameters"
|
||
msgstr "Параметри командного рядка"
|
||
|
||
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
||
msgid "Command line parameters of program"
|
||
msgstr "Параметри командного рядка програми"
|
||
|
||
#: lazarusidestrconsts.liscompile
|
||
msgctxt "lazarusidestrconsts.liscompile"
|
||
msgid "Compile"
|
||
msgstr "Компілювати"
|
||
|
||
#: lazarusidestrconsts.liscompileproject
|
||
msgid "Compile Project"
|
||
msgstr "Скомпілювати проект"
|
||
|
||
#: lazarusidestrconsts.liscompiler
|
||
msgid "Compiler"
|
||
msgstr "Компілятор"
|
||
|
||
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
||
msgid "Compiler \"%s\" does not support target %s-%s"
|
||
msgstr "Компілятор \"%s\" не підтримує ціль %s-%s"
|
||
|
||
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
||
msgid "Error: invalid compiler: %s"
|
||
msgstr "Помилка: неправильний компілятор:%s"
|
||
|
||
#: lazarusidestrconsts.liscompilerfilename
|
||
msgid "Compiler filename"
|
||
msgstr "Назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
||
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
||
msgstr "Довідка: Ви можете задати шлях до компілятора в Інструменти->Параметри->Файли->Шлях до компілятора"
|
||
|
||
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
||
msgid "Compiler messages file not found:%s%s"
|
||
msgstr "Не знайдено файл повідомлень компілятора:%s%s"
|
||
|
||
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
||
msgid "NOTE: codetools config file not found - using defaults"
|
||
msgstr "ЗАУВАЖЕННЯ: не знайдено файлу конфігурації для codetools - використовуємо типову"
|
||
|
||
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
||
msgid "NOTE: loading old codetools options file: "
|
||
msgstr "ЗАУВАЖЕННЯ: завантажується старий файл з налаштуваннями codetools:"
|
||
|
||
#: lazarusidestrconsts.liscompilestage
|
||
msgctxt "lazarusidestrconsts.liscompilestage"
|
||
msgid "Compile"
|
||
msgstr "Компілювати"
|
||
|
||
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
||
msgid "Compile with -vd for more details. Check for duplicates."
|
||
msgstr "Для деталізації компілювати з -vd. Перевірка дублів."
|
||
|
||
#: lazarusidestrconsts.liscompiling
|
||
msgid "%s (compiling ...)"
|
||
msgstr "%s (компілюю ...)"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
||
msgid "Show long line hints"
|
||
msgstr "Показ довгих підказок"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
||
msgid "Extend far left"
|
||
msgstr "Подовжувати далеко вліво"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
||
msgid "Extend some left"
|
||
msgstr "Подовжувати трохи вліво"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
||
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
||
msgid "Never"
|
||
msgstr "Ніколи"
|
||
|
||
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
||
msgid "Extend right only"
|
||
msgstr "Подовжувати лише вправо"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
||
msgid "Component name \"%s\" is a Pascal keyword."
|
||
msgstr "Назва компонента \"%s\" є ключовим словом Pascal."
|
||
|
||
#: lazarusidestrconsts.liscomponentnameiskeyword
|
||
msgid "Component name \"%s\" is keyword"
|
||
msgstr "Назву компонента \"%s\" зарезервовано"
|
||
|
||
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
||
msgid "Component name \"%s\" is not a valid identifier"
|
||
msgstr "Назва компонента \"%s\" є некоректним ідентифікатором"
|
||
|
||
#: lazarusidestrconsts.liscomppalcomponentlist
|
||
msgid "View All"
|
||
msgstr "Дивитись все"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenpackage
|
||
msgid "Open package"
|
||
msgstr "Відкриття пакунка"
|
||
|
||
#: lazarusidestrconsts.liscomppalopenunit
|
||
msgid "Open unit"
|
||
msgstr "Відкрити модуль"
|
||
|
||
#: lazarusidestrconsts.liscomptest
|
||
msgctxt "lazarusidestrconsts.liscomptest"
|
||
msgid "&Test"
|
||
msgstr "&Тест"
|
||
|
||
#: lazarusidestrconsts.liscondition
|
||
msgid "Condition"
|
||
msgstr "Умова"
|
||
|
||
#: lazarusidestrconsts.lisconditionals
|
||
msgctxt "lazarusidestrconsts.lisconditionals"
|
||
msgid "Conditionals"
|
||
msgstr "Умовні"
|
||
|
||
#: lazarusidestrconsts.lisconfigdirectory
|
||
msgid "Lazarus config directory"
|
||
msgstr "Тека конфігурації Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisconfigfileofadditions
|
||
msgid "Config file of additions:"
|
||
msgstr "Файл налаштувань додатків:"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuild
|
||
msgid "Configure Build %s"
|
||
msgstr "Налаштувати збирання %s"
|
||
|
||
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\""
|
||
msgstr "Налаштувати \"Збирання Lazarus\""
|
||
|
||
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
||
msgid "Configure Toolbar"
|
||
msgstr "Конфігурувати панель"
|
||
|
||
#: lazarusidestrconsts.lisconfigurelazaruside
|
||
msgid "Configure Lazarus IDE"
|
||
msgstr "Налаштувати Lazarus ІСР"
|
||
|
||
#: lazarusidestrconsts.lisconfirm
|
||
msgid "Confirm"
|
||
msgstr "Підтвердити"
|
||
|
||
#: lazarusidestrconsts.lisconfirmation
|
||
msgid "Confirmation"
|
||
msgstr "Підтвердження"
|
||
|
||
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
||
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
||
msgstr "Lazarus буде перезібраний з наступним профілем:%sПродовжити?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmchanges
|
||
msgid "Confirm changes"
|
||
msgstr "Підтвердити зміни"
|
||
|
||
#: lazarusidestrconsts.lisconfirmdelete
|
||
msgid "Confirm delete"
|
||
msgstr "Підтвердити видалення"
|
||
|
||
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
||
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
||
msgstr "Перебудувати Lazarus з профілем: %s ?"
|
||
|
||
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
||
msgid "Confirm new package set for the IDE"
|
||
msgstr "Підтвердьте новий набір пакунків для ІСР"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageaction
|
||
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
||
msgid "Action"
|
||
msgstr "Дія"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
||
msgid "New package set"
|
||
msgstr "Новий набір пакунків"
|
||
|
||
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
||
msgid "Old package set"
|
||
msgstr "Старий набір пакунків"
|
||
|
||
#: lazarusidestrconsts.lisconflict
|
||
msgid "Conflict"
|
||
msgstr "Конфлікт"
|
||
|
||
#: lazarusidestrconsts.lisconflictdetected
|
||
msgid "Conflict detected"
|
||
msgstr "Виявлено конфлікт"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplication
|
||
msgid "Console application"
|
||
msgstr "Консольний застосунок"
|
||
|
||
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
||
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
||
msgstr "Консольна програма Free Pascal, що використовує TCustomApplication для спрощення перевірки параметрів командного рядка, обробки винятків тощо."
|
||
|
||
#: lazarusidestrconsts.lisconstructorcode
|
||
msgid "Constructor code"
|
||
msgstr "Код конструктора"
|
||
|
||
#: lazarusidestrconsts.liscontains
|
||
msgid "contains"
|
||
msgstr "вміщує"
|
||
|
||
#: lazarusidestrconsts.liscontextsensitive
|
||
msgid "Context sensitive"
|
||
msgstr "З врахуванням контексту"
|
||
|
||
#: lazarusidestrconsts.liscontinue
|
||
msgctxt "lazarusidestrconsts.liscontinue"
|
||
msgid "Continue"
|
||
msgstr "Продовжити"
|
||
|
||
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
||
msgid "Continue and do not ask again"
|
||
msgstr "Продовжити і не питати знов"
|
||
|
||
#: lazarusidestrconsts.liscontinuebuilding
|
||
msgid "Continue building"
|
||
msgstr "Продовжити збирання"
|
||
|
||
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
||
msgid "Continue without loading form"
|
||
msgstr "Продовжити без завантаження форми"
|
||
|
||
#: lazarusidestrconsts.liscontributors
|
||
msgid "Contributors"
|
||
msgstr "Учасники"
|
||
|
||
#: lazarusidestrconsts.liscontrolneedsparent
|
||
msgid "Control needs parent"
|
||
msgstr "Елемент управління вимагає \"предка\""
|
||
|
||
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
||
msgid "Add comment after replacement"
|
||
msgstr "Після заміни додати коментар"
|
||
|
||
#: lazarusidestrconsts.lisconvaddingflagforregister
|
||
msgid "Adding flag for \"Register\" procedure in unit %s."
|
||
msgstr "Додавання прапорця наявності у модулі %s процедури \"Register\"."
|
||
|
||
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
||
msgid "\")\" is missing from replacement function: %s"
|
||
msgstr "\")\" відсутня у функції заміни: %s"
|
||
|
||
#: lazarusidestrconsts.lisconvbracketnotfound
|
||
msgid "Bracket not found"
|
||
msgstr "Не знайдена дужка"
|
||
|
||
#: lazarusidestrconsts.lisconvconvertedfrom
|
||
msgid " { *Converted from %s* }"
|
||
msgstr " { *Перетворено з %s* }"
|
||
|
||
#: lazarusidestrconsts.lisconvcoordhint
|
||
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
||
msgstr "Зсув додається до координати Верху елементів всередині візуальних контейнерів"
|
||
|
||
#: lazarusidestrconsts.lisconvcoordoffs
|
||
msgid "Coordinate offsets"
|
||
msgstr "Зміщення координат"
|
||
|
||
#: lazarusidestrconsts.lisconvdeletedfile
|
||
msgid "Deleted file %s"
|
||
msgstr "Видалено файл %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
||
msgid "Added defines %s in custom options"
|
||
msgstr "До користувацьких параметрів додано визначення %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
||
msgid "Added Package %s as a dependency."
|
||
msgstr "Пакунок %s додано як залежність."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
||
msgid "Added unit \"%s\" to uses section."
|
||
msgstr "До розділу uses додано модуль \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
||
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
|
||
msgid "All sub-directories will be scanned for unit files"
|
||
msgstr "Всі підтеки будуть перевірятися на файли модулів"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
||
msgid "BeginCodeTools failed!"
|
||
msgstr "BeginCodeTools не вдався!"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphicategories
|
||
msgid "Categories:"
|
||
msgstr "Категорії:"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
||
msgid "Changed encoding from %s to UTF-8"
|
||
msgstr "Кодування змінено з %s на UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
||
msgid "Conversion Aborted."
|
||
msgstr "Перетворення Перервано."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversionready
|
||
msgid "Conversion Ready."
|
||
msgstr "Перетворення Готове."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
||
msgid "Conversion took: %s"
|
||
msgstr "Перетворення зайняло: %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
||
msgid "Convert Delphi package"
|
||
msgstr "Конвертувати пакунок Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
||
msgid "Convert Delphi project"
|
||
msgstr "Конвертувати проект Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
||
msgid "Convert Delphi unit"
|
||
msgstr "Конвертувати модуль Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
||
msgid "*** Converting unit files found during conversion ***"
|
||
msgstr "*** Перетворити файли модулів, знайдені під час перетворення ***"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
||
msgid "*** Converting unit files belonging to project/package ***"
|
||
msgstr "*** Перетворення файлів модулів, що належать проекту/пакунка ***"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphierror
|
||
msgid "Error=\"%s\""
|
||
msgstr "Помилка=\"%s\""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
||
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
||
msgstr "При перетворенні модуля трапився виняток. Продовжуємо з файлами форм вже перетворених модулів..."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
||
msgid "Failed converting unit"
|
||
msgstr "Помилка конвертування модуля"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
||
msgid "Failed to convert unit \"%s\""
|
||
msgstr "Помилка конвертування модуля \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
||
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
||
msgstr "Виправлений регістр символів модуля \"%s\" на \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
||
msgid "Found all unit files"
|
||
msgstr "Знайдено всі файли модулів"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphifunc
|
||
msgid "Delphi Function"
|
||
msgstr "Функція Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
||
msgid "%s(%s,%s) missing include file"
|
||
msgstr "%s(%s,%s) не знаходить файл включення"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiname
|
||
msgid "Delphi Name"
|
||
msgstr "Назва Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
||
msgid "Package name exists"
|
||
msgstr "Назва пакунка існує"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
||
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
||
msgstr "Пакунок %s необхідний, але не встановлений у Lazarus! Встановіть його пізніше."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
||
msgid "Omitted unit %s from project"
|
||
msgstr "Знехтуваний модуль %s з проекту"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
||
msgid "Removed unit \"%s\" from uses section."
|
||
msgstr "Модуль \"%s\" вилучено з розділу uses."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
||
msgid "*** Fixing used units and Repairing form files ***"
|
||
msgstr "*** Виправлення використаних модулів і ремонт файлів форм ... ***"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
||
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
|
||
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
||
msgstr "Замінений модуль \"%s\" на \"%s\" в секції uses."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
||
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
||
msgstr "Вже існує пакунок з назвою \"%s\"%sБудь ласка спочатку виберіть пакунок."
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
||
msgid "Unitname exists in LCL"
|
||
msgstr "Назва модуля є у LCL"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
||
msgid "Units to replace in %s"
|
||
msgstr "Модулі для заміни в %s"
|
||
|
||
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
||
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
||
msgstr "LCL вже містить модуль з назвою %s. Видалити локальний файл %s?"
|
||
|
||
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
||
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
||
msgstr "Файл .dproj ще не підтримується. Він використовується Delphi 2007 і новішими. Виберіть файл .dpr для проектів або .dpk для пакунків."
|
||
|
||
#: lazarusidestrconsts.lisconversionerror
|
||
msgid "Conversion error"
|
||
msgstr "Помилка перетворення"
|
||
|
||
#: lazarusidestrconsts.lisconvert
|
||
msgid "Convert"
|
||
msgstr "Конвертувати"
|
||
|
||
#: lazarusidestrconsts.lisconvertencoding
|
||
msgid "Convert Encoding"
|
||
msgstr "Конвертувати Кодування"
|
||
|
||
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
||
msgid "Convert encoding of projects/packages"
|
||
msgstr "Змінити кодування проектів/пакунків"
|
||
|
||
#: lazarusidestrconsts.lisconvertotherhint
|
||
msgid "Other options affecting the conversion"
|
||
msgstr "Інші параметри, що впливають на перетворення"
|
||
|
||
#: lazarusidestrconsts.lisconvertprojectorpackage
|
||
msgid "Convert project or package"
|
||
msgstr "Конвертувати проект або пакунок"
|
||
|
||
#: lazarusidestrconsts.lisconverttarget
|
||
msgid "Target"
|
||
msgstr "Ціль"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
||
msgid "Cross-platform"
|
||
msgstr "Кросплатформовий"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
||
msgid "Cross-platform versus Windows-only"
|
||
msgstr "Кросплатформовий, а не лише для Windows"
|
||
|
||
#: lazarusidestrconsts.lisconverttargethint
|
||
msgid "Converter adds conditional compilation to support different targets"
|
||
msgstr "Конвертер додає умовну компіляцію для підтримки різних цілей"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
||
msgid "Use the same DFM form file"
|
||
msgstr "Використовувати той самий файл DFM форми"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
||
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
||
msgstr "Той самий DFM файл для Lazarus та Delphi замість копіювання його в LFM"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
||
msgid "Support Delphi"
|
||
msgstr "Підтримувати Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
||
msgid "Use conditional compilation to support Delphi"
|
||
msgstr "Використання умовної компіляції для підтримки Delphi"
|
||
|
||
#: lazarusidestrconsts.lisconvfixedunitname
|
||
msgid "Fixed unit name from %s to %s."
|
||
msgstr "Назву модуля виправлено з %s на %s."
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplacements
|
||
msgid "Function Replacements"
|
||
msgstr "Заміни Функцій"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncreplhint
|
||
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
|
||
msgid "Some Delphi functions can be replaced with LCL function"
|
||
msgstr "Деякі функції Delphi можна замінити функцію LCL"
|
||
|
||
#: lazarusidestrconsts.lisconvfuncstoreplace
|
||
msgid "Functions / procedures to replace"
|
||
msgstr "Функції / процедури для заміни"
|
||
|
||
#: lazarusidestrconsts.lisconvleftoff
|
||
msgid "Left offset"
|
||
msgstr "Зсув зліва"
|
||
|
||
#: lazarusidestrconsts.lisconvnewname
|
||
msgid "New Name"
|
||
msgstr "Нова назва"
|
||
|
||
#: lazarusidestrconsts.lisconvparentcontainer
|
||
msgid "Parent Container"
|
||
msgstr "Батьківський Контейнер"
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
||
msgid "Problems when trying to find all units from project file %s"
|
||
msgstr "Проблеми при спробі знайти всі модулі з файлу проекту %s"
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
||
msgid "Problems when fixing include files in file %s"
|
||
msgstr "Проблеми при виправленні включеного файлу файлі %s"
|
||
|
||
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
||
msgid "Problems when repairing form file %s"
|
||
msgstr "Проблеми з відновленням файлу форми %s"
|
||
|
||
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
||
msgid "Repairing include files : "
|
||
msgstr "Відновлення включених файлів"
|
||
|
||
#: lazarusidestrconsts.lisconvreplacedcall
|
||
msgid "Replaced call %s with %s"
|
||
msgstr "Виклик %s замінено на %s"
|
||
|
||
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
||
msgid "Replacement function parameter number should be >= 1: %s"
|
||
msgstr "Число параметрів функції заміни має бути >= 1: %s"
|
||
|
||
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
||
msgid "\"$\" should be followed by a number: %s"
|
||
msgstr "Після \"$\" має бути число: %s"
|
||
|
||
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
||
msgid "Stopped because there already is a package with the same name"
|
||
msgstr "Зупинено, бо вже є пакунок з такою назвою"
|
||
|
||
#: lazarusidestrconsts.lisconvthislogwassaved
|
||
msgid "This log was saved to %s"
|
||
msgstr "Цей журнал збережено до %s"
|
||
|
||
#: lazarusidestrconsts.lisconvtopoff
|
||
msgid "Top offset"
|
||
msgstr "Зсув зверху"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplacements
|
||
msgid "Type Replacements"
|
||
msgstr "Заміни Типів"
|
||
|
||
#: lazarusidestrconsts.lisconvtypereplhint
|
||
msgid "Unknown types in form file (DFM/LFM)"
|
||
msgstr "Невідомі типи в файлі форми (DFM/LFM)"
|
||
|
||
#: lazarusidestrconsts.lisconvtypestoreplace
|
||
msgid "Types to replace"
|
||
msgstr "Замінювані типи"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplacements
|
||
msgid "Unit Replacements"
|
||
msgstr "Заміни Модулів"
|
||
|
||
#: lazarusidestrconsts.lisconvunitreplhint
|
||
msgid "Unit names in uses section of a source unit"
|
||
msgstr "Назви модулів в секції uses джерельного модуля"
|
||
|
||
#: lazarusidestrconsts.lisconvunitstoreplace
|
||
msgid "Units to replace"
|
||
msgstr "Замінювані модулі"
|
||
|
||
#: lazarusidestrconsts.lisconvunknownprops
|
||
msgid "Unknown properties"
|
||
msgstr "Невідомі властивості"
|
||
|
||
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
||
msgid "User selected to end conversion with file %s"
|
||
msgstr "Користувач вибрав завершення перетворення з файлом %s"
|
||
|
||
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
||
msgid "Add/Config/Delete Toolbar(s)"
|
||
msgstr "Додати/налаштувати/видалити панелі"
|
||
|
||
#: lazarusidestrconsts.liscoolbaradddivider
|
||
msgid "Add Divider"
|
||
msgstr "Додати роздільник"
|
||
|
||
#: lazarusidestrconsts.liscoolbaraddselected
|
||
msgid "Add selected item to toolbar"
|
||
msgstr "Додати вибраний елемент керування на панель"
|
||
|
||
#: lazarusidestrconsts.liscoolbaravailablecommands
|
||
msgid "Available commands"
|
||
msgstr "Доступні команди"
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyle
|
||
msgid "Toolbars border style"
|
||
msgstr "Стиль меж панелей"
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
||
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
||
msgid "None"
|
||
msgstr "Немає"
|
||
|
||
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
||
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
||
msgid "Single"
|
||
msgstr "Одинарний"
|
||
|
||
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
||
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Оглядач коду"
|
||
|
||
#: lazarusidestrconsts.liscoolbarcodetemplates
|
||
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
||
msgid "Code Templates"
|
||
msgstr "Шаблони коду"
|
||
|
||
#: lazarusidestrconsts.liscoolbarconfigure
|
||
msgid "&Configure"
|
||
msgstr "&Конфігурувати"
|
||
|
||
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
||
msgid "Are you sure you want to delete the selected toolbar?"
|
||
msgstr "Справді бажаєте видалити вибрану панель інструментів?"
|
||
|
||
#: lazarusidestrconsts.liscoolbardeletewarning
|
||
msgid "There must be at least one toolbar!"
|
||
msgstr "Тут має бути принаймні одна панель інструментів!"
|
||
|
||
#: lazarusidestrconsts.liscoolbardesigner
|
||
msgid "Designer"
|
||
msgstr "Дизайнер"
|
||
|
||
#: lazarusidestrconsts.liscoolbargeneralsettings
|
||
msgid "General Coolbar Settings"
|
||
msgstr "Загальні параметри швидкої панелі"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyle
|
||
msgid "Toolbars grab style"
|
||
msgstr "Стиль вузла захопу"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
||
msgid "Simple"
|
||
msgstr "Просто"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
||
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
||
msgid "Double"
|
||
msgstr "Подвійний"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
||
msgid "HorLines"
|
||
msgstr "ГорЛінії"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
||
msgid "VerLines"
|
||
msgstr "ВерЛінії"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
||
msgid "Gripper"
|
||
msgstr "Затискач"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
||
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
||
msgid "Button"
|
||
msgstr "Кнопка"
|
||
|
||
#: lazarusidestrconsts.liscoolbargrabwidth
|
||
msgid "Grab width"
|
||
msgstr "Ширина захопу"
|
||
|
||
#: lazarusidestrconsts.liscoolbaridemainmenu
|
||
msgid "IDE Main Menu"
|
||
msgstr "Головне меню ІСР"
|
||
|
||
#: lazarusidestrconsts.liscoolbarmessages
|
||
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
||
msgid "Move selected toolbar item down"
|
||
msgstr "Пересунути вибраний елемент панелі донизу"
|
||
|
||
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
||
msgid "Move selected toolbar item up"
|
||
msgstr "Пересунути вибраний елемент панелі догори"
|
||
|
||
#: lazarusidestrconsts.liscoolbaroptions
|
||
msgid "IDE CoolBar"
|
||
msgstr "Швидка панель ІСР"
|
||
|
||
#: lazarusidestrconsts.liscoolbarpackageeditor
|
||
msgid "Package Editor"
|
||
msgstr "Редактор пакунків"
|
||
|
||
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
||
msgid "Package Editor Files"
|
||
msgstr "Файли редактора пакунків"
|
||
|
||
#: lazarusidestrconsts.liscoolbarremoveselected
|
||
msgid "Remove selected item from toolbar"
|
||
msgstr "Вилучити вибрані елементи з панелі"
|
||
|
||
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
||
msgid "Restore defaults"
|
||
msgstr "Відновити типові"
|
||
|
||
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
||
msgid "Please select a toolbar first!"
|
||
msgstr "Виберіть спочатку панель інструментів!"
|
||
|
||
#: lazarusidestrconsts.liscoolbarsourceeditor
|
||
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор коду"
|
||
|
||
#: lazarusidestrconsts.liscoolbarsourcetab
|
||
msgid "Source Tab"
|
||
msgstr "Вкладка редактора коду"
|
||
|
||
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
||
msgid "Toolbar commands"
|
||
msgstr "Команди панелі інструментів"
|
||
|
||
#: lazarusidestrconsts.liscoolbarvisible
|
||
msgid "Coolbar is &visible"
|
||
msgstr "Швидка панель &видима"
|
||
|
||
#: lazarusidestrconsts.liscoolbarwidth
|
||
msgid "Coolbar width"
|
||
msgstr "Ширина швидкої панелі"
|
||
|
||
#: lazarusidestrconsts.liscopy
|
||
msgctxt "lazarusidestrconsts.liscopy"
|
||
msgid "Copy"
|
||
msgstr "Копіювати"
|
||
|
||
#: lazarusidestrconsts.liscopyall
|
||
msgid "Copy All"
|
||
msgstr "Копіювати Все"
|
||
|
||
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
||
msgid "Copy All Items to Clipboard"
|
||
msgstr "Копіювати всі елементи в буфер"
|
||
|
||
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
||
msgid "Copy All/Original Messages to Clipboard"
|
||
msgstr "Копіювати всі/початкові повідомлення до буфера обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyalloutputclipboard
|
||
msgid "Copy all output to clipboard"
|
||
msgstr "Копіювати весь вихід в буфер"
|
||
|
||
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
||
msgid "Copy All Shown Messages to Clipboard"
|
||
msgstr "Копіювати всі Видимі повідомлення в буфер"
|
||
|
||
#: lazarusidestrconsts.liscopydescription
|
||
msgid "Copy description to clipboard"
|
||
msgstr "Копіювати опис в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyerror
|
||
msgid "Copy Error"
|
||
msgstr "Помилка при копіюванні"
|
||
|
||
#: lazarusidestrconsts.liscopyerror2
|
||
msgid "Copy error"
|
||
msgstr "Помилка копіювання"
|
||
|
||
#: lazarusidestrconsts.liscopyfilename
|
||
msgid "Copy Filename %s"
|
||
msgstr "Копіювати назву файлу %s"
|
||
|
||
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
||
msgid "Copy File Name to Clipboard"
|
||
msgstr "Копіювати назву файлу до буфера обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyidentifier
|
||
msgid "Copy \"%s\" to clipboard"
|
||
msgstr "Копіювати \"%s\" до буфера обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
||
msgid "Copying a whole form is not implemented."
|
||
msgstr "Копіювання всієї форми не реалізоване."
|
||
|
||
#: lazarusidestrconsts.liscopyitemtoclipboard
|
||
msgid "Copy Item to Clipboard"
|
||
msgstr "Копіювати елемент в буфер"
|
||
|
||
#: lazarusidestrconsts.liscopymovefiletodirectory
|
||
msgid "Copy/Move File to Directory"
|
||
msgstr "Копіювати/перемістити файл до теки"
|
||
|
||
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
||
msgid "Copy Selected Items to Clipboard"
|
||
msgstr "Копіювати вибрані елементи в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
||
msgid "Copy Selected Messages to Clipboard"
|
||
msgstr "Копіювати вибрані повідомлення в буфер"
|
||
|
||
#: lazarusidestrconsts.liscoscanforfpcmessages
|
||
msgid "Scan for FPC messages"
|
||
msgstr "Пошук повідомлень FPC"
|
||
|
||
#: lazarusidestrconsts.liscoscanformakemessages
|
||
msgid "Scan for Make messages"
|
||
msgstr "Пошук повідомлень Make"
|
||
|
||
#: lazarusidestrconsts.liscoscanformessages
|
||
msgid "Scan for messages:"
|
||
msgstr "Перевіряти повідомлення:"
|
||
|
||
#: lazarusidestrconsts.liscoskipcallingcompiler
|
||
msgid "Skip calling compiler"
|
||
msgstr "Пропустити виклик компілятора"
|
||
|
||
#: lazarusidestrconsts.liscouldnotadditomainsource
|
||
msgid "Could not add \"{$I %s}\" to main source!"
|
||
msgstr "Неможливо додати \"{$I %s}\" до основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
||
msgid "Could not add \"{$R %s}\" to main source!"
|
||
msgstr "Неможливо додати \"{$R %s}\" до основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
||
msgid "Could not add \"%s\" to main source!"
|
||
msgstr "Неможливо додати \"%s\" до основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
||
msgid "Could not remove \"%s\" from main source!"
|
||
msgstr "Неможливо видалити \"%s\" з основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
||
msgid "Could not remove \"{$I %s}\" from main source!"
|
||
msgstr "Неможливо вилучити \"{$I %s}\" з основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
||
msgid "Could not remove \"{$R %s}\" from main source!"
|
||
msgstr "Неможливо вилучити \"{$R %s}\" з основного сирцевого файлу!"
|
||
|
||
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
||
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
||
msgstr "Увага: додатковий файл налаштувань компілятора має ту ж саму назву, як може називатись один із стандартних файлів налаштувань компілятора Free Pascal. Це призведе до використання додаткового файлу і пропуску стандартного."
|
||
|
||
#: lazarusidestrconsts.liscpopenpackage
|
||
msgid "Open Package %s"
|
||
msgstr "Відкрити пакунок %s"
|
||
|
||
#: lazarusidestrconsts.liscpopenunit
|
||
msgid "Open Unit %s"
|
||
msgstr "Відкрити Модуль %s"
|
||
|
||
#: lazarusidestrconsts.liscpu
|
||
msgid ", CPU: %s"
|
||
msgstr ", ЦП: %s"
|
||
|
||
#: lazarusidestrconsts.liscreateaprojectfirst
|
||
msgid "Create a project first!"
|
||
msgstr "Спочатку створіть проект!"
|
||
|
||
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
||
msgid "Create Debug and Release modes"
|
||
msgstr "Створити режими Debug і Release"
|
||
|
||
#: lazarusidestrconsts.liscreatedirectory
|
||
msgid "Create directory?"
|
||
msgstr "Створити теку?"
|
||
|
||
#: lazarusidestrconsts.liscreatefilter
|
||
msgid "Create Filter"
|
||
msgstr "Створити фільтр"
|
||
|
||
#: lazarusidestrconsts.liscreatefunction
|
||
msgid "Create function"
|
||
msgstr "Створити функцію"
|
||
|
||
#: lazarusidestrconsts.liscreatehelpnode
|
||
msgid "Create Help node"
|
||
msgstr "Створити вузол Довідки"
|
||
|
||
#: lazarusidestrconsts.liscreateit
|
||
msgid "Create it"
|
||
msgstr "Створити його"
|
||
|
||
#: lazarusidestrconsts.liscreatelocalvariable
|
||
msgid "Create local variable \"%s\""
|
||
msgstr "Створити локальну змінну \"%s\""
|
||
|
||
#: lazarusidestrconsts.liscreatenewaddition
|
||
msgid "Create new addition"
|
||
msgstr "Створити новий додаток"
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackage
|
||
msgid "(Create new package)"
|
||
msgstr "(Створити новий пакунок)"
|
||
|
||
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
||
msgid "Create new package component"
|
||
msgstr "Створити новий компонент пакунка"
|
||
|
||
#: lazarusidestrconsts.liscreateproject
|
||
msgid "Create project"
|
||
msgstr "Створити проект"
|
||
|
||
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
||
msgid "Create/update .po file when saving a lfm file"
|
||
msgstr "Створити/оновити .po файл при збереженні lfm файлу"
|
||
|
||
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
||
msgid "Creating file index of FPC sources %s ..."
|
||
msgstr "Створення файлового індексу джерел FPC %s ..."
|
||
|
||
#: lazarusidestrconsts.liscsbottom
|
||
msgctxt "lazarusidestrconsts.liscsbottom"
|
||
msgid "Bottom"
|
||
msgstr "Нижній"
|
||
|
||
#: lazarusidestrconsts.liscstop
|
||
msgctxt "lazarusidestrconsts.liscstop"
|
||
msgid "Top"
|
||
msgstr "Верхній"
|
||
|
||
#: lazarusidestrconsts.lisctdefchoosedirectory
|
||
msgid "Choose Directory"
|
||
msgstr "Виберіть теку"
|
||
|
||
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
||
msgid "CodeTools Directory Values"
|
||
msgstr "Параметри тек Інструментів Коду"
|
||
|
||
#: lazarusidestrconsts.lisctdefdefinetemplates
|
||
msgid "Define templates"
|
||
msgstr "Визначення шаблонів"
|
||
|
||
#: lazarusidestrconsts.lisctdefnovariableselected
|
||
msgid "<no variable selected>"
|
||
msgstr "<Не вибрано змінних>"
|
||
|
||
#: lazarusidestrconsts.lisctdefsopenpreview
|
||
msgid "Open Preview"
|
||
msgstr "Відкрити попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.lisctdefstools
|
||
msgid "Tools"
|
||
msgstr "Інструменти"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariable
|
||
msgid "Variable: %s"
|
||
msgstr "Змінна: %s"
|
||
|
||
#: lazarusidestrconsts.lisctdefvariablename
|
||
msgid "Variable Name"
|
||
msgstr "Назва змінної"
|
||
|
||
#: lazarusidestrconsts.lisctdtemplates
|
||
msgid "Templates"
|
||
msgstr "Шаблони"
|
||
|
||
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
||
msgid "Update all method signatures"
|
||
msgstr "Оновити всі сигнатури методів"
|
||
|
||
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
||
msgid "Update multiple procedure signatures"
|
||
msgstr "Оновлювати все підхожі сигнатури процедур"
|
||
|
||
#: lazarusidestrconsts.lisctpleaseselectamacro
|
||
msgid "please select a macro"
|
||
msgstr "виберіть будь-ласка макрос"
|
||
|
||
#: lazarusidestrconsts.lisctselectcodemacro
|
||
msgid "Select Code Macro"
|
||
msgstr "Вибрати Код Макросу"
|
||
|
||
#: lazarusidestrconsts.liscurrent
|
||
msgctxt "lazarusidestrconsts.liscurrent"
|
||
msgid "Current"
|
||
msgstr "Поточний"
|
||
|
||
#: lazarusidestrconsts.liscurrentlclwidgetset
|
||
msgid "Current LCL widgetset: \"%s\""
|
||
msgstr "Поточна бібліотека віджетів LCL: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liscurrentstate
|
||
msgid "Current state: "
|
||
msgstr "Поточний стан: "
|
||
|
||
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
||
msgid "Cursor column in current editor"
|
||
msgstr "Колонка курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
||
msgid "Cursor row in current editor"
|
||
msgstr "Рядок курсора в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.liscustomopthint
|
||
msgid "These options are passed to the compiler after macros are replaced."
|
||
msgstr "Ці параметри передаються у компілятор після заміни макросів."
|
||
|
||
#: lazarusidestrconsts.liscustomoptions
|
||
msgid "custom options"
|
||
msgstr "параметри користувача"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions2
|
||
msgid "Custom options"
|
||
msgstr "Спеціальні параметри"
|
||
|
||
#: lazarusidestrconsts.liscustomoptions3
|
||
msgid "Custom Options"
|
||
msgstr "Власні параметри"
|
||
|
||
#: lazarusidestrconsts.liscustomprogram
|
||
msgid "Custom Program"
|
||
msgstr "Спеціальна програма"
|
||
|
||
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
||
msgid "A Custom Free Pascal program."
|
||
msgstr "Власна програма на Free Pascal."
|
||
|
||
#: lazarusidestrconsts.liscut
|
||
msgctxt "lazarusidestrconsts.liscut"
|
||
msgid "Cut"
|
||
msgstr "Вирізати"
|
||
|
||
#: lazarusidestrconsts.lisdadattach
|
||
msgid "Attach"
|
||
msgstr "Приєднати"
|
||
|
||
#: lazarusidestrconsts.lisdadimagename
|
||
msgid "Image Name"
|
||
msgstr "Назва зображення"
|
||
|
||
#: lazarusidestrconsts.lisdadpid
|
||
msgid "PID"
|
||
msgstr "Ідентифікатор процесу"
|
||
|
||
#: lazarusidestrconsts.lisdadrunningprocesses
|
||
msgid "Running Processes"
|
||
msgstr "Запущені процеси"
|
||
|
||
#: lazarusidestrconsts.lisdatamodule
|
||
msgid "Data Module"
|
||
msgstr "Модуль Даних"
|
||
|
||
#: lazarusidestrconsts.lisdate
|
||
msgid "Date"
|
||
msgstr "Дата"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdelete
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
||
msgid "Delete all"
|
||
msgstr "Видалити все"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
||
msgid "Delete all"
|
||
msgstr "Видалити все"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
||
msgid "Disable all"
|
||
msgstr "Вимкнути все"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
||
msgid "Disable all"
|
||
msgstr "Вимкнути все"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
||
msgid "Enable all"
|
||
msgstr "Ввімкнути все"
|
||
|
||
#: lazarusidestrconsts.lisdbgallitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
||
msgid "Enable all"
|
||
msgstr "Ввімкнути все"
|
||
|
||
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
||
msgid "Copy to Clipboard"
|
||
msgstr "Копіювати в буфер"
|
||
|
||
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
||
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr "Властивості точки зупинки ..."
|
||
|
||
#: lazarusidestrconsts.lisdbgemexpression
|
||
msgid "&Expression:"
|
||
msgstr "&Вираз:"
|
||
|
||
#: lazarusidestrconsts.lisdbgemnewvalue
|
||
msgid "&New value:"
|
||
msgstr "&Нове значення:"
|
||
|
||
#: lazarusidestrconsts.lisdbgemresult
|
||
msgid "&Result:"
|
||
msgstr "&Результат:"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
||
msgid "Breakpoint Evaluation"
|
||
msgstr "Аналіз точки зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
||
msgid "Breakpoint Hit"
|
||
msgstr "Досягнення точки зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
||
msgid "Breakpoint Message"
|
||
msgstr "Повідомлення точки зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
||
msgid "Breakpoint Stack Dump"
|
||
msgstr "Дамп стеку для точки зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdbgendefaultcolor
|
||
msgid "Default Color"
|
||
msgstr "Типовий колір"
|
||
|
||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||
msgid "Exception Raised"
|
||
msgstr "Виник виняток"
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||
msgid "Module Load"
|
||
msgstr "Завантаження модуля"
|
||
|
||
#: lazarusidestrconsts.lisdbgenmoduleunload
|
||
msgid "Module Unload"
|
||
msgstr "Вивантаження модуля"
|
||
|
||
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
||
msgid "Output Debug String"
|
||
msgstr "Рядок виводу зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessexit
|
||
msgid "Process Exit"
|
||
msgstr "Завершення процесу"
|
||
|
||
#: lazarusidestrconsts.lisdbgenprocessstart
|
||
msgid "Process Start"
|
||
msgstr "Запуск процесу"
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadexit
|
||
msgid "Thread Exit"
|
||
msgstr "Завершення нитки"
|
||
|
||
#: lazarusidestrconsts.lisdbgenthreadstart
|
||
msgid "Thread Start"
|
||
msgstr "Запуск нитки"
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||
msgid "Windows Message Posted"
|
||
msgstr "Віконне повідомлення додано"
|
||
|
||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||
msgid "Windows Message Sent"
|
||
msgstr "Віконне повідомлення надіслано"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdeletehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
||
msgid "Disable"
|
||
msgstr "Вимкнути"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemdisablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
||
msgid "Disable"
|
||
msgstr "Вимкнути"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenable
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
||
msgid "Enable"
|
||
msgstr "Ввімкнути"
|
||
|
||
#: lazarusidestrconsts.lisdbgitemenablehint
|
||
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
||
msgid "Enable"
|
||
msgstr "Ввімкнути"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
||
msgid "No debugger specified"
|
||
msgstr "Зневаджувач не визначений"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
||
msgid "Set the breakpoint anyway"
|
||
msgstr "Встановити точку зупину за будь-яких обставин"
|
||
|
||
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
||
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
||
msgstr "Не вказаний зневаджувач.%sВстановлені точки зупинки не діятимуть до тих пір, поки не буде встановлено Зневаджувач у діалозі параметрів зневаджувача у меню."
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpower
|
||
msgid "On/Off"
|
||
msgstr "Увімк/Вимк"
|
||
|
||
#: lazarusidestrconsts.lisdbgwinpowerhint
|
||
msgid "Disable/Enable updates for the entire window"
|
||
msgstr "Вимкнення/Ввімкнення оновлень всього вікна"
|
||
|
||
#: lazarusidestrconsts.lisdebug
|
||
msgctxt "lazarusidestrconsts.lisdebug"
|
||
msgid "Debug"
|
||
msgstr "Зневадження"
|
||
|
||
#: lazarusidestrconsts.lisdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Зневаджувач"
|
||
|
||
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
||
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
||
msgstr "Помилка зневаджувача%sОпа! Зневаджувач знаходиться в неробочому стані%sЗбережіть роботу!%sНатисніть Стоп і сподівайтесь на краще!"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
||
msgid "Debugger Error"
|
||
msgstr "Помилка зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
||
msgid "Debugger Information"
|
||
msgstr "Інформація зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
||
msgid "Debugger Warning"
|
||
msgstr "Попередження зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebuggerinvalid
|
||
msgid "Debugger invalid"
|
||
msgstr "Неправильний зневаджувач"
|
||
|
||
#: lazarusidestrconsts.lisdebugging
|
||
msgid "%s (debugging ...)"
|
||
msgstr "%s (йде зневадження ...)"
|
||
|
||
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
||
msgid "Automatic typecast for objects"
|
||
msgstr "Автоматичне зведення типів для об'єктів"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
||
msgid "Add Exception"
|
||
msgstr "Додати виняток"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
||
msgid "Additional search path"
|
||
msgstr "Додатковий пошуковий шлях"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
||
msgid "Breakpoint"
|
||
msgstr "Точка зупину"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
||
msgid "Clear log on run"
|
||
msgstr "Очищувати журнал при виконанні"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
||
msgid "Debugger"
|
||
msgstr "Зневаджувач"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
||
msgid "Debugger general options"
|
||
msgstr "Загальні параметри зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
||
msgid "Debugger specific options (depends on type of debugger)"
|
||
msgstr "Особливі параметри зневаджувача (залежать від його типу)"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
||
msgid "Duplicate Exception name"
|
||
msgstr "Дубльована назва винятку"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
||
msgid "Enter the name of the exception"
|
||
msgstr "Введіть назву винятку"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
||
msgid "Event Log"
|
||
msgstr "Журнал подій"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
||
msgid "Handled by"
|
||
msgstr "Обробляється"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
||
msgid "Handled by Debugger"
|
||
msgstr "Обробляється зневаджувачем"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
||
msgid "Handled by Program"
|
||
msgstr "Обробляється програмою"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
||
msgid "Ignore these exceptions"
|
||
msgstr "Ігнорувати ці винятки"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
||
msgid "Language Exceptions"
|
||
msgstr "Мовні винятки"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
||
msgid "Limit line count to"
|
||
msgstr "Обмежити к-сть рядків до"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
||
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
|
||
msgid "Module"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
||
msgid "Notify on Lazarus Exceptions"
|
||
msgstr "Повідомляти про винятки Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
||
msgid "OS Exceptions"
|
||
msgstr "Винятки ОС"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
||
msgid "Output"
|
||
msgstr "Виведення"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
||
msgid "Process"
|
||
msgstr "Процес"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
||
msgid "Reset Debugger after each run"
|
||
msgstr "Скидати зневаджувач після кожного запуску"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
||
msgid "Resume"
|
||
msgstr "Відновити"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
||
msgid "Resume Handled"
|
||
msgstr "Відновити оброблені"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
||
msgid "Resume Unhandled"
|
||
msgstr "Відновити необроблені"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
||
msgid "Show message on stop"
|
||
msgstr "Показувати повідомлення зверху"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
||
msgid "Signals"
|
||
msgstr "Сигнали"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
||
msgid "Thread"
|
||
msgstr "Нитка"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
||
msgid "Use event log colors"
|
||
msgstr "Використовувати кольори журналу подій"
|
||
|
||
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
||
msgid "Windows"
|
||
msgstr "Вікна"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
||
msgid "Unable to load file"
|
||
msgstr "Неможливо завантажити файл"
|
||
|
||
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
||
msgid "Unable to load file \"%s\"."
|
||
msgstr "Неможливо завантажити файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisdecimal
|
||
msgctxt "lazarusidestrconsts.lisdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Десяткове"
|
||
|
||
#: lazarusidestrconsts.lisdefault
|
||
msgctxt "lazarusidestrconsts.lisdefault"
|
||
msgid "Default"
|
||
msgstr "Типовий"
|
||
|
||
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
||
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
||
msgstr "Типовий розділ видимості класу нового методу. Наприклад, завершення коду для OnShow:=Типовий розділ видимості класу нового методу. Наприклад, завершення коду для OnShow:="
|
||
|
||
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
||
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
||
msgstr "Типово - розкривний список з елементами \"True\" і \"False\""
|
||
|
||
#: lazarusidestrconsts.lisdefaultplaceholder
|
||
msgid "(default)"
|
||
msgstr "(типово)"
|
||
|
||
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
||
msgid "Default section of methods"
|
||
msgstr "Типовий розділ методів"
|
||
|
||
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
||
msgid "Delay for long line hints in completion box"
|
||
msgstr "Затримка виведення довгих підказок у вікні автозавершення"
|
||
|
||
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
||
msgid "Delay for hints and completion box"
|
||
msgstr "Затримка виведення підказок і вікна автозавершення"
|
||
|
||
#: lazarusidestrconsts.lisdelete
|
||
msgctxt "lazarusidestrconsts.lisdelete"
|
||
msgid "Delete"
|
||
msgstr "Вилучити"
|
||
|
||
#: lazarusidestrconsts.lisdelete2
|
||
msgid "Delete?"
|
||
msgstr "Видалити?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteaddition
|
||
msgid "Delete addition \"%s\"?"
|
||
msgstr "Видалити додаток \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteall
|
||
msgid "&Delete All"
|
||
msgstr "&Видалити всі"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
||
msgid "Delete all breakpoints?"
|
||
msgstr "Видалити всі точки зупинки?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
||
msgid "Delete all breakpoints in file \"%s\"?"
|
||
msgstr "Видалити всі точки зупинки з файлу \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallinsamesource
|
||
msgid "Delete All in same source"
|
||
msgstr "Видалити Всі в тому ж файлі початкового коду"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
||
msgid "Delete all selected breakpoints?"
|
||
msgstr "Видалити всі вибрані точки зупинки?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteallthesefiles
|
||
msgid "Delete all these files?"
|
||
msgstr "Видалити всі ці файли?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteambiguousfile
|
||
msgid "Delete ambiguous file?"
|
||
msgstr "Видалити файл з неоднозначною назвою?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpoint
|
||
msgid "Delete Breakpoint"
|
||
msgstr "Видалити точку зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointatline
|
||
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
||
msgstr "Видалити точку зупинки в%s\"%s\" рядок %d?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
||
msgid "Delete breakpoint for address %s?"
|
||
msgstr "Видалити точку зупинки для адреси %s?"
|
||
|
||
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
||
msgid "Delete watchpoint for \"%s\"?"
|
||
msgstr "Видалити точку спостереження для \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeletefilefailed
|
||
msgid "Delete file failed"
|
||
msgstr "Видалення файлу не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisdeletemacro
|
||
msgid "Delete macro \"%s\"?"
|
||
msgstr "Видалити макрос \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeletemode
|
||
msgid "Delete mode \"%s\""
|
||
msgstr "Видалити режим \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile
|
||
msgid "Delete old file \"%s\"?"
|
||
msgstr "Видалити старий файл \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteoldfile2
|
||
msgid "Delete old file?"
|
||
msgstr "Видалити старий файл?"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedfiles
|
||
msgid "Delete selected files"
|
||
msgstr "Видалити вибрані файли"
|
||
|
||
#: lazarusidestrconsts.lisdeleteselectedmacro
|
||
msgid "Delete selected macro?"
|
||
msgstr "Видалити вибраний макрос?"
|
||
|
||
#: lazarusidestrconsts.lisdeletethisaddition
|
||
msgid "Delete this addition"
|
||
msgstr "Видалити цей додаток"
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue
|
||
msgid "Delete value \"%s\"?"
|
||
msgstr "Видалити значення \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisdeletevalue2
|
||
msgid "Delete value %s"
|
||
msgstr "Видалити значення %s"
|
||
|
||
#: lazarusidestrconsts.lisdeletingoffilefailed
|
||
msgid "Deleting of file \"%s\" failed."
|
||
msgstr "Видалити файл \"%s\" не вдалося."
|
||
|
||
#: lazarusidestrconsts.lisdelimiterissemicolon
|
||
msgid "Delimiter is semicolon."
|
||
msgstr "Роздільник - крапка з комою."
|
||
|
||
#: lazarusidestrconsts.lisdelphicompatibleresources
|
||
msgid "Delphi compatible resources. Recommended."
|
||
msgstr "Сирці, сумісні з Delphi. Рекомендовано."
|
||
|
||
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
||
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
||
msgstr "Пакунки часу розробки додають компоненти і елементи меню в ІСР. Вони можуть використовуватися проектами, але не збиратися з ними. Компілятор не знайде модулів такого пакунка при збиранні проекту."
|
||
|
||
#: lazarusidestrconsts.lisdesktops
|
||
msgid "Desktops ..."
|
||
msgstr "Стільниці ..."
|
||
|
||
#: lazarusidestrconsts.lisdestinationdirectory
|
||
msgid "Destination directory"
|
||
msgstr "Тека призначення"
|
||
|
||
#: lazarusidestrconsts.lisdestructorcode
|
||
msgid "Destructor code"
|
||
msgstr "Код деструктора"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
||
msgid "Case Insensitive"
|
||
msgstr "Без урахування регістру"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgfile1
|
||
msgid "File1"
|
||
msgstr "Файл1"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgfile2
|
||
msgid "File2"
|
||
msgstr "Файл2"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
||
msgid "Ignore if empty lines were added or removed"
|
||
msgstr "Ігнорувати дод./видал. порожніх рядків"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
||
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
||
msgstr "Ігнор. різні заверш. рядків (напр., #10 = #13#10)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
||
msgid "Ignore amount of space chars"
|
||
msgstr "Ігнорувати кількість пробілів"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
||
msgid "Ignore spaces (newline chars not included)"
|
||
msgstr "Ігнор. пробіли (без CR)"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
||
msgid "Ignore spaces at end of line"
|
||
msgstr "Ігнорувати пробіли в кінці рядка"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
||
msgid "Ignore spaces at start of line"
|
||
msgstr "Ігнорувати пробіли на початку рядка"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
||
msgid "Only selection"
|
||
msgstr "Тільки вибране"
|
||
|
||
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
||
msgid "Open difference in editor"
|
||
msgstr "Відкрити відмінності у редакторі"
|
||
|
||
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
||
msgid "different unit %s found at new position \"%s\""
|
||
msgstr "знайдено інший модуль %s у новому місці \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisdigits
|
||
msgid "Digits:"
|
||
msgstr "Розряди:"
|
||
|
||
#: lazarusidestrconsts.lisdirectives
|
||
msgid "Directives"
|
||
msgstr "Директиви"
|
||
|
||
#: lazarusidestrconsts.lisdirectivesfornewunit
|
||
msgid "Directives for new unit"
|
||
msgstr "Директиви для нового модуля"
|
||
|
||
#: lazarusidestrconsts.lisdirectories
|
||
msgid "Directories"
|
||
msgstr "Теки"
|
||
|
||
#: lazarusidestrconsts.lisdirectory
|
||
msgid "Directory: "
|
||
msgstr "Тека:"
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound
|
||
msgid "Directory \"%s\" not found."
|
||
msgstr "Теку \"%s\"не знайдено."
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotfound2
|
||
msgid "directory %s not found"
|
||
msgstr "тека %s не знайдена"
|
||
|
||
#: lazarusidestrconsts.lisdirectorynotwritable
|
||
msgid "Directory not writable"
|
||
msgstr "Тека не доступна для запису"
|
||
|
||
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
||
msgid "Directory where the IDE puts the .po files"
|
||
msgstr "Тека, в якій ІСР розміщує .po файли"
|
||
|
||
#: lazarusidestrconsts.lisdisableallinsamesource
|
||
msgid "Disable All in same source"
|
||
msgstr "Вимкнути всі у тому ж сирцевому файлі"
|
||
|
||
#: lazarusidestrconsts.lisdisablebreakpoint
|
||
msgid "Disable Breakpoint"
|
||
msgstr "Вимкнути точку зупинки"
|
||
|
||
#: lazarusidestrconsts.lisdisabled
|
||
msgid "Disabled"
|
||
msgstr "Вимкнено"
|
||
|
||
#: lazarusidestrconsts.lisdisablegroups
|
||
msgid "Disable Groups"
|
||
msgstr "Вимкнути групи"
|
||
|
||
#: lazarusidestrconsts.lisdisablei18nforlfm
|
||
msgid "Disable I18N for LFM"
|
||
msgstr "Вимкнути I18N для LFM"
|
||
|
||
#: lazarusidestrconsts.lisdisableoptionxg
|
||
msgid "Disable Option -Xg?"
|
||
msgstr "Вимкнути параметр -Xg?"
|
||
|
||
#: lazarusidestrconsts.lisdisableoptionxg2
|
||
msgid "Disable option -Xg"
|
||
msgstr "Вимкнути параметр -Xg"
|
||
|
||
#: lazarusidestrconsts.lisdisassassembler
|
||
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
||
msgid "Assembler"
|
||
msgstr "Асемблер"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddress
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
||
msgid "Goto Address"
|
||
msgstr "Перейти до адреси"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
||
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
||
msgid "Goto Address"
|
||
msgstr "Перейти до адреси"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
||
msgid "Goto Current Address"
|
||
msgstr "Перейти до поточної адреси"
|
||
|
||
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
||
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
||
msgid "Goto Current Address"
|
||
msgstr "Перейти до поточної адреси"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchanges
|
||
msgid "Discard changes"
|
||
msgstr "Відхилити зміни"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesall
|
||
msgid "Discard all changes"
|
||
msgstr "Відхилити всі зміни"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
||
msgid "Discard changes and open project"
|
||
msgstr "Відхилити зміни і відкрити проект"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangesandquit
|
||
msgid "Discard changes and quit"
|
||
msgstr "Відхилити зміни і вийти"
|
||
|
||
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
||
msgid "Discard changes, create new project"
|
||
msgstr "Відхилити зміни, створити новий проект"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
||
msgid "Click on one of the above items to see the diff"
|
||
msgstr "Виберіть один з елементів вище, щоб побачити різницю"
|
||
|
||
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
||
msgid "Error reading file: %s"
|
||
msgstr "Помилка читання файлу: %s"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
||
msgid "Ignore all disk changes"
|
||
msgstr "Знехтувати всіма змінами на диску"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
||
msgid "Reload checked files from disk"
|
||
msgstr "Перезавантажити змінені файли з диска"
|
||
|
||
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
||
msgid "Some files have changed on disk:"
|
||
msgstr "Деякі файли змінені на диску:"
|
||
|
||
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
||
msgid "Distinguish big and small letters e.g. A and a"
|
||
msgstr "Розрізняти регістр букв, наприклад, А і а"
|
||
|
||
#: lazarusidestrconsts.lisdlgadd
|
||
msgctxt "lazarusidestrconsts.lisdlgadd"
|
||
msgid "Add ..."
|
||
msgstr "Додати..."
|
||
|
||
#: lazarusidestrconsts.lisdlgalloptions
|
||
msgid "All options ..."
|
||
msgstr "Всі параметри"
|
||
|
||
#: lazarusidestrconsts.lisdlgchangeclass
|
||
msgid "Change Class ..."
|
||
msgstr "Змінити клас ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgdefines
|
||
msgid "Defines ..."
|
||
msgstr "Визначення ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgedit
|
||
msgctxt "lazarusidestrconsts.lisdlgedit"
|
||
msgid "Edit ..."
|
||
msgstr "Змінити ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgexport
|
||
msgctxt "lazarusidestrconsts.lisdlgexport"
|
||
msgid "Export ..."
|
||
msgstr "Експорт ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgimport
|
||
msgctxt "lazarusidestrconsts.lisdlgimport"
|
||
msgid "Import ..."
|
||
msgstr "Імпорт ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgmore
|
||
msgctxt "lazarusidestrconsts.lisdlgmore"
|
||
msgid "More ..."
|
||
msgstr "Більше ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgopen
|
||
msgctxt "lazarusidestrconsts.lisdlgopen"
|
||
msgid "Open ..."
|
||
msgstr "Відкрити ..."
|
||
|
||
#: lazarusidestrconsts.lisdlgsave
|
||
msgctxt "lazarusidestrconsts.lisdlgsave"
|
||
msgid "Save ..."
|
||
msgstr "Збереження ..."
|
||
|
||
#: lazarusidestrconsts.lisdoesnotexists
|
||
msgid "%s does not exist: %s"
|
||
msgstr "%s не існує: %s"
|
||
|
||
#: lazarusidestrconsts.lisdonotchange
|
||
msgid "Do not change"
|
||
msgstr "Не змінювати"
|
||
|
||
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
||
msgid "%sDo not check if another IDE instance is already running"
|
||
msgstr "%sНе перевіряти, чи запущено інший примірник ІСР"
|
||
|
||
#: lazarusidestrconsts.lisdonotclosetheproject
|
||
msgid "Do not close the project"
|
||
msgstr "Не закривати проект"
|
||
|
||
#: lazarusidestrconsts.lisdonotcompiledependencies
|
||
msgid "do not compile dependencies"
|
||
msgstr "не компілювати залежності"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
||
msgid "Do not show splash screen"
|
||
msgstr "Не показувати заставки"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
||
msgid "Do not show this dialog for this project"
|
||
msgstr "Не показувати цей діалог для цього проекту"
|
||
|
||
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
||
msgid "Do not show this message again"
|
||
msgstr "Не показувати це повідомлення знов"
|
||
|
||
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
||
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
||
msgstr "Не записувати оновлений файл інформації про проект після збирання. Якщо параметр не вказано, номер збірки буде нарощуватися (якщо цю функцію увімкнено)."
|
||
|
||
#: lazarusidestrconsts.lisdown
|
||
msgctxt "lazarusidestrconsts.lisdown"
|
||
msgid "Down"
|
||
msgstr "Вниз"
|
||
|
||
#: lazarusidestrconsts.lisdowngrade
|
||
msgid "Downgrade"
|
||
msgstr "Зниження"
|
||
|
||
#: lazarusidestrconsts.lisdowngradeconfiguration
|
||
msgid "Downgrade configuration"
|
||
msgstr "Понизити конфігурацію"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
||
msgid "Do you still want to create the new project?"
|
||
msgstr "Ви все ще хочете створити новий проект?"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
||
msgid "Do you still want to open another project?"
|
||
msgstr "Ви все ще хочете відкрити інший проект?"
|
||
|
||
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
||
msgid "Do you still want to quit?"
|
||
msgstr "Ви все ще хочете вийти?"
|
||
|
||
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
||
msgid "Draw grid lines"
|
||
msgstr "Малювати лінії сітки"
|
||
|
||
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
||
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
||
msgstr "Показувати вибране як таке, що перебуває у фокусі, навіть якщо вікно повідомлень не у фокусі. Користуйтесь цим, якщо елементи не у фокусі малопомітні у даній темі оформлення."
|
||
|
||
#: lazarusidestrconsts.lisdsgcopycomponents
|
||
msgid "Copy selected components to clipboard"
|
||
msgstr "Копіювати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts.lisdsgcutcomponents
|
||
msgid "Cut selected components to clipboard"
|
||
msgstr "Вирізати вибрані компоненти в буфер"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderbackone
|
||
msgid "Move component one back"
|
||
msgstr "Пересунути на один компонент назад"
|
||
|
||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||
msgid "Move component one forward"
|
||
msgstr "Пересунути на один компонент вперед"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||
msgid "Move component to back"
|
||
msgstr "Пересунути компонент в кінець"
|
||
|
||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||
msgid "Move component to front"
|
||
msgstr "Пересунути компонент наперед"
|
||
|
||
#: lazarusidestrconsts.lisdsgpastecomponents
|
||
msgid "Paste selected components from clipboard"
|
||
msgstr "Вставити вибрані компоненти з буфера"
|
||
|
||
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
||
msgid "Select parent component"
|
||
msgstr "Виділити компонент-предок"
|
||
|
||
#: lazarusidestrconsts.lisduplicate
|
||
msgid "Duplicate"
|
||
msgstr "Дублікат"
|
||
|
||
#: lazarusidestrconsts.lisduplicateentry
|
||
msgid "Duplicate entry"
|
||
msgstr "Повторний елемент"
|
||
|
||
#: lazarusidestrconsts.lisduplicatefilename
|
||
msgid "Duplicate File Name"
|
||
msgstr "Повторна назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
||
msgid "Duplicate found of value \"%s\"."
|
||
msgstr "Знайдений дублікат значення \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisduplicatename
|
||
msgid "Duplicate Name"
|
||
msgstr "Повторна назва"
|
||
|
||
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
||
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
||
msgstr "Дублювання назви: компонет з назвою \"%s\" вже існує і в успадкованому компоненті %s"
|
||
|
||
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
||
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr "Дубльовані ppu файли. Видаліть один або переконайтеся, що всі шляхи пошуку мають правильний порядок (Підказка: FPC спершу використовує останній шлях)."
|
||
|
||
#: lazarusidestrconsts.lisduplicatesearchpath
|
||
msgid "Duplicate search path"
|
||
msgstr "Шлях пошуку дублікату"
|
||
|
||
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
||
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
||
msgstr "Дубльовані сирці. Видаліть один або переконайтеся, що всі шляхи пошуку мають правильний порядок (Підказка: FPC спершу використовує останній шлях)."
|
||
|
||
#: lazarusidestrconsts.lisduplicateunit
|
||
msgid "Duplicate Unit"
|
||
msgstr "Повторний модуль"
|
||
|
||
#: lazarusidestrconsts.lisduplicateunitin
|
||
msgid "Duplicate unit \"%s\" in \"%s\""
|
||
msgstr "Повторний модуль \"%s\" у \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisedit
|
||
msgctxt "lazarusidestrconsts.lisedit"
|
||
msgid "Edit"
|
||
msgstr "Редагувати"
|
||
|
||
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
||
msgid "Edit additional help for messages"
|
||
msgstr "Змінити додаткову довідку для повідомлень"
|
||
|
||
#: lazarusidestrconsts.liseditcontexthelp
|
||
msgid "Edit context help"
|
||
msgstr "Редагувати контекстну допомогу"
|
||
|
||
#: lazarusidestrconsts.lisedithelp
|
||
msgid "Edit help"
|
||
msgstr "Змінити довідку"
|
||
|
||
#: lazarusidestrconsts.liseditkey
|
||
msgid "Edit Key"
|
||
msgstr "Змінити клавіші"
|
||
|
||
#: lazarusidestrconsts.liseditorcolors
|
||
msgid "Editor Colors"
|
||
msgstr "Кольори редактора"
|
||
|
||
#: lazarusidestrconsts.liseditormacros
|
||
msgid "Editor macros"
|
||
msgstr "Макроси редактора"
|
||
|
||
#: lazarusidestrconsts.liseditortoolbar
|
||
msgid "Editor ToolBar"
|
||
msgstr "Панель інструментів редактора"
|
||
|
||
#: lazarusidestrconsts.liseditortoolbarsettings
|
||
msgid "Editor Toolbar Settings"
|
||
msgstr "Параметри панелі інструментів редактора"
|
||
|
||
#: lazarusidestrconsts.liseditortoolbarvisible
|
||
msgid "Editor Toolbar is &visible"
|
||
msgstr "&Показувати панель інструментів редактора"
|
||
|
||
#: lazarusidestrconsts.lisedoptsloadascheme
|
||
msgid "Load a scheme"
|
||
msgstr "Завантажити схему"
|
||
|
||
#: lazarusidestrconsts.lisedtdefallpackages
|
||
msgid "All packages"
|
||
msgstr "Всі пакунки"
|
||
|
||
#: lazarusidestrconsts.lisedtdefcurrentproject
|
||
msgid "Current Project"
|
||
msgstr "Поточний проект"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsallprojects
|
||
msgid "All projects"
|
||
msgstr "Всі проекти"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
||
msgid "set FPC mode to DELPHI"
|
||
msgstr "встановити режим FPC в DELPHI"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
||
msgid "set FPC mode to FPC"
|
||
msgstr "встановити режим FPC на FPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
||
msgid "set FPC mode to GPC"
|
||
msgstr "встановити режим FPC в GPC"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
||
msgid "set FPC mode to MacPas"
|
||
msgstr "встановити режим FPC на MacPas"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
||
msgid "set FPC mode to TP"
|
||
msgstr "встановити режим FPC в TP"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
||
msgid "set IOCHECKS on"
|
||
msgstr "ввімкнути IOCHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
||
msgid "set OVERFLOWCHECKS on"
|
||
msgstr "ввімкнути OVERFLOWCHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
||
msgid "set RANGECHECKS on"
|
||
msgstr "ввімкнути RANGECHECKS на"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
||
msgid "use HeapTrc unit"
|
||
msgstr "використовувати модуль HeapTrc"
|
||
|
||
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
||
msgid "use LineInfo unit"
|
||
msgstr "використовувати модуль LineInfo"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
||
msgid "A valid tool needs at least a title and a filename."
|
||
msgstr "Нормальний інструмент обов'язково має мати заголовок і назву файлу."
|
||
|
||
#: lazarusidestrconsts.lisedtexttooledittool
|
||
msgid "Edit Tool"
|
||
msgstr "Інструмент правки"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolkey
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
||
msgid "Key"
|
||
msgstr "Клавіша"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolmacros
|
||
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
||
msgid "Macros"
|
||
msgstr "Макроси"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolparameters
|
||
msgid "Parameters:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
||
msgid "Program Filename:"
|
||
msgstr "Назва файлу програми:"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
||
msgid "Scan output for FPC messages"
|
||
msgstr "Пошук повідомлень компілятора FreePascal у виведенні"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
||
msgid "Scan output for \"make\" messages"
|
||
msgstr "Пошук повідомлень \"make\" у виведенні"
|
||
|
||
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
||
msgid "Title and Filename required"
|
||
msgstr "Необхідний заголовок і назва файлу"
|
||
|
||
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
||
msgid "Working Directory:"
|
||
msgstr "Робоча тека:"
|
||
|
||
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
||
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
||
msgstr "Завжди показувати це повідомлення як важливе (типово воно належить до менш важливих \"детальних\")"
|
||
|
||
#: lazarusidestrconsts.lisemdall
|
||
msgctxt "lazarusidestrconsts.lisemdall"
|
||
msgid "All"
|
||
msgstr "Всі"
|
||
|
||
#: lazarusidestrconsts.lisemdemptymethods
|
||
msgctxt "lazarusidestrconsts.lisemdemptymethods"
|
||
msgid "Empty Methods"
|
||
msgstr "Порожні методи"
|
||
|
||
#: lazarusidestrconsts.lisemdfoundemptymethods
|
||
msgid "Found empty methods:"
|
||
msgstr "Знайдені порожні методи:"
|
||
|
||
#: lazarusidestrconsts.lisemdnoclass
|
||
msgid "No class"
|
||
msgstr "Немає класу"
|
||
|
||
#: lazarusidestrconsts.lisemdnoclassat
|
||
msgid "No class at %s(%s,%s)"
|
||
msgstr "Немає класу в %s(%s,%s)"
|
||
|
||
#: lazarusidestrconsts.lisemdonlypublished
|
||
msgid "Only published"
|
||
msgstr "Лише опублікований"
|
||
|
||
#: lazarusidestrconsts.lisemdpublic
|
||
msgid "Public"
|
||
msgstr "Публічний"
|
||
|
||
#: lazarusidestrconsts.lisemdpublished
|
||
msgid "Published"
|
||
msgstr "Опублікований"
|
||
|
||
#: lazarusidestrconsts.lisemdremovemethods
|
||
msgid "Remove methods"
|
||
msgstr "Видалити методи"
|
||
|
||
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
||
msgid "Search in these class sections:"
|
||
msgstr "Пошук в цих секціях класу:"
|
||
|
||
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
||
msgid "Unable to show empty methods of the current class, because%s%s"
|
||
msgstr "Неможливо показати порожні методи поточного класу, тому що%s%s"
|
||
|
||
#: lazarusidestrconsts.lisempty
|
||
msgid "Empty"
|
||
msgstr "Порожньо"
|
||
|
||
#: lazarusidestrconsts.lisenableall
|
||
msgid "&Enable All"
|
||
msgstr "&Увімкнути все"
|
||
|
||
#: lazarusidestrconsts.lisenableallinsamesource
|
||
msgid "Enable All in same source"
|
||
msgstr "Ввімкнути Всі в тому ж джерелі"
|
||
|
||
#: lazarusidestrconsts.lisenablebreakpoint
|
||
msgid "Enable Breakpoint"
|
||
msgstr "Увімкнути точку зупинки"
|
||
|
||
#: lazarusidestrconsts.lisenabled
|
||
msgctxt "lazarusidestrconsts.lisenabled"
|
||
msgid "Enabled"
|
||
msgstr "Доступний"
|
||
|
||
#: lazarusidestrconsts.lisenabledonlyforpackages
|
||
msgid "Enabled only for packages."
|
||
msgstr "Доступно лише для пакунків."
|
||
|
||
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
||
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
||
msgstr ". Встановіть прапорець \"Використовувати модуль\" для модуля %s у пакунку %s"
|
||
|
||
#: lazarusidestrconsts.lisenablegroups
|
||
msgid "Enable Groups"
|
||
msgstr "Ввімкнути Групи"
|
||
|
||
#: lazarusidestrconsts.lisenablei18nforlfm
|
||
msgid "Enable I18N for LFM"
|
||
msgstr "Ввімкнути i18n для LFM"
|
||
|
||
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
||
msgid "Enable internationalization and translation support"
|
||
msgstr "Включити підтримку інтернаціоналізації та перекладів "
|
||
|
||
#: lazarusidestrconsts.lisenablemacros
|
||
msgid "Enable Macros"
|
||
msgstr "Макрос доступний"
|
||
|
||
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
||
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
||
msgstr "Ввімк = натискання Enter замінює цілий ідентифікатор, а Shift+Enter замінює префікс; Вимк = натискання Enter замінює префікс, а Shift+Enter замінює цілий ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisenclose
|
||
msgid "Enclose"
|
||
msgstr "Задужкувати"
|
||
|
||
#: lazarusidestrconsts.lisencloseinifdef
|
||
msgid "Enclose in $IFDEF"
|
||
msgstr "Вкласти в $IFDEF"
|
||
|
||
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
||
msgid "Number of files failed to convert: %d"
|
||
msgstr "Число файлів, які не вдалось перетворити: %d"
|
||
|
||
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
||
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
||
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
||
msgstr "Кодування файлу \"%s\"%sна диску - %s. Нове кодування - %s."
|
||
|
||
#: lazarusidestrconsts.lisendlessloopinmacros
|
||
msgid "Endless loop in macros"
|
||
msgstr "Нескінченний цикл в макросі"
|
||
|
||
#: lazarusidestrconsts.lisenternewnameformacros
|
||
msgid "Enter new name for Macro \"%s\""
|
||
msgstr "Введіть нову назву макросу \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
||
msgid "Environment variable, name as parameter"
|
||
msgstr "Змінна оточення, назва як параметр"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
||
msgid "Directory not found"
|
||
msgstr "Теки не існує"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
||
msgid "Invalid debugger filename"
|
||
msgstr "Некоректна назва файлу зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
||
msgid "The debugger file \"%s\" is not an executable."
|
||
msgstr "Файл зневаджувача \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
||
msgid "Test directory \"%s\" not found."
|
||
msgstr "Теки проб \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.liserrinvalidoption
|
||
msgid "Invalid option at position %d: \"%s\""
|
||
msgstr "Неправильна опція в позиції %d: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrnooptionallowed
|
||
msgid "Option at position %d does not allow an argument: %s"
|
||
msgstr "Опція в позиції %d на дозволяє використовувати аргумент %s"
|
||
|
||
#: lazarusidestrconsts.liserroptionneeded
|
||
msgid "Option at position %d needs an argument : %s"
|
||
msgstr "Опція в позиції %d потребує аргумент %s"
|
||
|
||
#: lazarusidestrconsts.liserror
|
||
msgid "Error: "
|
||
msgstr "Помилка: "
|
||
|
||
#: lazarusidestrconsts.liserrorcreatingfile
|
||
msgid "Error creating file"
|
||
msgstr "Помилка створення файлу"
|
||
|
||
#: lazarusidestrconsts.liserrordeletingfile
|
||
msgid "Error deleting file"
|
||
msgstr "Помилка видалення файлу"
|
||
|
||
#: lazarusidestrconsts.liserrorin
|
||
msgid "Error in %s"
|
||
msgstr "Помилка в %s"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
||
msgid "Error in the compiler file name:"
|
||
msgstr "Помилка в назві файлу компілятора:"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
||
msgid "Error in the custom compiler options (Other):"
|
||
msgstr "Помилка в власних параметрах компілятора (Інше):"
|
||
|
||
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
||
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
||
msgstr "Помилка у власних параметрах компонувальника (Компіляція і компонування / Передати параметри компонувальнику):"
|
||
|
||
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
||
msgid "Error in the \"Debugger path addition\":"
|
||
msgstr "Помилка у \"Доповненні шляху зневаджувача\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
||
msgid "Error in the search path for \"Include files\":"
|
||
msgstr "Помилка в шляху пошуку для \"Включені файли\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
||
msgid "Error in the search path for \"Libraries\":"
|
||
msgstr "Помилка в шляху пошуку для \"Бібліотеки\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
||
msgid "Error in the search path for \"Object files\":"
|
||
msgstr "Помилка в шляху пошуку для \"Об'єктні файли\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
||
msgid "Error in the search path for \"Other sources\":"
|
||
msgstr "Помилка в шляху пошуку для \"Інші початкові коди\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
||
msgid "Error in the search path for \"Other unit files\":"
|
||
msgstr "Помилка в шляху пошуку для \"Інші файли модулів\":"
|
||
|
||
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
||
msgid "Error in the \"unit output directory\":"
|
||
msgstr "Помилка в \"вихідній теці модуля\":"
|
||
|
||
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
||
msgid "Error: (lazarus) invalid build mode \"%s\""
|
||
msgstr "Помилка: (lazarus) неправильний режим збирання \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile
|
||
msgid "Error loading file"
|
||
msgstr "Помилка завантаження файлу"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfile2
|
||
msgid "Error loading file \"%s\":"
|
||
msgstr "Помилка завантаження файлу \"%s\":"
|
||
|
||
#: lazarusidestrconsts.liserrorloadingfrom
|
||
msgid "Error loading %s from%s%s%s%s"
|
||
msgstr "Помилка завантаження %s з%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent
|
||
msgid "Error moving component"
|
||
msgstr "Помилка переміщення компонента"
|
||
|
||
#: lazarusidestrconsts.liserrormovingcomponent2
|
||
msgid "Error moving component %s:%s"
|
||
msgstr "Помилка переміщення компонента %s:%s"
|
||
|
||
#: lazarusidestrconsts.liserrornamingcomponent
|
||
msgid "Error naming component"
|
||
msgstr "Помилка при називанні компонента"
|
||
|
||
#: lazarusidestrconsts.liserroropeningcomponent
|
||
msgid "Error opening component"
|
||
msgstr "Помилка відкриття компонента"
|
||
|
||
#: lazarusidestrconsts.liserroropeningform
|
||
msgid "Error opening form"
|
||
msgstr "Помилка відкривання форми"
|
||
|
||
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
||
msgid "Error parsing lfm component stream."
|
||
msgstr "Помилка аналізу потоку lfm компонента"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
||
msgid "Error reading package list from file%s%s%s%s"
|
||
msgstr "Помилка читання списку пакунків з файлу%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxml
|
||
msgid "Error reading XML"
|
||
msgstr "Помилка читання XML"
|
||
|
||
#: lazarusidestrconsts.liserrorreadingxmlfile
|
||
msgid "Error reading xml file \"%s\"%s%s"
|
||
msgstr "Помилка читання xml-файлу \"%s\"%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorrenamingfile
|
||
msgid "Error renaming file"
|
||
msgstr "Помилка перейменування файлу"
|
||
|
||
#: lazarusidestrconsts.liserrors
|
||
msgctxt "lazarusidestrconsts.liserrors"
|
||
msgid "Errors"
|
||
msgstr "Помилки"
|
||
|
||
#: lazarusidestrconsts.liserrors2
|
||
msgid ", Errors: %s"
|
||
msgstr ", Помилок: %s"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingform
|
||
msgid "Error saving form"
|
||
msgstr "Помилка збереження форми"
|
||
|
||
#: lazarusidestrconsts.liserrorsavingto
|
||
msgid "Error saving %s to%s%s%s%s"
|
||
msgstr "Помилка збереження %s до%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
||
msgid "Error setting the name of a component %s to %s"
|
||
msgstr "Помилка задання назви компонента %s на %s"
|
||
|
||
#: lazarusidestrconsts.liserrorwritingfile
|
||
msgid "Error writing file \"%s\""
|
||
msgstr "Помилка запису файлу \"%s\""
|
||
|
||
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
||
msgid "Error writing package list to file%s%s%s%s"
|
||
msgstr "Помилка запису списку пакунків в файл%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisevalexpression
|
||
msgctxt "lazarusidestrconsts.lisevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Оцінити вираз"
|
||
|
||
#: lazarusidestrconsts.lisevaluate
|
||
msgid "E&valuate"
|
||
msgstr "О&цінити"
|
||
|
||
#: lazarusidestrconsts.lisevaluatemodify
|
||
msgid "&Evaluate/Modify"
|
||
msgstr "&Оцінити/Змінити"
|
||
|
||
#: lazarusidestrconsts.liseventlogclear
|
||
msgid "Clear Events"
|
||
msgstr "Очистити події"
|
||
|
||
#: lazarusidestrconsts.liseventlogoptions
|
||
msgid "Event Log Options ..."
|
||
msgstr "Параметри журналу подій ..."
|
||
|
||
#: lazarusidestrconsts.liseventlogsavetofile
|
||
msgid "Save Events to File"
|
||
msgstr "Зберегти події у файл"
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment
|
||
msgid "Add Comment ..."
|
||
msgstr "Додати коментар ..."
|
||
|
||
#: lazarusidestrconsts.liseventslogaddcomment2
|
||
msgid "Add Comment"
|
||
msgstr "Додати коментар"
|
||
|
||
#: lazarusidestrconsts.liseverynthlinenumber
|
||
msgid "Every n-th line number"
|
||
msgstr "Кожен n-ний номер рядка"
|
||
|
||
#: lazarusidestrconsts.lisexamplefile
|
||
msgid "Example file:"
|
||
msgstr "Файл прикладу:"
|
||
|
||
#: lazarusidestrconsts.lisexamplesbuildallselected
|
||
msgid "Build all selected"
|
||
msgstr "Зібрати всі вибрані"
|
||
|
||
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
||
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
||
msgstr "Приклади:%sІдентифікатор%sTMyEnum.Enum%sНазвамодуля.Ідентифікатор%s#Назвапакунку.Назвамодуля.Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
||
msgid "Open first selected"
|
||
msgstr "Відкрити перший вибраний"
|
||
|
||
#: lazarusidestrconsts.lisexceptiondialog
|
||
msgid "Debugger Exception Notification"
|
||
msgstr "Повідомлення про виняток зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lisexcludedatruntime
|
||
msgid "%s excluded at run time"
|
||
msgstr "%s виключений під час виконання"
|
||
|
||
#: lazarusidestrconsts.lisexcludefilter
|
||
msgid "Exclude filter"
|
||
msgstr "Фільтр для виключення"
|
||
|
||
#: lazarusidestrconsts.lisexecutableisadirectory
|
||
msgid "executable \"%s\" is a directory"
|
||
msgstr "виконуваний файл \"%s\" є текою"
|
||
|
||
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
||
msgid "executable \"%s\" lacks the permission to run"
|
||
msgstr "виконуваний файл \"%s\" не має прав на запуск"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandafter
|
||
msgid "Executing command after"
|
||
msgstr "Виконати команду після"
|
||
|
||
#: lazarusidestrconsts.lisexecutingcommandbefore
|
||
msgid "Executing command before"
|
||
msgstr "Виконати команду до"
|
||
|
||
#: lazarusidestrconsts.lisexecutionstopped
|
||
msgid "Execution stopped"
|
||
msgstr "Виконання завершено"
|
||
|
||
#: lazarusidestrconsts.lisexit
|
||
msgctxt "lazarusidestrconsts.lisexit"
|
||
msgid "Exit"
|
||
msgstr "Вихід"
|
||
|
||
#: lazarusidestrconsts.lisexitcode
|
||
msgid "Exit code %s"
|
||
msgstr "Код завершення %s"
|
||
|
||
#: lazarusidestrconsts.lisexpandall
|
||
msgid "Expand All (*)"
|
||
msgstr "Розгорнути все (*)"
|
||
|
||
#: lazarusidestrconsts.lisexpandallclasses
|
||
msgid "Expand all classes"
|
||
msgstr "Розширити всі класи"
|
||
|
||
#: lazarusidestrconsts.lisexpandallpackages
|
||
msgid "Expand all packages"
|
||
msgstr "Розгорнути всі пакунки"
|
||
|
||
#: lazarusidestrconsts.lisexpandallunits
|
||
msgid "Expand all units"
|
||
msgstr "Розширити всі модулі"
|
||
|
||
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
||
msgid "Expanded filename of current editor file"
|
||
msgstr "Повна назва файлу в поточному редакторі"
|
||
|
||
#: lazarusidestrconsts.lisexport
|
||
msgctxt "lazarusidestrconsts.lisexport"
|
||
msgid "Export"
|
||
msgstr "Експортувати"
|
||
|
||
#: lazarusidestrconsts.lisexportall
|
||
msgid "Export all"
|
||
msgstr "Експортувати всі"
|
||
|
||
#: lazarusidestrconsts.lisexportallitemstofile
|
||
msgid "Export All Items to File"
|
||
msgstr "Експортувати всі елементи до файлу"
|
||
|
||
#: lazarusidestrconsts.lisexportenvironmentoptions
|
||
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
||
msgid "Export environment options"
|
||
msgstr "Експортувати параметри оточення"
|
||
|
||
#: lazarusidestrconsts.lisexporthtml
|
||
msgid "Export as HTML"
|
||
msgstr "Експортувати як HTML"
|
||
|
||
#: lazarusidestrconsts.lisexportimport
|
||
msgid "Export / Import"
|
||
msgstr "Експорт / Імпорт"
|
||
|
||
#: lazarusidestrconsts.lisexportlist
|
||
msgid "Export list"
|
||
msgstr "Список експорту"
|
||
|
||
#: lazarusidestrconsts.lisexportpackagelistxml
|
||
msgid "Export package list (*.xml)"
|
||
msgstr "Експортувати список пакунків (*.xml)"
|
||
|
||
#: lazarusidestrconsts.lisexportselected
|
||
msgid "Export selected"
|
||
msgstr "Експортувати вибране"
|
||
|
||
#: lazarusidestrconsts.lisexportsub
|
||
msgid "Export >>"
|
||
msgstr "Експортувати >>"
|
||
|
||
#: lazarusidestrconsts.lisexpression
|
||
msgid "Expression:"
|
||
msgstr "Вираз:"
|
||
|
||
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
||
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
||
msgstr "Доповнити список шляхів пошуку файлів для включення пакунка \"%s\" такими%s\"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
||
msgid "Extend include files search path of project with%s\"%s\"?"
|
||
msgstr "Доповнити список шляхів пошуку файлів для включення проекту такими%s\"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisextendincludepath
|
||
msgid "Extend include path?"
|
||
msgstr "Доповнити шляхи до файлів для включення?"
|
||
|
||
#: lazarusidestrconsts.lisextendunitpath
|
||
msgid "Extend unit path?"
|
||
msgstr "Розширити шлях до модулів?"
|
||
|
||
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
||
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
||
msgstr "Доповнити список шляхів пошуку модулів пакету \"%s\" такими%s\"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
||
msgid "Extend unit search path of project with%s\"%s\"?"
|
||
msgstr "Доповнити список шляхів пошуку модулів проекту такими%s\"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisextract
|
||
msgid "Extract"
|
||
msgstr "Здобути"
|
||
|
||
#: lazarusidestrconsts.lisextractprocedure
|
||
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
||
msgid "Extract Procedure"
|
||
msgstr "Видобути процедуру"
|
||
|
||
#: lazarusidestrconsts.lisextremelyverbose
|
||
msgid "Extremely Verbose"
|
||
msgstr "Надзвичайно детально"
|
||
|
||
#: lazarusidestrconsts.lisexttoolexternaltools
|
||
msgid "External Tools"
|
||
msgstr "Зовнішні інструменти"
|
||
|
||
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
||
msgid "Maximum Tools reached"
|
||
msgstr "Досягнуто максимуму інструментів"
|
||
|
||
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
||
msgid "There is a maximum of %s tools."
|
||
msgstr "Припускається максимум %s інструментів."
|
||
|
||
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
||
msgid "Failed to add %d not unique resource(s)"
|
||
msgstr "Не вдалось додати неунікальні ресурси (%d шт.)"
|
||
|
||
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
||
msgid "Failed to create Application Bundle for \"%s\""
|
||
msgstr "Не вдалось створити пакет застосунків для \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
||
msgid "Failed to load fold state"
|
||
msgstr "Не вдалось завантажити стан згортки"
|
||
|
||
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
||
msgid "failed to resolve macros"
|
||
msgstr "не вдалось розкрити макрос"
|
||
|
||
#: lazarusidestrconsts.lisfailedtosavefile
|
||
msgid "Failed to save file."
|
||
msgstr "Не вдалось зберегти файл."
|
||
|
||
#: lazarusidestrconsts.lisfatal
|
||
msgctxt "lazarusidestrconsts.lisfatal"
|
||
msgid "Fatal"
|
||
msgstr "Фатальна помилка"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
||
msgid "Reduce designer painting"
|
||
msgstr "Обмежити мал. дизайнера"
|
||
|
||
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
|
||
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
|
||
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
||
msgstr "Малювати елементи дизайну тільки в паузах (зменшує навантаження на повільних машинах)"
|
||
|
||
#: lazarusidestrconsts.lisfile
|
||
msgctxt "lazarusidestrconsts.lisfile"
|
||
msgid "File"
|
||
msgstr "Файл"
|
||
|
||
#: lazarusidestrconsts.lisfile2
|
||
msgid "File: "
|
||
msgstr "Файл:"
|
||
|
||
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
||
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
|
||
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
||
msgstr "Файл \"%s\"%sне схожий на текстовий.%sВсе одно відкрити?"
|
||
|
||
#: lazarusidestrconsts.lisfileextensionofprograms
|
||
msgid "File extension of programs"
|
||
msgstr "Розширення файлів програм"
|
||
|
||
#: lazarusidestrconsts.lisfilefilter
|
||
msgid "File filter"
|
||
msgstr "Фільтр файлів"
|
||
|
||
#: lazarusidestrconsts.lisfilefilters
|
||
msgid "File Filters"
|
||
msgstr "Файлові фільтри"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersaddrow
|
||
msgid "Add Row"
|
||
msgstr "Додати рядок"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
||
msgid "Delete Row"
|
||
msgstr "Видалити рядок"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
||
msgid "Insert Row"
|
||
msgstr "Вставити рядок"
|
||
|
||
#: lazarusidestrconsts.lisfilefiltersmask
|
||
msgid "File mask"
|
||
msgstr "Файлова маска"
|
||
|
||
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
||
msgid "Set defaults"
|
||
msgstr "Задати типові"
|
||
|
||
#: lazarusidestrconsts.lisfilefilterstitle
|
||
msgid "These are file filters that will appear in all File Open dialogs"
|
||
msgstr "Це фільтри файлів, які з'являться в усіх діалогах відкриття файлів"
|
||
|
||
#: lazarusidestrconsts.lisfilehaschangedsave
|
||
msgid "File \"%s\" has changed. Save?"
|
||
msgstr "Файл \"%s\" змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts.lisfilehasnoproject
|
||
msgid "File has no project"
|
||
msgstr "Файл не має проекту"
|
||
|
||
#: lazarusidestrconsts.lisfileisdirectory
|
||
msgid "File is directory"
|
||
msgstr "Файл є текою"
|
||
|
||
#: lazarusidestrconsts.lisfileisnotanexecutable
|
||
msgid "File is not an executable"
|
||
msgstr "Файл не є виконуваним"
|
||
|
||
#: lazarusidestrconsts.lisfileisnotwritable
|
||
msgid "File is not writable"
|
||
msgstr "У файл не можна писати"
|
||
|
||
#: lazarusidestrconsts.lisfileissymlink
|
||
msgid "File is symlink"
|
||
msgstr "Файл є символьним посиланням"
|
||
|
||
#: lazarusidestrconsts.lisfileisvirtual
|
||
msgid "File \"%s\" is virtual."
|
||
msgstr "Файл \"%s\" є віртуальним."
|
||
|
||
#: lazarusidestrconsts.lisfilelinkerror
|
||
msgid "File link error"
|
||
msgstr "Помилкове посилання на файл"
|
||
|
||
#: lazarusidestrconsts.lisfilenameaddress
|
||
msgid "Filename/Address"
|
||
msgstr "Назва файлу/адреса"
|
||
|
||
#: lazarusidestrconsts.lisfilenamestyle
|
||
msgid "Filename Style"
|
||
msgstr "Стиль назви файлу"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound
|
||
msgid "File not found"
|
||
msgstr "Файл не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound2
|
||
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Файл \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound3
|
||
msgid "file %s not found"
|
||
msgstr "файл %s не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound4
|
||
msgid "file not found"
|
||
msgstr "файл не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfound5
|
||
msgid "File not found:%s%s"
|
||
msgstr "Файл не знайдено:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
||
msgid "File \"%s\" not found.%sDo you want to create it?"
|
||
msgstr "Файл \"%s\" не знайдено.%sСтворити його?"
|
||
|
||
#: lazarusidestrconsts.lisfilenotlowercase
|
||
msgid "File not lowercase"
|
||
msgstr "Файл не в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lisfilenottext
|
||
msgid "File not text"
|
||
msgstr "Не текстовий файл"
|
||
|
||
#: lazarusidestrconsts.lisfilesettings
|
||
msgid "File Settings"
|
||
msgstr "Параметри файлу"
|
||
|
||
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
||
msgid "File %s has incorrect syntax."
|
||
msgstr "Файл %s має некоректний синтаксис."
|
||
|
||
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
||
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
||
msgstr "Файлів: %s, з процедурою Register: %s, у виразі Uses пакунка: %s"
|
||
|
||
#: lazarusidestrconsts.lisfileshaverightencoding
|
||
msgid "*** All found files already have the right encoding ***"
|
||
msgstr "*** Всі знайдені файли вже мають правильне кодування ***"
|
||
|
||
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
||
msgid "Files in ASCII or UTF-8 encoding"
|
||
msgstr "Файли в кодуванні ASCII або UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
||
msgid "File %s is converted to text format."
|
||
msgstr "Файл %s перетворено на текстовий."
|
||
|
||
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
||
msgid "Files not in ASCII nor UTF-8 encoding"
|
||
msgstr "Файли не в кодуванні ASCII і не в UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
||
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
||
msgstr "файл, куди буде записуватись зневаджувальна інформація. Якщо не вказано, зневаджувальна інформація виводиться у консоль."
|
||
|
||
#: lazarusidestrconsts.lisfilter
|
||
msgid "Filter"
|
||
msgstr "Фільтр"
|
||
|
||
#: lazarusidestrconsts.lisfilter3
|
||
msgid "Filter: %s"
|
||
msgstr "Фільтр: %s"
|
||
|
||
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
||
msgid "Filter all messages of certain type"
|
||
msgstr "Приховати повідомлення певного типу"
|
||
|
||
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
||
msgid "Filter all messages of type %s"
|
||
msgstr "Фільтрувати всі повідомлення типу %s"
|
||
|
||
#: lazarusidestrconsts.lisfilteralreadyexists
|
||
msgid "Filter already exists"
|
||
msgstr "Фільтрувати вже наявні"
|
||
|
||
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
||
msgid "Filter Debug Messages and below"
|
||
msgstr "Не показувати повідомлення зневадження і нижчі"
|
||
|
||
#: lazarusidestrconsts.lisfilterhintsandbelow
|
||
msgid "Filter Hints and below"
|
||
msgstr "Не показувати підказки і нижчі"
|
||
|
||
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
||
msgid "Filter Hints without Source Position"
|
||
msgstr "Не показувати підказки без позиції у коді"
|
||
|
||
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
||
msgid "Filter None, do not filter by urgency"
|
||
msgstr "Показувати всі, не фільтрувати за важливістю"
|
||
|
||
#: lazarusidestrconsts.lisfilternonurgentmessages
|
||
msgid "Filter non urgent Messages"
|
||
msgstr "Фільтрувати повідомлення за важливістю"
|
||
|
||
#: lazarusidestrconsts.lisfilternotesandbelow
|
||
msgid "Filter Notes and below"
|
||
msgstr "Фільтрувати зауваження і нижче"
|
||
|
||
#: lazarusidestrconsts.lisfiltersets
|
||
msgid "Filter Sets"
|
||
msgstr "Набори фільтрів"
|
||
|
||
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
||
msgid "Filter the available options list"
|
||
msgstr "Фільтрувати доступний список параметрів"
|
||
|
||
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
||
msgid "Filter Verbose Messages and below"
|
||
msgstr "Не показувати детальні повідомлення і нижчі"
|
||
|
||
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
||
msgid "Filter Warnings and below"
|
||
msgstr "Не показувати попередження і нижчі"
|
||
|
||
#: lazarusidestrconsts.lisfind
|
||
msgid "Find ..."
|
||
msgstr "Знайти ..."
|
||
|
||
#: lazarusidestrconsts.lisfinddeclarationof
|
||
msgid "Find Declaration of %s"
|
||
msgstr "Знайти оголошення %s"
|
||
|
||
#: lazarusidestrconsts.lisfindfiledirectories
|
||
msgid "D&irectories"
|
||
msgstr "&Теки"
|
||
|
||
#: lazarusidestrconsts.lisfindfilefilemask
|
||
msgid "Fi&le mask"
|
||
msgstr "&Маска файлів"
|
||
|
||
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
||
msgid "Include &sub directories"
|
||
msgstr "Включити &підтеки"
|
||
|
||
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
||
msgid "&Multiline pattern"
|
||
msgstr "&Багаторядковий шаблон"
|
||
|
||
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
||
msgid "Only text files"
|
||
msgstr "Тільки текстові файли"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
||
msgid "search all files in &project"
|
||
msgstr "шукати в усіх файлах &проекту"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
||
msgid "search all &open files"
|
||
msgstr "шукати в усіх від&критих файлах"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
||
msgid "search in &active file"
|
||
msgstr "шукати в &активному файлі"
|
||
|
||
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
||
msgid "search in &directories"
|
||
msgstr "шукати в &директоріях"
|
||
|
||
#: lazarusidestrconsts.lisfindfilewhere
|
||
msgid "Where"
|
||
msgstr "Де"
|
||
|
||
#: lazarusidestrconsts.lisfindkeycombination
|
||
msgid "Find key combination"
|
||
msgstr "Знайти комбінацію клавіш"
|
||
|
||
#: lazarusidestrconsts.lisfindmissingunit
|
||
msgid "Find missing unit"
|
||
msgstr "Знайти втрачений модуль"
|
||
|
||
#: lazarusidestrconsts.lisfirst
|
||
msgid "First"
|
||
msgstr "Перший"
|
||
|
||
#: lazarusidestrconsts.lisfirsttest
|
||
msgid "&First test"
|
||
msgstr "&Перший тест"
|
||
|
||
#: lazarusidestrconsts.lisfixlfmfile
|
||
msgid "Fix LFM file"
|
||
msgstr "Виправити файл LFM"
|
||
|
||
#: lazarusidestrconsts.lisfloatingpoin
|
||
msgid "Floating Point"
|
||
msgstr "Рухома кома"
|
||
|
||
#: lazarusidestrconsts.lisfocushint
|
||
msgid "Focus hint"
|
||
msgstr "Фокусна підказка"
|
||
|
||
#: lazarusidestrconsts.lisforcerenaming
|
||
msgid "Force renaming"
|
||
msgstr "Розпочати зміну назв"
|
||
|
||
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
||
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
||
msgstr "Наприклад, виводити вгорі локальні змінні, потім елементи поточного класу, його предків, поточного і використаних модулів"
|
||
|
||
#: lazarusidestrconsts.lisform
|
||
msgid "Form"
|
||
msgstr "Форма"
|
||
|
||
#: lazarusidestrconsts.lisformacosdarwin
|
||
msgid "For macOS (Darwin)"
|
||
msgstr "Для macOS (Darwin)"
|
||
|
||
#: lazarusidestrconsts.lisformaterror
|
||
msgid "Format error"
|
||
msgstr "Помилка формату"
|
||
|
||
#: lazarusidestrconsts.lisforwindows
|
||
msgid "For Windows"
|
||
msgstr "Для Windows"
|
||
|
||
#: lazarusidestrconsts.lisfoundversionexpected
|
||
msgid "Found version %s, expected %s"
|
||
msgstr "Знайдена версія %s, але очікувалась %s"
|
||
|
||
#: lazarusidestrconsts.lisfpccfgismissing
|
||
msgid "fpc.cfg is missing."
|
||
msgstr "fpc.cfg загубився."
|
||
|
||
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
||
msgid "FPC version as one number (e.g. 20701)"
|
||
msgstr "Версія FPC одним числом (наприклад, 20701)"
|
||
|
||
#: lazarusidestrconsts.lisfpcmakefailed
|
||
msgid "fpcmake failed"
|
||
msgstr "fpcmake провалився"
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagefile2
|
||
msgid "FPC message file:"
|
||
msgstr "Файл повідомлень FPC:"
|
||
|
||
#: lazarusidestrconsts.lisfpcmessagesappendix
|
||
msgid "FPC messages: Appendix"
|
||
msgstr "Повідомлення FPC: додаток"
|
||
|
||
#: lazarusidestrconsts.lisfpcresources
|
||
msgid "FPC resources (.res)"
|
||
msgstr "Ресурси FPC (.res)"
|
||
|
||
#: lazarusidestrconsts.lisfpcsources
|
||
msgid "FPC sources"
|
||
msgstr "Початкові коди FPC"
|
||
|
||
#: lazarusidestrconsts.lisfpctooold
|
||
msgid "FPC too old"
|
||
msgstr "FPC надто старий"
|
||
|
||
#: lazarusidestrconsts.lisfpcversion
|
||
msgid "FPC Version: "
|
||
msgstr "Версія FPC: "
|
||
|
||
#: lazarusidestrconsts.lisfpcversioneg222
|
||
msgid "FPC Version (e.g. 2.2.2)"
|
||
msgstr "Версія FPC (напр. 2.2.2)"
|
||
|
||
#: lazarusidestrconsts.lisfpdoceditor
|
||
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
||
msgid "FPDoc Editor"
|
||
msgstr "Редактор FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocerrorwriting
|
||
msgid "Error writing \"%s\"%s%s"
|
||
msgstr "Помилка запису \"%s\"%s%s"
|
||
|
||
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
||
msgid "FPDoc syntax error"
|
||
msgstr "Синтаксична помилка FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagename
|
||
msgid "FPDoc package name:"
|
||
msgstr "Назва пакунка FPDoc:"
|
||
|
||
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
||
msgid "FPDoc package name. Default is project file name."
|
||
msgstr "Назва пакунка FPDoc. Типовим є назва файлу проекту."
|
||
|
||
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
||
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
||
msgstr "Є синтаксична помилка в елементі fpdoc \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.lisframe
|
||
msgid "Frame"
|
||
msgstr "Фрейм"
|
||
|
||
#: lazarusidestrconsts.lisfrbackwardsearch
|
||
msgid "&Backward search"
|
||
msgstr "Пошук на&зад"
|
||
|
||
#: lazarusidestrconsts.lisfreeingbufferlines
|
||
msgid "freeing buffer lines: %s"
|
||
msgstr "вивільнення рядків буфера: %s"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
||
msgid "Free Pascal Compiler messages"
|
||
msgstr "Повідомлення компілятора Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
||
msgid "Free Pascal source directory"
|
||
msgstr "Тека кодів Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisfrforwardsearch
|
||
msgid "Forwar&d search"
|
||
msgstr "Пошук в&перед"
|
||
|
||
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
||
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
||
msgstr "Додаткові файли для пошуку (напр. /path/*.pas;/path2/*.pp)"
|
||
|
||
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
||
msgid "Find or Rename Identifier"
|
||
msgstr "Знайти або перейменувати ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisfrifindreferences
|
||
msgid "Find References"
|
||
msgstr "Знайти посилання"
|
||
|
||
#: lazarusidestrconsts.lisfriidentifier
|
||
msgid "Identifier: %s"
|
||
msgstr "Ідентифікатор: %s"
|
||
|
||
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
||
msgid "in all open packages and projects"
|
||
msgstr "у всіх відкритих пакунках і проектах"
|
||
|
||
#: lazarusidestrconsts.lisfriincurrentunit
|
||
msgid "in current unit"
|
||
msgstr "в поточному модулі"
|
||
|
||
#: lazarusidestrconsts.lisfriinmainproject
|
||
msgid "in main project"
|
||
msgstr "в головному проекті"
|
||
|
||
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
||
msgid "in project/package owning current unit"
|
||
msgstr "у проекті/пакунку, що вміщує цей модуль"
|
||
|
||
#: lazarusidestrconsts.lisfriinvalididentifier
|
||
msgid "Invalid Identifier"
|
||
msgstr "Некоректний ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisfrirenameallreferences
|
||
msgid "Rename all References"
|
||
msgstr "Перейменувати всі посилання"
|
||
|
||
#: lazarusidestrconsts.lisfrirenaming
|
||
msgid "Renaming"
|
||
msgstr "Перейменування"
|
||
|
||
#: lazarusidestrconsts.lisfrisearch
|
||
msgid "Search"
|
||
msgstr "Пошук"
|
||
|
||
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
||
msgid "Search in comments too"
|
||
msgstr "Шукати також і в коментарях"
|
||
|
||
#: lazarusidestrconsts.lisfull
|
||
msgid "Full"
|
||
msgstr "Повний"
|
||
|
||
#: lazarusidestrconsts.lisfunction
|
||
msgctxt "lazarusidestrconsts.lisfunction"
|
||
msgid "Function"
|
||
msgstr "Функція"
|
||
|
||
#: lazarusidestrconsts.lisgeneral
|
||
msgctxt "lazarusidestrconsts.lisgeneral"
|
||
msgid "General"
|
||
msgstr "Загальне"
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
||
msgid "get word at current cursor position"
|
||
msgstr "взяти слово в поточній позиції"
|
||
|
||
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
||
msgid "Get word at current cursor position."
|
||
msgstr "Взяти слово у поточній позиції курсора."
|
||
|
||
#: lazarusidestrconsts.lisglobalsettings
|
||
msgid "Global settings"
|
||
msgstr "Глобальні параметри"
|
||
|
||
#: lazarusidestrconsts.lisgotoline
|
||
msgid "Goto Line"
|
||
msgstr "Перейти до рядка"
|
||
|
||
#: lazarusidestrconsts.lisgotoselected
|
||
msgid "Goto selected"
|
||
msgstr "Перейти до вибраного"
|
||
|
||
#: lazarusidestrconsts.lisgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
||
"\n"
|
||
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
||
"\n"
|
||
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
msgstr ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"Ці сирці є відкритим програмним забезпеченням; ви можете поширювати їх та змінювати на умовах ліцензії GNU GPL v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. \n"
|
||
"\n"
|
||
"Цей код поширюється з надією, що він буде корисними, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується його придатність для певної мети. Докладнішу інформацію дивіться у ліцензії GNU GPL. \n"
|
||
"\n"
|
||
"Копія ліцензії доступна у Всесвітній мережі за адресою <http://www.gnu.org/copyleft/gpl.html>. Ви також можете отримати її, написавши листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
|
||
#: lazarusidestrconsts.lisgroup
|
||
msgid "Group"
|
||
msgstr "Група"
|
||
|
||
#: lazarusidestrconsts.lisgroupassignexisting
|
||
msgid "Assign to existing \"%s\" group?"
|
||
msgstr "Присвоїти до наявної \"%s\" групи?"
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydelete
|
||
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
||
msgstr "До групи \"%s\" більше не призначено точок зупинки, видалити її?"
|
||
|
||
#: lazarusidestrconsts.lisgroupemptydeletemore
|
||
msgid "%sThere are %d more empty groups, delete all?"
|
||
msgstr "%sЄ ще %d порожніх груп, видалити всі?"
|
||
|
||
#: lazarusidestrconsts.lisgrouplocalvariables
|
||
msgid "Group automatically defined local variables"
|
||
msgstr "Групувати автоматично визначені локальні змінні"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
||
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
||
msgstr "Назва групи не може бути порожня. Очистити груп(и) точок зупинки?"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinput
|
||
msgid "Group name:"
|
||
msgstr "Назва групи:"
|
||
|
||
#: lazarusidestrconsts.lisgroupnameinvalid
|
||
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
||
msgstr "Назва ГрупиТочокЗупинки має бути дійсною назвою ідентифікатора."
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnew
|
||
msgid "Set new group ..."
|
||
msgstr "Задати нову групу ..."
|
||
|
||
#: lazarusidestrconsts.lisgroupsetnone
|
||
msgid "Clear group(s)"
|
||
msgstr "Очистити груп(и)"
|
||
|
||
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
||
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
||
msgstr "Увімкнення або вимкнення груп виводу зневаджувача. Варіанти:"
|
||
|
||
#: lazarusidestrconsts.lisgrowtolarges
|
||
msgid "Grow to Largest"
|
||
msgstr "Зростання до найбільшого"
|
||
|
||
#: lazarusidestrconsts.lishashelp
|
||
msgid "Has Help"
|
||
msgstr "Має довідку"
|
||
|
||
#: lazarusidestrconsts.lisheadercolors
|
||
msgid "Header colors"
|
||
msgstr "Кольори заголовка"
|
||
|
||
#: lazarusidestrconsts.lisheadercommentforclass
|
||
msgid "Header comment for class"
|
||
msgstr "Коментар заголовка для класу"
|
||
|
||
#: lazarusidestrconsts.lishelp
|
||
msgctxt "lazarusidestrconsts.lishelp"
|
||
msgid "Help"
|
||
msgstr "Довідка"
|
||
|
||
#: lazarusidestrconsts.lishelpentries
|
||
msgid "Help entries"
|
||
msgstr "Розділи довідки"
|
||
|
||
#: lazarusidestrconsts.lishelpselectordialog
|
||
msgid "Help selector"
|
||
msgstr "Селектор довідки"
|
||
|
||
#: lazarusidestrconsts.lishexadecimal
|
||
msgid "Hexadecimal"
|
||
msgstr "Шістнадцяткове"
|
||
|
||
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
||
msgid "Help for Free Pascal Compiler message"
|
||
msgstr "Довідка до повідомлень компілятора Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
||
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
||
msgstr "Приховати всі поради і попередження, вставивши директиву ІСР {%H-}"
|
||
|
||
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
||
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
||
msgstr "Приховати повідомлення у позиції %s вставлянням директиви ІСР {%H-}"
|
||
|
||
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
||
msgid "Hide message by inserting IDE directive {%H-}"
|
||
msgstr "Приховати повідомлення, вставивши директиву ІСР {%H-}"
|
||
|
||
#: lazarusidestrconsts.lishidesearch
|
||
msgid "Hide Search"
|
||
msgstr "Приховати засіб пошуку"
|
||
|
||
#: lazarusidestrconsts.lishidewindow
|
||
msgctxt "lazarusidestrconsts.lishidewindow"
|
||
msgid "Hide window"
|
||
msgstr "Сховати вікно"
|
||
|
||
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
||
msgid "Hide with package option (-vm%s)"
|
||
msgstr "Приховати за допомогою параметра пакунка (-vm%s)"
|
||
|
||
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
||
msgid "Hide with project option (-vm%s)"
|
||
msgstr "Приховати за допомогою параметра проекту (-vm%s)"
|
||
|
||
#: lazarusidestrconsts.lishint
|
||
msgctxt "lazarusidestrconsts.lishint"
|
||
msgid "Hint"
|
||
msgstr "Підказка"
|
||
|
||
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
||
msgid "Hint: A default value can be defined in the conditionals."
|
||
msgstr "Порада: типове значення може бути задане в умовних."
|
||
|
||
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
||
msgid "A hint at property's name shows its description."
|
||
msgstr "Спливна підказка для назви властивості показує її опис"
|
||
|
||
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
||
msgid "Hint: Check if two packages contain a unit with the same name."
|
||
msgstr "Порада: перевірте чи два пакунки містять модуль з однією назвою."
|
||
|
||
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
||
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
||
msgstr "Підказка: натисніть \"Показати параметри\", щоб з'ясувати, звідки було взято успадковані шляхи."
|
||
|
||
#: lazarusidestrconsts.lishints
|
||
msgid ", Hints: %s"
|
||
msgstr ", Підказки: %s"
|
||
|
||
#: lazarusidestrconsts.lishintsaveall
|
||
msgid "Save all"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts.lishintstepinto
|
||
msgid "Step Into"
|
||
msgstr "На крок із входом"
|
||
|
||
#: lazarusidestrconsts.lishintstepout
|
||
msgid "Run until function returns"
|
||
msgstr "Виконати до повернення результату функції"
|
||
|
||
#: lazarusidestrconsts.lishintstepover
|
||
msgid "Step Over"
|
||
msgstr "На крок в обхід"
|
||
|
||
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
||
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
||
msgstr "Довідка: функція Створити Рядок Ресурсів вимагає рядкової константи.%sВиберіть вираз і спробуйте спочатку."
|
||
|
||
#: lazarusidestrconsts.lishinttoggleformunit
|
||
msgid "Toggle Form/Unit"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts.lishintviewforms
|
||
msgid "View Forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts.lishintviewunits
|
||
msgid "View Units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.lishitcount
|
||
msgid "Hitcount"
|
||
msgstr "К-сть влучень"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsdatabases
|
||
msgid "Databases"
|
||
msgstr "Бази даних"
|
||
|
||
#: lazarusidestrconsts.lishlpoptshelpoptions
|
||
msgid "Help Options"
|
||
msgstr "Параметри довідки"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsproperties
|
||
msgid "Properties:"
|
||
msgstr "Властивості:"
|
||
|
||
#: lazarusidestrconsts.lishlpoptsviewers
|
||
msgid "Viewers"
|
||
msgstr "Переглядачі"
|
||
|
||
#: lazarusidestrconsts.lishofpcdochtmlpath
|
||
msgid "FPC Doc HTML Path"
|
||
msgstr "HTML шлях до FPC документації"
|
||
|
||
#: lazarusidestrconsts.lishorizontal
|
||
msgid "Horizontal"
|
||
msgstr "Горизонтальний"
|
||
|
||
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
||
msgid "Horizontal lines between properties."
|
||
msgstr "Горизонтальні лінії між властивостями."
|
||
|
||
#: lazarusidestrconsts.lisid
|
||
msgctxt "lazarusidestrconsts.lisid"
|
||
msgid "ID"
|
||
msgstr "ID"
|
||
|
||
#: lazarusidestrconsts.lisidcaddition
|
||
msgid "Addition"
|
||
msgstr "Додавання"
|
||
|
||
#: lazarusidestrconsts.lisidcopening
|
||
msgid "Opening"
|
||
msgstr "Відкривання"
|
||
|
||
#: lazarusidestrconsts.liside
|
||
msgid "IDE"
|
||
msgstr "ІСР"
|
||
|
||
#: lazarusidestrconsts.lisidebuildoptions
|
||
msgid "IDE build options"
|
||
msgstr "Параметри збирання ІСР"
|
||
|
||
#: lazarusidestrconsts.lisidecompileandrestart
|
||
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
||
msgstr "Під час встановлення/видалення пакунків ІСР буде перекомпільовано і перезапущено."
|
||
|
||
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
||
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
||
msgstr "Ласкаво просимо до Lazarus.%0:sЗнайдені налаштування ІСР використовувались іншим примірником Lazarus.%0:sДва або більше примірників Lazarus не повинні мати спільну конфігурацію. Це може спричинити конфлікти і неможливість використання Lazarus.%0:s%0:sЯкщо ви маєте лише один примірник і скопіювали або перемістили виконуваний файл Lazarus, налаштування можна оновити.%0:s%1:s%0:s%0:sВиберіть:%0:s%0:s* Оновити дані: Використовувати цю конфігурацію і оновити її для подальшого використання. Старий примірник Lazarus більше не буде її використовувати.%0:s* Знехтувати: Використовувати цю конфігурацію, але попереджувати надалі. Це може спричинити конфлікти з іншими примірниками Lazarus.%0:s* Перервати: Завершити роботу. Проблему можна буде виправити, запустивши Lazarus з правильною конфігурацією.%0:s%0:sДодаткова інформація:%0:sЦя конфігурація знаходиться у: %2:s%0:sВона належить примірнику Lazarus у: %3:s%0:sПоточний примірник ІСР запущено з: %4:s%0:s"
|
||
|
||
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
||
msgid "Creating Makefile for package %s"
|
||
msgstr "Створюю Makefile для пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
||
msgid "Error: running 'compile after' tool failed for package %s"
|
||
msgstr "Помилка: для пакунка %s не вдалось виконати засіб, визначений для виконання після компіляції"
|
||
|
||
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
||
msgid "Information about the IDE"
|
||
msgstr "Інформація про ІСР"
|
||
|
||
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
||
msgid "WARNING: unit name invalid %s, package=%s"
|
||
msgstr "УВАГА: неправильна назва модуля %s, пакунок=%s"
|
||
|
||
#: lazarusidestrconsts.lisidemacros
|
||
msgid "IDE Macros"
|
||
msgstr "Макрос ІСР"
|
||
|
||
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
||
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
||
msgid "The IDE maintains the title in main unit."
|
||
msgstr "ІСР зберігає заголовок у головному модулі"
|
||
|
||
#: lazarusidestrconsts.lisidentifier
|
||
msgid "identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisidentifierbeginswith
|
||
msgid "Identifier begins with ..."
|
||
msgstr "Ідентифікатор починається з ..."
|
||
|
||
#: lazarusidestrconsts.lisidentifiercontains
|
||
msgid "Identifier contains ..."
|
||
msgstr "Ідентифікатор вміщує ..."
|
||
|
||
#: lazarusidestrconsts.lisideoptions
|
||
msgid "IDE Options:"
|
||
msgstr "Параметри ІСР:"
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
||
msgid "IDE title shows selected build mode"
|
||
msgstr "Показувати у заголовку ІСР вибраний режим збирання"
|
||
|
||
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
||
msgid "IDE title shows project directory"
|
||
msgstr "Показувати у заголовку ІСР теку проекту"
|
||
|
||
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
||
msgid "IDE title starts with project name"
|
||
msgstr "Заголовок ІСР починається з назви проекту"
|
||
|
||
#: lazarusidestrconsts.lisiecoallbuildmodes
|
||
msgid "All build modes"
|
||
msgstr "Всі режими збирання"
|
||
|
||
#: lazarusidestrconsts.lisiecocompileroptionsof
|
||
msgid "Compiler options of"
|
||
msgstr "Параметри компілятора для"
|
||
|
||
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
||
msgid "Current build mode"
|
||
msgstr "Поточний режим збирання"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroropeningxml
|
||
msgid "Error opening XML"
|
||
msgstr "Помилка відкривання XML"
|
||
|
||
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
||
msgid "Error opening XML file \"%s\":%s%s"
|
||
msgstr "Помилка відкривання файлу XML \"%s\":%s%s"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
||
msgid "Export Compiler Options"
|
||
msgstr "Експортувати параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexists
|
||
msgid "Export file exists"
|
||
msgstr "Експортований файл існує"
|
||
|
||
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
||
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
||
msgstr "Експортований файл \"%s\" існує.%sВідкрити файл і замінити тільки параметри компілятора?%s(Решту налаштувань буде збережено.)"
|
||
|
||
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
||
msgid "Import Compiler Options"
|
||
msgstr "Імпортувати параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.lisiecoloadfromfile
|
||
msgid "Load from file"
|
||
msgstr "Завантажити з файлу"
|
||
|
||
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
||
msgid "File \"%s\" does not contain compiler options."
|
||
msgstr "Файл \"%s\" не містить параметрів компілятора."
|
||
|
||
#: lazarusidestrconsts.lisiecorecentfiles
|
||
msgid "Recent files"
|
||
msgstr "Недавні файли"
|
||
|
||
#: lazarusidestrconsts.lisiecosavetofile
|
||
msgid "Save to file"
|
||
msgstr "Зберегти в файл"
|
||
|
||
#: lazarusidestrconsts.lisifnotchecked
|
||
msgid "If not checked:"
|
||
msgstr "Якщо не позначено:"
|
||
|
||
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
||
msgid "If only the session info changed, ask about saving it."
|
||
msgstr "Якщо змінилась лише інформація про сеанс, запитувати перед її збереженням"
|
||
|
||
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
||
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
||
msgstr "Якщо ви хочете використовувати дві різні версії Lazarus ви повинні запустити інший Lazarus з параметром командного рядка primary-config-path чи pcp.%sНаприклад:"
|
||
|
||
#: lazarusidestrconsts.lisignore
|
||
msgctxt "lazarusidestrconsts.lisignore"
|
||
msgid "Ignore"
|
||
msgstr "Знехтувати"
|
||
|
||
#: lazarusidestrconsts.lisignoreall
|
||
msgid "Ignore all"
|
||
msgstr "Знехтувати все"
|
||
|
||
#: lazarusidestrconsts.lisignoreandcontinue
|
||
msgid "Ignore and continue"
|
||
msgstr "Знехтувати і продовжити"
|
||
|
||
#: lazarusidestrconsts.lisignorebinaries
|
||
msgid "Ignore binaries"
|
||
msgstr "Ігнорувати двійкові"
|
||
|
||
#: lazarusidestrconsts.lisignoreexceptiontype
|
||
msgid "Ignore this exception type"
|
||
msgstr "Ігнорувати цей тип винятків"
|
||
|
||
#: lazarusidestrconsts.lisignoreuseasancestor
|
||
msgid "Ignore, use %s as ancestor"
|
||
msgstr "Знехтувати, використати %s як предка"
|
||
|
||
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
||
msgid "Imitate indentation of current unit, project or package"
|
||
msgstr "Наслідувати відступ поточного модуля, проекту або пакунка"
|
||
|
||
#: lazarusidestrconsts.lisimplementationcommentforclass
|
||
msgid "Implementation comment for class"
|
||
msgstr "Коментар перед реалізацією класу"
|
||
|
||
#: lazarusidestrconsts.lisimport
|
||
msgctxt "lazarusidestrconsts.lisimport"
|
||
msgid "Import"
|
||
msgstr "Імпортувати"
|
||
|
||
#: lazarusidestrconsts.lisimportant
|
||
msgctxt "lazarusidestrconsts.lisimportant"
|
||
msgid "Important"
|
||
msgstr "Важливо"
|
||
|
||
#: lazarusidestrconsts.lisimportenvironmentoptions
|
||
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
||
msgid "Import environment options"
|
||
msgstr "Імпортувати параметри оточення"
|
||
|
||
#: lazarusidestrconsts.lisimportfromfile
|
||
msgid "Import from File"
|
||
msgstr "Імпортувати з файлу"
|
||
|
||
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
||
msgid "Importing BuildModes is not supported for packages."
|
||
msgstr "Імпорт режимів збирання не підтримується для пакунків."
|
||
|
||
#: lazarusidestrconsts.lisimportlist
|
||
msgid "Import list"
|
||
msgstr "Список імпорту"
|
||
|
||
#: lazarusidestrconsts.lisimportpackagelistxml
|
||
msgid "Import package list (*.xml)"
|
||
msgstr "Імпортувати список пакунків (*.xml)"
|
||
|
||
#: lazarusidestrconsts.lisimpossible
|
||
msgid "Impossible"
|
||
msgstr "Неможливо"
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
||
msgid "In a source directory of the package \"%s\"."
|
||
msgstr "В джерельній теці пакунка \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
||
msgid "In a source directory of the project. Check for duplicates."
|
||
msgstr "В теці початкових кодів проекту. Перевірте на дублікати."
|
||
|
||
#: lazarusidestrconsts.lisincludeallsubdirectories
|
||
msgid "Include all subdirectories"
|
||
msgstr "Включно з усіма підтеками"
|
||
|
||
#: lazarusidestrconsts.lisincludefilter
|
||
msgid "Include filter"
|
||
msgstr "Фільтр для вибору"
|
||
|
||
#: lazarusidestrconsts.lisincludepath
|
||
msgid "include path"
|
||
msgstr "шлях доданих файлів"
|
||
|
||
#: lazarusidestrconsts.lisincludepaths
|
||
msgid "Include paths"
|
||
msgstr "Шляхи до файлів для включення"
|
||
|
||
#: lazarusidestrconsts.lisincludesubdirectories
|
||
msgid "Include subdirectories"
|
||
msgstr "Включно з підтеками"
|
||
|
||
#: lazarusidestrconsts.lisincompatibleppu
|
||
msgid ", incompatible ppu=%s"
|
||
msgstr ", несумісний PPU=%s"
|
||
|
||
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
||
msgid "Incorrect configuration directory found"
|
||
msgstr "Знайдена неправильна тека конфігурації"
|
||
|
||
#: lazarusidestrconsts.lisindentationforpascalsources
|
||
msgid "Indentation for Pascal sources"
|
||
msgstr "Відступи для сирців Pascal"
|
||
|
||
#: lazarusidestrconsts.lisindex
|
||
msgid "Index"
|
||
msgstr "Індекс"
|
||
|
||
#: lazarusidestrconsts.lisinformation
|
||
msgid "Information"
|
||
msgstr "Інформація"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutunit
|
||
msgid "Information about %s"
|
||
msgstr "Інформація про %s"
|
||
|
||
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
||
msgid "Information about used FPC"
|
||
msgstr "Інфо про використаний FPC"
|
||
|
||
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
||
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
||
msgstr "У шляху пошуку модулів FPC. Ймовірно, встановлено пакунок FPC. Переконайтеся в тому, компілятор і ppu файл з одного встановлення."
|
||
|
||
#: lazarusidestrconsts.lisinfrontofrelated
|
||
msgid "In front of related"
|
||
msgstr "Перед пов'язаними"
|
||
|
||
#: lazarusidestrconsts.lisinheriteditem
|
||
msgid "Inherited Item"
|
||
msgstr "Успадкований Елемент"
|
||
|
||
#: lazarusidestrconsts.lisinheritedparameters
|
||
msgid "Inherited parameters"
|
||
msgstr "Успадковані параметри"
|
||
|
||
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
||
msgid "Inherited project component"
|
||
msgstr "Успадкований компонент проекту"
|
||
|
||
#: lazarusidestrconsts.lisinitializelocalvariable
|
||
msgid "Initialize Local Variable"
|
||
msgstr "Ініціалізувати локальну змінну"
|
||
|
||
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
||
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
||
msgstr "Для того, щоб створити чисту копію проекту/пакунка, всі файли в даній теці будуть видалені і весь її вміст буде втрачено.%sВидалити всі файли в \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisinsert
|
||
msgctxt "lazarusidestrconsts.lisinsert"
|
||
msgid "Insert"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lisinsertassignment
|
||
msgid "Insert Assignment %s := ..."
|
||
msgstr "Вставити присвоєння %s := ..."
|
||
|
||
#: lazarusidestrconsts.lisinsertdate
|
||
msgid "insert date"
|
||
msgstr "Вставити дату"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtime
|
||
msgid "insert date and time"
|
||
msgstr "Вставити дату і час"
|
||
|
||
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
||
msgid "Insert date and time. Optional: format string."
|
||
msgstr "Вставити дату і час. Можливо: рядок формату."
|
||
|
||
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
||
msgid "Insert date. Optional: format string."
|
||
msgstr "Вставити дату. Можливо: рядок формату."
|
||
|
||
#: lazarusidestrconsts.lisinsertendifneeded
|
||
msgid "insert end if needed"
|
||
msgstr "вставити кінець якщо потрібно"
|
||
|
||
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
||
msgid ""
|
||
"Insert header of current procedure.\n"
|
||
"\n"
|
||
"Optional Parameters (comma separated):\n"
|
||
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
||
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
||
"AddClassName, // extract/add ClassName.\n"
|
||
"WithoutClassName, // skip classname\n"
|
||
"WithoutName, // skip function name\n"
|
||
"WithoutParamList, // skip param list\n"
|
||
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
||
"WithParameterNames, // extract parameter names\n"
|
||
"WithoutParamTypes, // skip colon, param types and default values\n"
|
||
"WithDefaultValues, // extract default values\n"
|
||
"WithResultType, // extract colon + result type\n"
|
||
"WithOfObject, // extract 'of object'\n"
|
||
"WithCallingSpecs, // extract cdecl; inline;\n"
|
||
"WithProcModifiers, // extract forward; alias; external;\n"
|
||
"WithComments, // extract comments and spaces\n"
|
||
"InUpperCase, // turn to uppercase\n"
|
||
"CommentsToSpace, // replace comments with a single space\n"
|
||
" // (default is to skip unnecessary space,\n"
|
||
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
||
" // with this option you get 'Do ;')\n"
|
||
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
||
"WithoutSemicolon, // skip semicolon at end\n"
|
||
msgstr ""
|
||
"Вставити заголовок поточної процедури.\n"
|
||
"\n"
|
||
"Необов'язкові параметри (відокремлені комою):\n"
|
||
"WithStart, // ключове слово процедури, напр. 'function', 'class procedure'\n"
|
||
"WithoutClassKeyword,// без ключового слова 'class'\n"
|
||
"AddClassName, // видобути/додати назву класу.\n"
|
||
"WithoutClassName, // пропустити назву класу\n"
|
||
"WithoutName, // пропустити назву функції\n"
|
||
"WithoutParamList, // пропустити список параметрів\n"
|
||
"WithVarModifiers, // видобути 'var', 'out', 'const'\n"
|
||
"WithParameterNames, // видобути назви параметрів\n"
|
||
"WithoutParamTypes, // пропустити двокрапки, типи параметрів і типові значення\n"
|
||
"WithDefaultValues, // видобути типові значення\n"
|
||
"WithResultType, // видобути двокрапку + тип результату\n"
|
||
"WithOfObject, // видобути 'of object'\n"
|
||
"WithCallingSpecs, // видобути cdecl; inline;\n"
|
||
"WithProcModifiers, // видобути forward; alias; external;\n"
|
||
"WithComments, // видобути коментарі і пропуски\n"
|
||
"InUpperCase, // перевести в верхній регістр\n"
|
||
"CommentsToSpace, // замінити коментарі одиничними пропусками\n"
|
||
" // (типовим є опускання зайвих пропусків,\n"
|
||
" // напр. 'Do ;' зазвичай стає 'Do;'\n"
|
||
" // а з цим параметром отримаєте 'Do ;')\n"
|
||
"WithoutBrackets, // опустити початкову і кінцеву дужки списку параметрів\n"
|
||
"WithoutSemicolon, // опустити крапку з комою в кінці\n"
|
||
|
||
#: lazarusidestrconsts.lisinsertmacro
|
||
msgctxt "lazarusidestrconsts.lisinsertmacro"
|
||
msgid "Insert Macro"
|
||
msgstr "Вставити макрос"
|
||
|
||
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
||
msgid "Insert name of current procedure."
|
||
msgstr "Вставити назву поточної процедури."
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag
|
||
msgid "Insert PrintShort tag"
|
||
msgstr "Вставити тег PrintShort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprintshorttag2
|
||
msgid "Insert printshort tag"
|
||
msgstr "Вставити тег printshort"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurehead
|
||
msgid "insert procedure head"
|
||
msgstr "вставити заголовок процедури"
|
||
|
||
#: lazarusidestrconsts.lisinsertprocedurename
|
||
msgid "insert procedure name"
|
||
msgstr "вставити назву процедури"
|
||
|
||
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
||
msgid "Insert semicolon if needed"
|
||
msgstr "Вставити за потреби крапку з комою"
|
||
|
||
#: lazarusidestrconsts.lisinserttime
|
||
msgid "insert time"
|
||
msgstr "вставити час"
|
||
|
||
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
||
msgid "Insert time. Optional: format string."
|
||
msgstr "Вставити час. Можливо: рядок формату."
|
||
|
||
#: lazarusidestrconsts.lisinserturltag
|
||
msgid "Insert url tag"
|
||
msgstr "Вставити тег url"
|
||
|
||
#: lazarusidestrconsts.lisinsession
|
||
msgid "In session"
|
||
msgstr "В сесії"
|
||
|
||
#: lazarusidestrconsts.lisinspect
|
||
msgid "&Inspect"
|
||
msgstr "&Перевірити"
|
||
|
||
#: lazarusidestrconsts.lisinspectclassinherit
|
||
msgid "%s : Class %s inherits from %s"
|
||
msgstr "%s : Клас %s успадковує від %s"
|
||
|
||
#: lazarusidestrconsts.lisinspectdata
|
||
msgid "Data"
|
||
msgstr "Дані"
|
||
|
||
#: lazarusidestrconsts.lisinspectdialog
|
||
msgid "Debug Inspector"
|
||
msgstr "Інспектор зневадження"
|
||
|
||
#: lazarusidestrconsts.lisinspectmethods
|
||
msgid "Methods"
|
||
msgstr "Методи"
|
||
|
||
#: lazarusidestrconsts.lisinspectpointerto
|
||
msgid "Pointer to %s"
|
||
msgstr "Вказівник на %s"
|
||
|
||
#: lazarusidestrconsts.lisinspectproperties
|
||
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
||
msgid "Properties"
|
||
msgstr "Властивості"
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcolclass
|
||
msgid "Show class column"
|
||
msgstr "Показати стовпець класу"
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcoltype
|
||
msgid "Show type column"
|
||
msgstr "Показати стовпець типу"
|
||
|
||
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
||
msgid "Show visibility column"
|
||
msgstr "Показати стовпець видимості"
|
||
|
||
#: lazarusidestrconsts.lisinspectunavailable
|
||
msgid "%s : unavailable"
|
||
msgstr "%s : недоступне"
|
||
|
||
#: lazarusidestrconsts.lisinspectuseinstance
|
||
msgid "Instance"
|
||
msgstr "Примірник"
|
||
|
||
#: lazarusidestrconsts.lisinspectuseinstancehint
|
||
msgid "Use instance class"
|
||
msgstr "Використати клас примірника"
|
||
|
||
#: lazarusidestrconsts.lisinstallationfailed
|
||
msgid "Installation failed"
|
||
msgstr "Встановлення не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisinstalled
|
||
msgid "installed"
|
||
msgstr "Встановлено"
|
||
|
||
#: lazarusidestrconsts.lisinstallitilikethefat
|
||
msgid "Install it, I like the fat"
|
||
msgstr "Встанови його, мені подобається жир"
|
||
|
||
#: lazarusidestrconsts.lisinstallselection
|
||
msgid "Install selection"
|
||
msgstr "Встановити вибране"
|
||
|
||
#: lazarusidestrconsts.lisinstalluninstallpackages
|
||
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
|
||
msgid "Install/Uninstall Packages"
|
||
msgstr "Встановлення/Видалення Пакунків"
|
||
|
||
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
||
msgid "Instead of compile package create a simple Makefile."
|
||
msgstr "Замість компілювання пакунка створити простий Makefile."
|
||
|
||
#: lazarusidestrconsts.lisinsufficientencoding
|
||
msgid "Insufficient encoding"
|
||
msgstr "Непідхоже кодування"
|
||
|
||
#: lazarusidestrconsts.lisinteractive
|
||
msgid "Interactive"
|
||
msgstr "Інтерактивний"
|
||
|
||
#: lazarusidestrconsts.lisinternalerror
|
||
msgid "internal error: %s"
|
||
msgstr "внутрішня помилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidcommand
|
||
msgid "Invalid command"
|
||
msgstr "Неправильна команда"
|
||
|
||
#: lazarusidestrconsts.lisinvaliddelete
|
||
msgid "Invalid delete"
|
||
msgstr "Неприпустиме видалення"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexecutable
|
||
msgid "Invalid Executable"
|
||
msgstr "Неправильний виконуваний файл"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
||
msgid "The file \"%s\" is not executable."
|
||
msgstr "Файл \"%s\" не є виконуваним."
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpression
|
||
msgid "Invalid expression:%s%s%s%s"
|
||
msgstr "Неприпустимий вираз:%s%s%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
||
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
||
msgstr "Неправильний вираз.%sДовідка: функція \"Створити Рядок Ресурсів\" вимагає рядкової константи в одному файлі. Виділіть вираз і спробуйте ще."
|
||
|
||
#: lazarusidestrconsts.lisinvalidfilter
|
||
msgid "Invalid filter"
|
||
msgstr "Неправильний фільтр"
|
||
|
||
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
||
msgid "Invalid line, column in message%s%s"
|
||
msgstr "Неприпустимий рядок, стовпець в повідомленні%s%s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrosin
|
||
msgid "Invalid macros in \"%s\""
|
||
msgstr "Неправильний макрос у \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
||
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
||
msgstr "Неправильний макрос \"%s\" у зовнішньому засобі \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
||
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
||
msgstr "Недійсний макрос \"%s\". Назва макросу має бути ідентифікатором Pascal."
|
||
|
||
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
||
msgid "Invalid macro name \"%s\". The name is a keyword."
|
||
msgstr "Недійсна назва макросу \"%s\". Назва є ключовим словом."
|
||
|
||
#: lazarusidestrconsts.lisinvalidmask
|
||
msgid "Invalid Mask"
|
||
msgstr "Неправильна маска"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmode
|
||
msgid "Invalid mode %s"
|
||
msgstr "Неправильний режим %s"
|
||
|
||
#: lazarusidestrconsts.lisinvalidmultiselection
|
||
msgid "Invalid multiselection"
|
||
msgstr "Неправильний множинний вибір"
|
||
|
||
#: lazarusidestrconsts.lisinvalidoff
|
||
msgid "Invalid (Off)"
|
||
msgstr "Неправильний (Вимк)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidon
|
||
msgid "Invalid (On)"
|
||
msgstr "Неправильний (Увімк)"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
||
msgid "Invalid Pascal Identifier"
|
||
msgstr "Некоректний ідентифікатор паскаля"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
||
msgid "The name \"%s\" is not a valid Pascal identifier."
|
||
msgstr "Назва \"%s\" не є правильним ідентифікатором мови Pascal."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprocname
|
||
msgid "Invalid proc name"
|
||
msgstr "Неправильна назва проц."
|
||
|
||
#: lazarusidestrconsts.lisinvalidprojectfilename
|
||
msgid "Invalid project filename"
|
||
msgstr "Неправильна назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
||
msgid "Invalid publishing Directory"
|
||
msgstr "Неправильна тека публікації"
|
||
|
||
#: lazarusidestrconsts.lisinvalidselection
|
||
msgid "Invalid selection"
|
||
msgstr "Неправильний вибір"
|
||
|
||
#: lazarusidestrconsts.lisinvalidversionin
|
||
msgid "invalid version in %s"
|
||
msgstr "неправильна версія у %s"
|
||
|
||
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
||
msgid "%s is already part of the Project."
|
||
msgstr "%s вже є частиною проекту."
|
||
|
||
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
||
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
||
msgstr "\"%s\" не є коректною назвою проекту.%s Виберіть іншу (напр., project1.lpi)"
|
||
|
||
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
||
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
||
msgstr "%s це %s.%sЦя кругова залежність не допускається."
|
||
|
||
#: lazarusidestrconsts.lisisddirectorynotfound
|
||
msgid "directory not found"
|
||
msgstr "директорія не знайдена"
|
||
|
||
#: lazarusidestrconsts.lisissues
|
||
msgid "Issues"
|
||
msgstr "Питання"
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||
msgid "I wonder how you did that. Error in the %s:"
|
||
msgstr "Цікаво, як ви це зробили. Помилка в %s:"
|
||
|
||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||
msgid "I wonder how you did that: Error in the base directory:"
|
||
msgstr "Цікаво, як ви це зробили. Помилка у базовій теці:"
|
||
|
||
#: lazarusidestrconsts.lisjhjumphistory
|
||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Історія Переходів"
|
||
|
||
#: lazarusidestrconsts.lisjumptoerror
|
||
msgid "Jump to error"
|
||
msgstr "Перейти до помилки"
|
||
|
||
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
||
msgid "When an error in the sources is found at identifier completion, jump to it."
|
||
msgstr "Переходити до помилки, виявленої у сирцях при завершенні ідентифікатора."
|
||
|
||
#: lazarusidestrconsts.lisjumptoprocedure
|
||
msgid "Jump to procedure %s"
|
||
msgstr "Перейти до процедури %s"
|
||
|
||
#: lazarusidestrconsts.liskb
|
||
msgid "%s KB"
|
||
msgstr "%s КБ"
|
||
|
||
#: lazarusidestrconsts.liskeep2
|
||
msgid "Keep"
|
||
msgstr "Залишити"
|
||
|
||
#: lazarusidestrconsts.liskeepfileopen
|
||
msgid "Keep converted files open in editor"
|
||
msgstr "Залишити конвертовані файли відкритими в редакторі"
|
||
|
||
#: lazarusidestrconsts.liskeepfileopenhint
|
||
msgid "All project files will be open in editor after conversion"
|
||
msgstr "Всі файли проекту буде відкрито в редакторі після перетворення"
|
||
|
||
#: lazarusidestrconsts.liskeepininstalllist
|
||
msgid "Keep in install list"
|
||
msgstr "Залишити в списку встановлення"
|
||
|
||
#: lazarusidestrconsts.liskeepname
|
||
msgid "Keep name"
|
||
msgstr "Залишати назву"
|
||
|
||
#: lazarusidestrconsts.liskeepopen
|
||
msgid "Keep open"
|
||
msgstr "Залишити відкритим"
|
||
|
||
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
||
msgid "Keep relative indentation of multi line template"
|
||
msgstr "Зберігати відносний відступ багаторядкового шаблону"
|
||
|
||
#: lazarusidestrconsts.liskeepsubindentation
|
||
msgid "Keep indentation"
|
||
msgstr "Залишити відступи"
|
||
|
||
#: lazarusidestrconsts.liskeepthemandcontinue
|
||
msgid "Keep them and continue"
|
||
msgstr "Залишити їх і продовжити"
|
||
|
||
#: lazarusidestrconsts.liskey
|
||
msgctxt "lazarusidestrconsts.liskey"
|
||
msgid "Key"
|
||
msgstr "Ключ"
|
||
|
||
#: lazarusidestrconsts.liskeycatcustom
|
||
msgid "Custom commands"
|
||
msgstr "Спеціальні команди"
|
||
|
||
#: lazarusidestrconsts.liskeycatdesigner
|
||
msgid "Designer commands"
|
||
msgstr "Команди дизайнера"
|
||
|
||
#: lazarusidestrconsts.liskeycatobjinspector
|
||
msgid "Object Inspector commands"
|
||
msgstr "Команди Інспектора об'єктів"
|
||
|
||
#: lazarusidestrconsts.liskeyor2keysequence
|
||
msgid "Key (or 2 key sequence)"
|
||
msgstr "Клавіша (або двоклавішна комбінація)"
|
||
|
||
#: lazarusidestrconsts.liskmabortbuilding
|
||
msgid "Abort building"
|
||
msgstr "Перервати збирання"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpaddress
|
||
msgid "Add Address Breakpoint"
|
||
msgstr "Додати Адресну Точку зупинки"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpsource
|
||
msgid "Add Source Breakpoint"
|
||
msgstr "Додати Точку зупинки Коду"
|
||
|
||
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
||
msgid "Add Data/WatchPoint"
|
||
msgstr "Додати Дані/ТочкуОгляду"
|
||
|
||
#: lazarusidestrconsts.liskmaddwatch
|
||
msgid "Add watch"
|
||
msgstr "Додати спостереження"
|
||
|
||
#: lazarusidestrconsts.liskmbuildmanymodes
|
||
msgid "Build many modes"
|
||
msgstr "Зібрати в багатьох режимах"
|
||
|
||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||
msgid "Build project/program"
|
||
msgstr "Зібрати проект/програму"
|
||
|
||
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
||
msgid "Choose Keymapping scheme"
|
||
msgstr "Вибір схеми розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts.liskmclassic
|
||
msgid "Classic"
|
||
msgstr "Класичний"
|
||
|
||
#: lazarusidestrconsts.liskmcleanupandbuild
|
||
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
||
msgid "Clean up and build"
|
||
msgstr "Очистити і зібрати"
|
||
|
||
#: lazarusidestrconsts.liskmcloseproject
|
||
msgid "Close project"
|
||
msgstr "Закрити проект"
|
||
|
||
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
||
msgid "CodeTools defines editor"
|
||
msgstr "CodeTools визначає редактор"
|
||
|
||
#: lazarusidestrconsts.liskmcompileprojectprogram
|
||
msgid "Compile project/program"
|
||
msgstr "Компілювати проект/програму"
|
||
|
||
#: lazarusidestrconsts.liskmconfigbuildfile
|
||
msgid "Config \"Build File\""
|
||
msgstr "Налаштувати \"Зібрати файл\""
|
||
|
||
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
||
msgid "Configure Custom Components"
|
||
msgstr "Налаштувати нетипові компонети"
|
||
|
||
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
||
msgid "Context sensitive help"
|
||
msgstr "Контекстна допомога"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||
msgid "Convert Delphi package to Lazarus package"
|
||
msgstr "Перетворення пакунка Delphi на пакунок Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||
msgid "Convert Delphi Project to Lazarus Project"
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||
msgid "Convert Delphi Unit to Lazarus Unit"
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus"
|
||
|
||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||
msgid "Convert DFM File to LFM"
|
||
msgstr "Перетворення файлу DFM в LFM"
|
||
|
||
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
||
#, fuzzy
|
||
#| msgid "Copy selected Components to clipboard"
|
||
msgid "Copy selected components"
|
||
msgstr "Копіювати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
||
#, fuzzy
|
||
#| msgid "Cut selected Components to clipboard"
|
||
msgid "Cut selected components"
|
||
msgstr "Вирізати обрані Компоненти в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.liskmdefaulttoosx
|
||
msgid "Default adapted to OS X"
|
||
msgstr "Типова для адаптації до OS X"
|
||
|
||
#: lazarusidestrconsts.liskmdeletelastchar
|
||
msgid "Delete last char"
|
||
msgstr "Видалення останнього символу"
|
||
|
||
#: lazarusidestrconsts.liskmdiffeditorfiles
|
||
msgid "Diff Editor Files"
|
||
msgstr "Порівняти файли кодів"
|
||
|
||
#: lazarusidestrconsts.liskmeditcodetemplates
|
||
msgid "Edit Code Templates"
|
||
msgstr "Редагувати Коди Шаблонів"
|
||
|
||
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
||
msgid "Edit context sensitive help"
|
||
msgstr "Редагувати контекстну допомогу"
|
||
|
||
#: lazarusidestrconsts.liskmencloseselection
|
||
msgid "Enclose Selection"
|
||
msgstr "Задужкувати вибране"
|
||
|
||
#: lazarusidestrconsts.liskmevaluatemodify
|
||
msgid "Evaluate/Modify"
|
||
msgstr "Обчислити/Змінити"
|
||
|
||
#: lazarusidestrconsts.liskmexampleprojects
|
||
msgid "Example Projects"
|
||
msgstr "Приклади проектів"
|
||
|
||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||
msgid "External Tools settings"
|
||
msgstr "Налаштування Зовнішніх інструментів"
|
||
|
||
#: lazarusidestrconsts.liskmfindincremental
|
||
msgid "Find Incremental"
|
||
msgstr "Знайти за зростанням"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker0
|
||
msgid "Go to bookmark 0"
|
||
msgstr "Перейти до закладки 0"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker1
|
||
msgid "Go to bookmark 1"
|
||
msgstr "Перейти до закладки 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker2
|
||
msgid "Go to bookmark 2"
|
||
msgstr "Перейти до закладки 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker3
|
||
msgid "Go to bookmark 3"
|
||
msgstr "Перейти до закладки 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker4
|
||
msgid "Go to bookmark 4"
|
||
msgstr "Перейти до закладки 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker5
|
||
msgid "Go to bookmark 5"
|
||
msgstr "Перейти до закладки 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker6
|
||
msgid "Go to bookmark 6"
|
||
msgstr "Перейти до закладки 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker7
|
||
msgid "Go to bookmark 7"
|
||
msgstr "Перейти до закладки 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker8
|
||
msgid "Go to bookmark 8"
|
||
msgstr "Перейти до закладки 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotomarker9
|
||
msgid "Go to bookmark 9"
|
||
msgstr "Перейти до закладки 9"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor1
|
||
msgid "Go to source editor 1"
|
||
msgstr "Перейти до редактора коду 1"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor10
|
||
msgid "Go to source editor 10"
|
||
msgstr "Перейти до редактора коду 10"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor2
|
||
msgid "Go to source editor 2"
|
||
msgstr "Перейти до редактора коду 2"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor3
|
||
msgid "Go to source editor 3"
|
||
msgstr "Перейти до редактора коду 3"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor4
|
||
msgid "Go to source editor 4"
|
||
msgstr "Перейти до редактора коду 4"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor5
|
||
msgid "Go to source editor 5"
|
||
msgstr "Перейти до редактора коду 5"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor6
|
||
msgid "Go to source editor 6"
|
||
msgstr "Перейти до редактора коду 6"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor7
|
||
msgid "Go to source editor 7"
|
||
msgstr "Перейти до редактора коду 7"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor8
|
||
msgid "Go to source editor 8"
|
||
msgstr "Перейти до редактора коду 8"
|
||
|
||
#: lazarusidestrconsts.liskmgotosourceeditor9
|
||
msgid "Go to source editor 9"
|
||
msgstr "Перейти до редактора коду 9"
|
||
|
||
#: lazarusidestrconsts.liskminsertdateandtime
|
||
msgid "Insert date and time"
|
||
msgstr "Вставити дату і час"
|
||
|
||
#: lazarusidestrconsts.liskminsertusername
|
||
msgid "Insert username"
|
||
msgstr "Вставити назву користувача"
|
||
|
||
#: lazarusidestrconsts.liskminspect
|
||
msgid "Inspect"
|
||
msgstr "Перевірити"
|
||
|
||
#: lazarusidestrconsts.liskmkeymappingscheme
|
||
msgid "Keymapping Scheme"
|
||
msgstr "Схема розкладки клавіатури"
|
||
|
||
#: lazarusidestrconsts.liskmlazarusdefault
|
||
msgid "Lazarus (default)"
|
||
msgstr "Lazarus (типовий)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxapple
|
||
msgid "Mac OS X (Apple style)"
|
||
msgstr "Mac OS X (стиль Apple)"
|
||
|
||
#: lazarusidestrconsts.liskmmacosxlaz
|
||
msgid "Mac OS X (Lazarus style)"
|
||
msgstr "Mac OS X (стиль Lazarus)"
|
||
|
||
#: lazarusidestrconsts.liskmnewpackage
|
||
msgid "New package"
|
||
msgstr "Новий пакунок"
|
||
|
||
#: lazarusidestrconsts.liskmnewproject
|
||
msgid "New project"
|
||
msgstr "Новий проект"
|
||
|
||
#: lazarusidestrconsts.liskmnewprojectfromfile
|
||
msgid "New project from file"
|
||
msgstr "Новий проект з файлу"
|
||
|
||
#: lazarusidestrconsts.liskmnewunit
|
||
msgctxt "lazarusidestrconsts.liskmnewunit"
|
||
msgid "New Unit"
|
||
msgstr "Новий Модуль"
|
||
|
||
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
||
msgid "Note: All keys will be set to the values of the chosen scheme."
|
||
msgstr "Примітка: Всі ключі будуть встановлені відповідно до обраної схеми."
|
||
|
||
#: lazarusidestrconsts.liskmopenpackagefile
|
||
msgid "Open package file"
|
||
msgstr "Відкриття файлу пакунка"
|
||
|
||
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
||
#, fuzzy
|
||
#| msgid "Paste Components from clipboard"
|
||
msgid "Paste Components"
|
||
msgstr "Вставити компоненти з буферу обміну"
|
||
|
||
#: lazarusidestrconsts.liskmpauseprogram
|
||
msgid "Pause program"
|
||
msgstr "Зупинити програму"
|
||
|
||
#: lazarusidestrconsts.liskmpublishproject
|
||
msgid "Publish project"
|
||
msgstr "Опублікувати проект"
|
||
|
||
#: lazarusidestrconsts.liskmquickcompilenolinking
|
||
msgid "Quick compile, no linking"
|
||
msgstr "Швидке компілювання, без компонування"
|
||
|
||
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
||
msgid "Remove Active File from Project"
|
||
msgstr "Видалити Активний Файл з Проекту"
|
||
|
||
#: lazarusidestrconsts.liskmrunprogram
|
||
msgid "Run program"
|
||
msgstr "Виконати програму"
|
||
|
||
#: lazarusidestrconsts.liskmsaveall
|
||
msgid "SaveAll"
|
||
msgstr "ЗберегтиВсе"
|
||
|
||
#: lazarusidestrconsts.liskmsaveas
|
||
msgid "SaveAs"
|
||
msgstr "ЗберегтиЯк"
|
||
|
||
#: lazarusidestrconsts.liskmsaveproject
|
||
msgid "Save project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts.liskmsaveprojectas
|
||
msgid "Save project as"
|
||
msgstr "Зберегти проект як"
|
||
|
||
#: lazarusidestrconsts.liskmselectlineend
|
||
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
||
msgid "Select Line End"
|
||
msgstr "Виділити кінець рядка"
|
||
|
||
#: lazarusidestrconsts.liskmselectlinestart
|
||
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Виділити початок рядка"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagebottom
|
||
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Виділити низ сторінки"
|
||
|
||
#: lazarusidestrconsts.liskmselectpagetop
|
||
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Виділити верх сторінки"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordleft
|
||
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts.liskmselectwordright
|
||
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts.liskmsetfreebookmark
|
||
msgid "Set free Bookmark"
|
||
msgstr "Встановити Закладку на дереві"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker0
|
||
msgid "Set bookmark 0"
|
||
msgstr "Встановити закладку 0"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker1
|
||
msgid "Set bookmark 1"
|
||
msgstr "Встановити закладку 1"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker2
|
||
msgid "Set bookmark 2"
|
||
msgstr "Встановити закладку 2"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker3
|
||
msgid "Set bookmark 3"
|
||
msgstr "Встановити закладку 3"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker4
|
||
msgid "Set bookmark 4"
|
||
msgstr "Встановити закладку 4"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker5
|
||
msgid "Set bookmark 5"
|
||
msgstr "Встановити закладку 5"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker6
|
||
msgid "Set bookmark 6"
|
||
msgstr "Встановити закладку 6"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker7
|
||
msgid "Set bookmark 7"
|
||
msgstr "Встановити закладку 7"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker8
|
||
msgid "Set bookmark 8"
|
||
msgstr "Встановити закладку 8"
|
||
|
||
#: lazarusidestrconsts.liskmsetmarker9
|
||
msgid "Set bookmark 9"
|
||
msgstr "Встановити закладку 9"
|
||
|
||
#: lazarusidestrconsts.liskmstopprogram
|
||
msgid "Stop Program"
|
||
msgstr "Завершити програму"
|
||
|
||
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
||
msgid "Toggle between Unit and Form"
|
||
msgstr "Перемкнути між модулем і формою"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker0
|
||
msgid "Toggle bookmark 0"
|
||
msgstr "Перемкнути закладку 0"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker1
|
||
msgid "Toggle bookmark 1"
|
||
msgstr "Перемкнути закладку 1"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker2
|
||
msgid "Toggle bookmark 2"
|
||
msgstr "Перемкнути закладку 2"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker3
|
||
msgid "Toggle bookmark 3"
|
||
msgstr "Перемкнути закладку 3"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker4
|
||
msgid "Toggle bookmark 4"
|
||
msgstr "Перемкнути закладку 4"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker5
|
||
msgid "Toggle bookmark 5"
|
||
msgstr "Перемкнути закладку 5"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker6
|
||
msgid "Toggle bookmark 6"
|
||
msgstr "Перемкнути закладку 6"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker7
|
||
msgid "Toggle bookmark 7"
|
||
msgstr "Перемкнути закладку 7"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker8
|
||
msgid "Toggle bookmark 8"
|
||
msgstr "Перемкнути закладку 8"
|
||
|
||
#: lazarusidestrconsts.liskmtogglemarker9
|
||
msgid "Toggle bookmark 9"
|
||
msgstr "Перемкнути закладку 9"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewassembler
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
||
msgid "View Assembler"
|
||
msgstr "Переглянути Асемблер"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
||
msgid "View Breakpoints"
|
||
msgstr "Переглянути Точки Зупинки"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr "Показати стек викликів"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
||
msgid "Toggle view Code Browser"
|
||
msgstr "Перемкнути показ Оглядача коду"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
||
msgid "Toggle view Code Explorer"
|
||
msgstr "Перемкнути до перегляду Коду Explorer"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
||
msgid "Toggle View Component Palette"
|
||
msgstr "Перемкнути до перегляду палітри компонентів"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
||
msgid "View Debuger Event Log"
|
||
msgstr "Переглянути Журнал подій зневаджувача"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
||
msgid "View Debugger Output"
|
||
msgstr "Переглянути повідомлення зневаджувача"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
||
msgid "Toggle view Documentation Editor"
|
||
msgstr "Перемкнути до перегляду Документації Редактора"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewhistory
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
||
msgid "View History"
|
||
msgstr "Переглянути Історію"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
||
msgid "Toggle view IDE speed buttons"
|
||
msgstr "Перемкнути до перегляду гарячих клавіш графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
||
msgid "View Local Variables"
|
||
msgstr "Перегляд локальних змінних"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewmessages
|
||
msgid "Toggle view Messages"
|
||
msgstr "Перемкнути до перегляду Повідомлень"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
||
msgid "Toggle view Object Inspector"
|
||
msgstr "Перемкнути до перегляду Інспектора Об'єктів"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
||
msgid "View Terminal Output"
|
||
msgstr "Показати вивід терміналу"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewregisters
|
||
msgid "View Registers"
|
||
msgstr "Переглянути Регістри"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
||
msgid "Toggle view Search Results"
|
||
msgstr "Перемкнути до перегляду Результатів Пошуку"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
||
msgid "Toggle view Source Editor"
|
||
msgstr "Перемкнути до перегляду Редактора програмного Коду"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewthreads
|
||
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
||
msgid "View Threads"
|
||
msgstr "Переглянути нитки"
|
||
|
||
#: lazarusidestrconsts.liskmtoggleviewwatches
|
||
msgid "View Watches"
|
||
msgstr "Показувати спостереження"
|
||
|
||
#: lazarusidestrconsts.liskmviewjumphistory
|
||
msgid "View jump history"
|
||
msgstr "Переглянути історію переходів"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectoptions
|
||
msgid "View project options"
|
||
msgstr "Переглядання опцій проекту"
|
||
|
||
#: lazarusidestrconsts.liskmviewprojectsource
|
||
msgid "View Project Source"
|
||
msgstr "Переглядання тексту проекту"
|
||
|
||
#: lazarusidestrconsts.liskmviewunitinfo
|
||
msgid "View Unit Info"
|
||
msgstr "Переглянути Інформацію про Модулі"
|
||
|
||
#: lazarusidestrconsts.lislastopened
|
||
msgid "Last opened"
|
||
msgstr "Останнє відкрите"
|
||
|
||
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
||
msgid "Launching application invalid"
|
||
msgstr "Виконуваний застосунок є неправильним"
|
||
|
||
#: lazarusidestrconsts.lislaunchingcmdline
|
||
msgid "Launching target command line"
|
||
msgstr "Командний рядок виконуваної програми"
|
||
|
||
#: lazarusidestrconsts.lislazarus
|
||
msgctxt "lazarusidestrconsts.lislazarus"
|
||
msgid "Lazarus"
|
||
msgstr "Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdefault
|
||
msgid "Lazarus Default"
|
||
msgstr "Типове для Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdirectory
|
||
msgid "Lazarus directory"
|
||
msgstr "Тека Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazarusdiroverride
|
||
msgid "directory, to be used as a basedirectory"
|
||
msgstr "тека, буде використана як базова"
|
||
|
||
#: lazarusidestrconsts.lislazaruseditorv
|
||
msgid "Lazarus IDE v%s"
|
||
msgstr "ІСР Lazarus v%s"
|
||
|
||
#: lazarusidestrconsts.lislazaruside
|
||
msgid "Lazarus IDE"
|
||
msgstr "Графічна оболонка Lazarus"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguageid
|
||
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
||
msgstr "Мова графічної оболонки Lazarus (напр. en, uk, de, br, fi)"
|
||
|
||
#: lazarusidestrconsts.lislazaruslanguagename
|
||
msgid "Lazarus language name (e.g. english, deutsch)"
|
||
msgstr "Назва мови для Lazarus (напр. english, deutsch, ukrainain)"
|
||
|
||
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
||
msgid "lazarus [options] <project-filename>"
|
||
msgstr "lazarus [параметри] <назва файлу проекту>"
|
||
|
||
#: lazarusidestrconsts.lislazbuildaboaction
|
||
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
||
msgid "Action"
|
||
msgstr "Дія"
|
||
|
||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||
msgid "Choose output directory of the IDE executable "
|
||
msgstr "Виберіть вихідний каталог виконуваного файлу ІСР"
|
||
|
||
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
||
msgid "Are you sure you want to delete this build profile?"
|
||
msgstr "Ви точно хочете видалити цей профіль збирання?"
|
||
|
||
#: lazarusidestrconsts.lislazbuildbuildmany
|
||
msgid "Build Many"
|
||
msgstr "Зібрати Багато"
|
||
|
||
#: lazarusidestrconsts.lislazbuildcommonsettings
|
||
msgid "Common Settings"
|
||
msgstr "Загальні Налаштування"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
||
msgid "Confirm before build"
|
||
msgstr "Підтвердити перед збиранням"
|
||
|
||
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
||
msgid "Confirm deletion"
|
||
msgstr "Підтвердьте видалення"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddebugide
|
||
msgid "Debug IDE"
|
||
msgstr "Зневадження ІСР"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefines
|
||
msgid "Defines"
|
||
msgstr "Визначення"
|
||
|
||
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
||
msgid "Defines without -d"
|
||
msgstr "Визначення без -d"
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditdefines
|
||
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
||
msgid "Edit Defines"
|
||
msgstr "Редагувати Визначення"
|
||
|
||
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
||
msgid "Edit list of defines which can be used by any profile"
|
||
msgstr "Редагувати список визначень, які можуть бути використані будь-яким профілем"
|
||
|
||
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Помилка запису файлу"
|
||
|
||
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
||
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
||
msgstr "%s%s%s%slazbuild не інтерактивний, зупиняю зараз."
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
||
msgid "Manage Build Profiles"
|
||
msgstr "Керування профілями збирання"
|
||
|
||
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
||
msgid "Manage profiles"
|
||
msgstr "Керування профілями"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
||
msgid "Name of the active profile"
|
||
msgstr "Назва активного профілю"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprof
|
||
msgid "Add New Profile"
|
||
msgstr "Додати новий профіль"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
||
msgid "Current build options will be associated with:"
|
||
msgstr "Поточні параметри збирання будуть пов'язані з:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildnormalide
|
||
msgid "Normal IDE"
|
||
msgstr "Звичайний ІСР"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptimizedide
|
||
msgid "Optimized IDE"
|
||
msgstr "Оптимізований ІСР"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptions
|
||
msgid "Options:"
|
||
msgstr "Параметри:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
||
msgid "Options passed to compiler"
|
||
msgstr "Опції, передані компілятору"
|
||
|
||
#: lazarusidestrconsts.lislazbuildprofile
|
||
msgid "Profile to build"
|
||
msgstr "Профіль для збирання"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprof
|
||
msgid "Rename Profile"
|
||
msgstr "Перейменувати профіль"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
||
msgid "New name for profile:"
|
||
msgstr "Нова назва для профілю:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
||
msgid "Restart after building IDE"
|
||
msgstr "Перезапустити після збирання ІСР"
|
||
|
||
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
||
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
|
||
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
||
msgstr "Перезапустити Lazarus автоматично після збирання ІСР (не впливає на збирання інших частин)"
|
||
|
||
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
||
msgid "Select profiles to build"
|
||
msgstr "Виберіть профілі для збирання"
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
||
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
|
||
msgid "Show confirmation dialog when building directly from Tools menu"
|
||
msgstr "Показати діалог підтвердження при збиранні безпосередньо з меню Інструментів"
|
||
|
||
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
||
msgid "Show options and defines for command line"
|
||
msgstr "Показувати параметри і визначення для командного рядка"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetcpu
|
||
msgid "Target CPU:"
|
||
msgstr "Для ЦП"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
||
msgid "Target directory:"
|
||
msgstr "Цільова тека:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildtargetos
|
||
msgid "Target OS:"
|
||
msgstr "Для ОС:"
|
||
|
||
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
||
msgid "Unable to write file \"%s\":%s"
|
||
msgstr "Неможливо записати файл \"%s\":%s"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
||
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
|
||
msgid "Update revision.inc"
|
||
msgstr "Оновити revision.inc"
|
||
|
||
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
||
msgid "Update revision info in \"About Lazarus\" dialog"
|
||
msgstr "Оновити дані про ревізію в діалозі \"Про Lazarus\""
|
||
|
||
#: lazarusidestrconsts.lislazcleanupbuildall
|
||
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
|
||
msgid "Clean Up + Build all"
|
||
msgstr "Очистити + Зібрати все"
|
||
|
||
#: lazarusidestrconsts.lislazver
|
||
msgid "Lazarus Version (e.g. 1.2.4)"
|
||
msgstr "Версія Lazarus (наприклад, 1.2.4)"
|
||
|
||
#: lazarusidestrconsts.lislclwidgettype
|
||
msgid "LCL widget type"
|
||
msgstr "Тип LCL widget"
|
||
|
||
#: lazarusidestrconsts.lisldaddlinktoinherited
|
||
msgid "Add link to inherited"
|
||
msgstr "Додати посилання до нащадка"
|
||
|
||
#: lazarusidestrconsts.lisldcopyfrominherited
|
||
msgid "Copy from inherited"
|
||
msgstr "Копіювати з успадкованого"
|
||
|
||
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
||
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
||
msgstr "%s не має діючого шляху FPDoc.%sНеможливо створити файл fpdoc для %s"
|
||
|
||
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
||
msgid "Move entries to inherited"
|
||
msgstr "Пересунути включення до успадкованого"
|
||
|
||
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
||
msgid "No valid FPDoc path"
|
||
msgstr "Немає дійсного шляху FPDoc"
|
||
|
||
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
||
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
||
msgstr "Модуль %s не належить жодному пакунку чи проекту.%sДодайте модуль до пакунка або проекту.%sНеможливо створити fpdoc файл."
|
||
|
||
#: lazarusidestrconsts.lisleft
|
||
msgctxt "lazarusidestrconsts.lisleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||
msgstr "Лівий бордюр. Це значення додається до базового бордюру і використовується для відступу зліва від контролю."
|
||
|
||
#: lazarusidestrconsts.lisleftgroupboxcaption
|
||
msgid "Left anchoring"
|
||
msgstr "Ліве якорювання"
|
||
|
||
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr "Це елемент керування одного рівня, за яким зафіксовано лівий край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
|
||
|
||
#: lazarusidestrconsts.lisleftsides
|
||
msgid "Left sides"
|
||
msgstr "Ліві сторони"
|
||
|
||
#: lazarusidestrconsts.lisleftspaceequally
|
||
msgid "Left space equally"
|
||
msgstr "Лівий простір еквівалентно"
|
||
|
||
#: lazarusidestrconsts.lisless
|
||
msgctxt "lazarusidestrconsts.lisless"
|
||
msgid "Less"
|
||
msgstr "Менше"
|
||
|
||
#: lazarusidestrconsts.lislevels
|
||
msgid "Levels"
|
||
msgstr "Рівні"
|
||
|
||
#: lazarusidestrconsts.lislfmfile
|
||
msgid "LFM file"
|
||
msgstr "LFM файл"
|
||
|
||
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
||
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
||
msgstr "Файл LFM містить невідомі властивості/класи, які не існують у LCL. Їх можна замінити або вилучити."
|
||
|
||
#: lazarusidestrconsts.lislfmfilecorrupt
|
||
msgid "LFM file corrupt"
|
||
msgstr "Зламався файл LFM"
|
||
|
||
#: lazarusidestrconsts.lislfmisok
|
||
msgid "LFM is ok"
|
||
msgstr "LFM справний"
|
||
|
||
#: lazarusidestrconsts.lislgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
||
"\n"
|
||
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
||
"\n"
|
||
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
msgstr ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"Ця бібліотека є вільним програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. \n"
|
||
"\n"
|
||
"Ця програма поширюється з надією, що вона буде корисною, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується її придатність для певної мети. Докладнішу інформацію дивіться в ліцензії GNU LGPL. \n"
|
||
"\n"
|
||
"Ви повинні були отримати копію ліцензії GNU LGPL разом з бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
|
||
#: lazarusidestrconsts.lislibrarypath
|
||
msgid "library path"
|
||
msgstr "шлях до бібліотек"
|
||
|
||
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
||
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
||
msgstr "Спільна бібліотека Free Pascal (.dll під Windows, .so під Linux, .dylib під MacOS X)."
|
||
|
||
#: lazarusidestrconsts.lisline
|
||
msgid "Line:"
|
||
msgstr "Рядок:"
|
||
|
||
#: lazarusidestrconsts.lislinelength
|
||
msgid "Line/Length"
|
||
msgstr "Рядок/Довжина"
|
||
|
||
#: lazarusidestrconsts.lislink
|
||
msgid "Link:"
|
||
msgstr "Посилання:"
|
||
|
||
#: lazarusidestrconsts.lislinkeroptions
|
||
msgid "linker options"
|
||
msgstr "параметри компонувальника"
|
||
|
||
#: lazarusidestrconsts.lislinktarget
|
||
msgid "Link target"
|
||
msgstr "Ціль посилання"
|
||
|
||
#: lazarusidestrconsts.lislistofallcasevalues
|
||
msgid "list of all case values"
|
||
msgstr "список всіх значень case"
|
||
|
||
#: lazarusidestrconsts.lisloadingfailed
|
||
msgid "Loading %s failed."
|
||
msgstr "Завантаження %s провалилось."
|
||
|
||
#: lazarusidestrconsts.lisloadmacrofrom
|
||
msgid "Load macro from"
|
||
msgstr "Завантажити макрос з"
|
||
|
||
#: lazarusidestrconsts.lislocal
|
||
msgid "&Local"
|
||
msgstr "&Локальна"
|
||
|
||
#: lazarusidestrconsts.lislocals
|
||
msgid "Locals"
|
||
msgstr "Локальні"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyname
|
||
msgid "&Copy Name"
|
||
msgstr "&Копіювати назву"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
|
||
msgid "Copy &RAW Value"
|
||
msgstr "Копіювати &сирі значення"
|
||
|
||
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
||
msgid "C&opy Value"
|
||
msgstr "Ко&піювати Значення"
|
||
|
||
#: lazarusidestrconsts.lislocalsnotevaluated
|
||
msgid "Locals not evaluated"
|
||
msgstr "Локальні не оцінені"
|
||
|
||
#: lazarusidestrconsts.lislogcallstack
|
||
msgid "Log Call Stack"
|
||
msgstr "Стек викликів журналу"
|
||
|
||
#: lazarusidestrconsts.lislogcallstacklimit
|
||
msgid "(frames limit. 0 - no limits)"
|
||
msgstr "(межа фреймів. 0 - необмежено)"
|
||
|
||
#: lazarusidestrconsts.lislogevalexpression
|
||
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
||
msgid "Eval expression"
|
||
msgstr "Оцінити вираз"
|
||
|
||
#: lazarusidestrconsts.lislogmessage
|
||
msgid "Log Message"
|
||
msgstr "Повідомлення журналу"
|
||
|
||
#: lazarusidestrconsts.lislowercasestring
|
||
msgid "lowercase string"
|
||
msgstr "рядок в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
||
msgid "Lowercase string given as parameter."
|
||
msgstr "Рядок у нижньому регістрі, поданий як параметр"
|
||
|
||
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
||
msgid "lpk has vanished on disk. Using as alternative%s"
|
||
msgstr "lpk зник з диска. Замість нього використовується%s"
|
||
|
||
#: lazarusidestrconsts.lislpkismissing
|
||
msgid "lpk is missing"
|
||
msgstr "lpk відсутній"
|
||
|
||
#: lazarusidestrconsts.lislrsincludefiles
|
||
msgid "Lazarus resources (.lrs) include files"
|
||
msgstr "Файли ресурсів Lazarus (.lrs) для включення"
|
||
|
||
#: lazarusidestrconsts.lismacro
|
||
msgid "Macro %s"
|
||
msgstr "Макрос %s"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterdata
|
||
msgid "Enter data"
|
||
msgstr "Введіть дані"
|
||
|
||
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
||
msgid "Enter run parameters"
|
||
msgstr "Введіть параметри запуску"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
||
msgid "Main unit has Application.CreateForm statements"
|
||
msgstr "Головний модуль має оператори Application.CreateForm"
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
|
||
msgid "Main unit has Application.Scaled statement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
|
||
msgid "Main unit has Application.Title statement"
|
||
msgstr ""
|
||
|
||
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
||
msgid "Main unit has Uses section containing all units of project"
|
||
msgstr "Головний модуль має секцію Uses, що вміщує всі модулі проекту"
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsource
|
||
msgid "Main unit is Pascal source"
|
||
msgstr "Основний модуль в кодах Паскаля"
|
||
|
||
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
||
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
||
msgstr "Вважати, що файл містить код на Pascal, навіть якщо він не має розширення .pas/.pp"
|
||
|
||
#: lazarusidestrconsts.lismakeexe
|
||
msgid "Make Executable"
|
||
msgstr "Створити виконуваний"
|
||
|
||
#: lazarusidestrconsts.lismakenotfound
|
||
msgid "Make not found"
|
||
msgstr "Make не знайдений"
|
||
|
||
#: lazarusidestrconsts.lismakeresourcestring
|
||
msgid "Make ResourceString"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrappendtosection
|
||
msgid "Append to section"
|
||
msgstr "Додати до розділу"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
||
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
||
msgstr "Рядок ресурсів \"%s\" вже існує. %sВиберіть іншу назву. %s Використовуйте Знехтувати, щоб все-таки додати."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
||
msgid "Conversion Options"
|
||
msgstr "Параметри перетворення"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
||
msgid "Custom identifier"
|
||
msgstr "Спеціальний ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
||
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
||
msgid "Identifier"
|
||
msgstr "Ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierlength
|
||
msgid "Identifier length:"
|
||
msgstr "Довжина ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
||
msgid "Identifier prefix:"
|
||
msgstr "Префікс ідентифікатора:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
||
msgid "Insert alphabetically"
|
||
msgstr "Вставити за алфавітом"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
||
msgid "Insert context sensitive"
|
||
msgstr "Вставити з врахуванням контексту"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
||
msgid "Invalid Resourcestring section"
|
||
msgstr "Неправильна секція Resourcestring"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
||
msgid "Please choose a resourcestring section from the list."
|
||
msgstr "Виберіть секцію рядки ресурсів зі списку."
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
||
msgid "Resourcestring already exists"
|
||
msgstr "Рядок ресурсів вже існує"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
||
msgid "Resourcestring section:"
|
||
msgstr "Секція Resourcestring:"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
||
msgid "Source preview"
|
||
msgstr "Переглядання коду"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
||
msgid "String constant in source"
|
||
msgstr "Рядкова константа в коді"
|
||
|
||
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
||
msgid "Strings with same value:"
|
||
msgstr "Рядки з тим же значенням:"
|
||
|
||
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
||
msgid "Make sure all ppu files of a package are in its output directory."
|
||
msgstr "Пакунку необхідна вихідна тека."
|
||
|
||
#: lazarusidestrconsts.lismanagesourceeditors
|
||
msgid "Manage Source Editors ..."
|
||
msgstr "Керування редакторами сирців ..."
|
||
|
||
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
||
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
|
||
msgstr "Найбільше число ниток для паралельної компіляції. Типово - 0 (намагатись визначити число ядер процесорів у системі)."
|
||
|
||
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
||
msgid "Maximum parallel processes, 0 means default (%s)"
|
||
msgstr "Найбільше число паралельних процесів, 0 - типове значення (%s)"
|
||
|
||
#: lazarusidestrconsts.lismaxs
|
||
msgid "Max %d"
|
||
msgstr "Макс %d"
|
||
|
||
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
||
msgid "%s Maybe you have to recompile the package."
|
||
msgstr "%s Може вам треба перезібрати пакунок."
|
||
|
||
#: lazarusidestrconsts.lismb
|
||
msgid "%s MB"
|
||
msgstr "%s МБ"
|
||
|
||
#: lazarusidestrconsts.lismeaction
|
||
msgctxt "lazarusidestrconsts.lismeaction"
|
||
msgid "Action"
|
||
msgstr "Дія"
|
||
|
||
#: lazarusidestrconsts.lismemorydump
|
||
msgid "Memory Dump"
|
||
msgstr "Дамп пам'яті"
|
||
|
||
#: lazarusidestrconsts.lismenuabortbuild
|
||
msgid "Abort Build"
|
||
msgstr "Перервати збирання"
|
||
|
||
#: lazarusidestrconsts.lismenuaboutfpc
|
||
msgid "About FPC"
|
||
msgstr "Про FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuaddbreakpoint
|
||
msgid "Add &Breakpoint"
|
||
msgstr "Додати &точку зупинки"
|
||
|
||
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
||
msgid "Add Active File to Package ..."
|
||
msgstr "Додати активний файл до пакунка ..."
|
||
|
||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||
msgid "Add Jump Point to History"
|
||
msgstr "Додати точку переходу до історії"
|
||
|
||
#: lazarusidestrconsts.lismenuaddtoproject
|
||
msgid "Add Editor File to Project"
|
||
msgstr "Додати файл редактора до проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuaddwatch
|
||
msgid "Add &Watch ..."
|
||
msgstr "Додати &спостереження..."
|
||
|
||
#: lazarusidestrconsts.lismenubeaklinesinselection
|
||
msgid "Break Lines in Selection"
|
||
msgstr "Розбивати рядки у вибраному"
|
||
|
||
#: lazarusidestrconsts.lismenubreak
|
||
msgid "&Break"
|
||
msgstr "&Перервати"
|
||
|
||
#: lazarusidestrconsts.lismenubuildfile
|
||
msgid "Build File"
|
||
msgstr "Зібрати файл"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarus
|
||
msgid "Build Lazarus with Current Profile"
|
||
msgstr "Зібрати Lazarus з поточним профілем"
|
||
|
||
#: lazarusidestrconsts.lismenubuildlazarusprof
|
||
msgid "Build Lazarus with Profile: %s"
|
||
msgstr "Зібрати Lazarus з профілем: %s"
|
||
|
||
#: lazarusidestrconsts.lismenuchecklfm
|
||
msgid "Check LFM File in Editor"
|
||
msgstr "Перевірити файл LFM у редакторі"
|
||
|
||
#: lazarusidestrconsts.lismenucleandirectory
|
||
msgid "Clean Directory ..."
|
||
msgstr "Очистити теку ..."
|
||
|
||
#: lazarusidestrconsts.lismenucleanupandbuild
|
||
msgid "Clean up and Build ..."
|
||
msgstr "Очистити і зібрати ..."
|
||
|
||
#: lazarusidestrconsts.lismenucloseall
|
||
msgid "Close A&ll"
|
||
msgstr "Закрити всі"
|
||
|
||
#: lazarusidestrconsts.lismenucloseeditorfile
|
||
msgid "&Close Editor File"
|
||
msgstr "&Закрити файл редактора"
|
||
|
||
#: lazarusidestrconsts.lismenucloseproject
|
||
msgid "Close Project"
|
||
msgstr "Закрити проект"
|
||
|
||
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
||
msgid "CodeTools Defines Editor ..."
|
||
msgstr "Редактор визначень CodeTools ..."
|
||
|
||
#: lazarusidestrconsts.lismenucommentselection
|
||
msgid "Comment Selection"
|
||
msgstr "Вибір коментаря"
|
||
|
||
#: lazarusidestrconsts.lismenucomparefiles
|
||
msgid "Compare files ..."
|
||
msgstr "Порівняти файли ..."
|
||
|
||
#: lazarusidestrconsts.lismenucompilemanymodes
|
||
msgid "Compile many Modes ..."
|
||
msgstr "Компілювати у багатьох режимах ..."
|
||
|
||
#: lazarusidestrconsts.lismenucompletecode
|
||
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
||
msgid "Complete Code"
|
||
msgstr "Завершити код"
|
||
|
||
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
||
msgid "Complete Code (with dialog)"
|
||
msgstr "Завершувати код (у діалозі)"
|
||
|
||
#: lazarusidestrconsts.lismenuconfigbuildfile
|
||
msgid "Configure Build+Run File ..."
|
||
msgstr "Налаштувати збирання+виконання файлу ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
||
msgid "Configure Custom Components ..."
|
||
msgstr "Налаштувати користувацькі компоненти ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigexternaltools
|
||
msgid "Configure External Tools ..."
|
||
msgstr "Налаштувати зовнішні інструменти ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
||
msgid "Configure \"Build Lazarus\" ..."
|
||
msgstr "Налаштувати \"Збирання Lazarus\" ..."
|
||
|
||
#: lazarusidestrconsts.lismenucontexthelp
|
||
msgid "Context sensitive Help"
|
||
msgstr "Контекстна довідка"
|
||
|
||
#: lazarusidestrconsts.lismenucontinue
|
||
msgid "&Continue"
|
||
msgstr "&Продовжити"
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||
msgid "Convert Delphi Package to Lazarus Package ..."
|
||
msgstr "Перетворення пакунка Delphi на пакунок Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||
msgid "Convert Delphi Project to Lazarus Project ..."
|
||
msgstr "Перетворення проекту Delphi в проект Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
||
msgstr "Перетворення модуля Delphi в модуль Lazarus ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
||
msgstr "Перетворити двійковий DFM в текстовий LFM + перевірка синтаксису ..."
|
||
|
||
#: lazarusidestrconsts.lismenuconvertencoding
|
||
msgid "Convert Encoding of Projects/Packages ..."
|
||
msgstr "Конвертувати кодування проектів/пакунків ..."
|
||
|
||
#: lazarusidestrconsts.lismenudebugwindows
|
||
msgid "Debug Windows"
|
||
msgstr "Вікна зневадження"
|
||
|
||
#: lazarusidestrconsts.lismenudelphiconversion
|
||
msgid "Delphi Conversion"
|
||
msgstr "Перетворення Delphi"
|
||
|
||
#: lazarusidestrconsts.lismenuedit
|
||
msgid "&Edit"
|
||
msgstr "&Зміни"
|
||
|
||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||
msgid "Code Templates ..."
|
||
msgstr "Кодові шаблони ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||
msgid "Edit context sensitive Help"
|
||
msgstr "Редагувати контекстну довідку"
|
||
|
||
#: lazarusidestrconsts.lismenueditinstallpkgs
|
||
msgid "Install/Uninstall Packages ..."
|
||
msgstr "Встановити/Видалити пакунки ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
||
msgid "Accelerator(&&) key \"%s\" needs changing"
|
||
msgstr "Клавішу (&&) швидкого виклику \"%s\" слід змінити"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
||
msgid "Add a new item above selected item"
|
||
msgstr "Додати новий елемент над вибраним"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
||
msgid "Add a new item after selected item"
|
||
msgstr "Додати новий елемент після вибраного"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
||
msgid "Add a new item before selected item"
|
||
msgstr "Додати новий елемент перед вибраним"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
||
msgid "Add a new item below selected item"
|
||
msgstr "Додати новий елемент під вибраним"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
||
msgid "Add a submenu at the right of selected item"
|
||
msgstr "Додати підменю праворуч від вибраного елемента"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
||
msgid "Add a submenu below selected item"
|
||
msgstr "Додати підменю під вибраним елементом"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
||
msgid "&Add from template ..."
|
||
msgstr "&Додати з шаблону ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
||
msgid "Add icon from %s"
|
||
msgstr "Додати значок з %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
||
msgid "Add imagelist &icon"
|
||
msgstr "Додати &значок з ImageList"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
||
msgid "Add menu item"
|
||
msgstr "Додати елемент меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
||
msgid "&Add new item above"
|
||
msgstr "&Додати новий елемент вище"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
||
msgid "Add ne&w item after"
|
||
msgstr "Додати &новий елемент після"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
||
msgid "&Add new item before"
|
||
msgstr "&Додати новий елемент перед"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
||
msgid "Add ne&w item below"
|
||
msgstr "Додати &новий елемент нижче"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
||
msgid "Add &OnClick handler"
|
||
msgstr "Додати &обробник OnClick"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
||
msgid "Add separator &after"
|
||
msgstr "Додати &роздільник після"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
||
msgid "Add separator &before"
|
||
msgstr "Додати роздільник &перед"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
||
msgid "Add submenu"
|
||
msgstr "Додати підменю"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
||
msgid "Add &submenu below"
|
||
msgstr "Додати &підменю нижче"
|
||
|
||
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
||
msgid "Add &submenu right"
|
||
msgstr "Додати підменю п&раворуч"
|
||
|
||
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
||
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
||
msgstr "Збережено новий шаблон меню, описаний як \"%s\", на основі %s, з %d піделементами"
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
||
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
||
msgstr "&Зміни,Базове меню \"Зміни\",&Скасувати,Ctrl+Z,&Повернути,,-,,Ви&брати всі,Ctrl+A,В&ирізати,Ctrl+X,&Копіювати,Ctrl+C,В&ставити,Ctrl+V,Сп&еціальна вставка,,-,,&Знайти,,&Замінити,,&Перейти ...,,"
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
||
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
||
msgstr "&Файл,Базове меню \"Файл\",&Новий,,&Відкрити ...,,&Зберегти,,Зберегти &як,,-,,&Друк,,П&араметри друку ...,,-,,В&ихід,,"
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
||
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
||
msgstr "&Довідка,Базове меню \"Довідка\",Зміст,F1,&Покажчик,,Довідка у м&ережі,,-,,Відомості про &ліцензію,,&Перевірити оновлення,,-,,&Про програму,,"
|
||
|
||
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
||
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
||
msgstr "Вік&но,Базове меню \"Вікно\",&Нове вікно,,&Замостити,,&Каскадувати,,&Упорядкувати всі,,-,,Прихо&вати,,&Показати,,"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaption
|
||
msgid "Caption"
|
||
msgstr "Заголовок"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
||
msgid "Captioned items: %s"
|
||
msgstr "Елементів з заголовками: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
||
msgid "Caption should not be blank"
|
||
msgstr "Заголовок не може бути порожнім"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
||
msgid "Change conflicting accelerator \"%s\""
|
||
msgstr "Змінити конфліктну швидку клавішу \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
||
msgid "Change imagelist &icon"
|
||
msgstr "Змінити &значок з ImageList"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
||
msgid "Change %s for %s"
|
||
msgstr "Змінити %s для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
||
msgid "Change shortcut conflict \"%s\""
|
||
msgstr "Змінити конфліктне сполучення клавіш \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
||
msgid "Change the shortCut for %s"
|
||
msgstr "Змінити значення shortCut для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
||
msgid "Change the shortCutKey2 for %s"
|
||
msgstr "Змінити значення ShortCutKey2 для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
||
msgid "Choose template to delete"
|
||
msgstr "Виберіть шаблон для видалення"
|
||
|
||
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
||
msgid "Choose template to insert"
|
||
msgstr "Виберіть шаблон для вставлення"
|
||
|
||
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
||
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
||
msgstr "Клацніть активний елемент для зміни сполучення клавіш або заголовок стовпця списку для упорядкування"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
||
msgid "Component is unexpected kind"
|
||
msgstr "Компонент неочікуваного виду"
|
||
|
||
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
||
msgid "Component is unnamed"
|
||
msgstr "Компонент без назви"
|
||
|
||
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
||
msgid "<conflict resolution complete>"
|
||
msgstr "<розв'язування конфліктів завершено>"
|
||
|
||
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
||
msgid "Conflicts found initially: %d"
|
||
msgstr "Було знайдено конфліктів: %d"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
||
msgid "Deepest nested menu level: %s"
|
||
msgstr "Глибина вкладеності меню: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteitem
|
||
msgid "&Delete item"
|
||
msgstr "&Вилучити елемент"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
||
msgid "&Delete menu template ..."
|
||
msgstr "&Видалити шаблон меню ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
||
msgid "Delete saved menu template"
|
||
msgstr "Видалити збережений шаблон меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
||
msgid "Delete selected menu template"
|
||
msgstr "Видалити вибраний шаблон меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
||
msgid "Delete this item and its subitems?"
|
||
msgstr "Видалити цей елемент і його піделементи?"
|
||
|
||
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
||
msgid "Display preview as &Popup menu"
|
||
msgstr "Попередній перегляд як &спливне меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditcaption
|
||
msgid "Edit &Caption"
|
||
msgstr "&Змінити заголовок"
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
||
msgid "Editing Caption of %s"
|
||
msgstr "Змінення заголовка %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingsdots
|
||
msgid "To resolve conflict edit %s.%s"
|
||
msgstr "Для розв'язання конфлікту змініть %s.%s"
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingsfors
|
||
msgid "Editing %s for %s"
|
||
msgstr "Змінення %s для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
||
msgid "Editing %s.%s - no menuitem selected"
|
||
msgstr "Редагування %s.%s - елементи меню не вибрано"
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
||
msgid "Enter a menu &Description:"
|
||
msgstr "Введіть &опис меню:"
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
||
msgid "Enter a new ShortCut for %s"
|
||
msgstr "Уведіть значення ShortCut для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
||
msgid "Enter a new ShortCutKey2 for %s"
|
||
msgstr "Уведіть значення ShortCutKey2 для %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
||
msgid "Existing saved templates"
|
||
msgstr "Наявні збережені шаблони"
|
||
|
||
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
||
msgid "Further shortcut conflict"
|
||
msgstr "Додатковий конфлікт сполучень клавіш"
|
||
|
||
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
||
msgid "Get help to use this editor"
|
||
msgstr "Отримати довідку з користування цим редактором"
|
||
|
||
#: lazarusidestrconsts.lismenueditorgrabkey
|
||
msgid "&Grab key"
|
||
msgstr "&Захопити клавішу"
|
||
|
||
#: lazarusidestrconsts.lismenueditorgroupindexd
|
||
msgid "GroupIndex: %d"
|
||
msgstr "GroupIndex: %d"
|
||
|
||
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
||
msgid "Values in use: %s"
|
||
msgstr "Наявні значення: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
||
msgid "Inadequate Description"
|
||
msgstr "Недостатній опис"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
||
msgid "Insert menu template into root of %s"
|
||
msgstr "Вставити шаблон меню у корінь %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
||
msgid "Insert selected menu template"
|
||
msgstr "Вставити вибраний шаблон меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditorisnotassigned
|
||
msgid "is not assigned"
|
||
msgstr "не присвоєно"
|
||
|
||
#: lazarusidestrconsts.lismenueditoritemswithicons
|
||
msgid "Items with icon: %s"
|
||
msgstr "Елементи зі значками: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
||
msgid "List shortcuts and &accelerators for %s ..."
|
||
msgstr "Показати сполучення і &швидкі клавіші для %s ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
||
msgid "List shortcuts for %s ..."
|
||
msgstr "Показати сполучення клавіш для %s ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditormenueditor
|
||
msgid "Menu Editor"
|
||
msgstr "Редактор меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenuitemactions
|
||
msgid "Menu Item actions"
|
||
msgstr "Дії з елементами меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
||
msgid "Menuitem shortcut conflicts in %s"
|
||
msgstr "Конфлікти сполучень клавіш меню %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditormovedown
|
||
msgid "Move Down (or right)"
|
||
msgstr "Пересунути вниз (або вправо)"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemdown
|
||
msgid "Mo&ve item down"
|
||
msgstr "Пере&містити елемент вниз"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemleft
|
||
msgid "&Move item left"
|
||
msgstr "&Перемістити елемент вліво"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemright
|
||
msgid "Mo&ve item right"
|
||
msgstr "Перемістити &елемент вправо"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveitemup
|
||
msgid "&Move item up"
|
||
msgstr "Перемістити елемент &вгору"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
||
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
||
msgid "Move selected item down"
|
||
msgstr "Перемістити вибраний елемент вниз"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
||
msgid "Move selected item to the left"
|
||
msgstr "Перемістити вибраний елемент вліво"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
||
msgid "Move selected item to the right"
|
||
msgstr "Перемістити вибраний елемент вправо"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
||
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
||
msgid "Move selected item up"
|
||
msgstr "Перемістити вибраний елемент вгору"
|
||
|
||
#: lazarusidestrconsts.lismenueditormoveup
|
||
msgid "Move Up (or left)"
|
||
msgstr "Пересунути вгору (або вліво)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorna
|
||
msgid "n/a"
|
||
msgstr "недоступне"
|
||
|
||
#: lazarusidestrconsts.lismenueditornomenuselected
|
||
msgid "(no menu selected)"
|
||
msgstr "(меню не вибрано)"
|
||
|
||
#: lazarusidestrconsts.lismenueditornone
|
||
msgid "<none>"
|
||
msgstr "<немає>"
|
||
|
||
#: lazarusidestrconsts.lismenueditornonenone
|
||
msgid "<none>,<none>"
|
||
msgstr "<немає>,<немає>"
|
||
|
||
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
||
msgid "<no shortcut conflicts>"
|
||
msgstr "<немає конфліктів сполучень>"
|
||
|
||
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
||
msgid "No user-saved templates"
|
||
msgstr "Немає користувацьких шаблонів"
|
||
|
||
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
||
msgid "Pick an icon from %s"
|
||
msgstr "Додати значок з %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
||
msgid "Popup assignments: %s"
|
||
msgstr "Присвоєнь зі спливного меню: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorradioitem
|
||
msgid "RadioItem"
|
||
msgstr "Елемент-перемикач"
|
||
|
||
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
||
msgid "Remaining conflicts: %s"
|
||
msgstr "Залишилось конфліктів: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
||
msgid "&Remove all separators"
|
||
msgstr "&Вилучити всі роздільники"
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
||
msgid "Resolved conflicts: %s"
|
||
msgstr "Розв'язані конфлікти: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
||
msgid "Resolve selected conflict"
|
||
msgstr "Розв'язати вибраний конфлікт"
|
||
|
||
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
||
msgid "&Resolve shortcut conflicts ..."
|
||
msgstr "&Розв'язати конфлікт сполучень ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
||
msgid "Saved templates"
|
||
msgstr "Збережені шаблони"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
||
msgid "&Save menu as a template ..."
|
||
msgstr "&Зберегти меню як шаблон ..."
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
||
msgid "Save menu as template"
|
||
msgstr "Зберегти меню як шаблон"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
||
msgid "Save menu as template for future use"
|
||
msgstr "Зберегти меню як шаблон для подальшого використання"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
||
msgid "Save menu shown as a new template"
|
||
msgstr "Зберегти показане меню як новий шаблон"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
||
msgid "%s conflicts with %s"
|
||
msgstr "%s конфліктує з %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorseparators
|
||
msgid "Se¶tors"
|
||
msgstr "&Роздільники"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
||
msgid "Shortcut items: %s"
|
||
msgstr "Елементи сполучень: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
||
msgid "Shortcut not yet changed"
|
||
msgstr "Сполучення ще не змінено"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcuts
|
||
msgid "Shortcuts"
|
||
msgstr "Сполучення"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcuts2
|
||
msgid "Shortc&uts"
|
||
msgstr "Сполу&чення"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
||
msgid "Shortcuts and Accelerator keys"
|
||
msgstr "Сполучення і швидкі клавіші"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsd
|
||
msgid "Shortcuts (%d)"
|
||
msgstr "Сполучення (%d)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
||
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
||
msgstr "Сполучення (%d) і швидкі клавіші (%d)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
||
msgid "Shortcut,Source Property"
|
||
msgstr "Сполучення клавіш,Властивість-джерело"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
||
msgid "Shortcuts used in %s"
|
||
msgstr "Сполучення використано в %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
||
msgid "Shortcuts used in %s (%d)"
|
||
msgstr "Сполучення використано у %s (%d)"
|
||
|
||
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
||
msgid "ShowMenuEditor: TMenu parameter is nil"
|
||
msgstr "ShowMenuEditor: параметр TMenu є нульовим"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsins
|
||
msgid "\"%s\" in %s"
|
||
msgstr "\"%s\" в %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
||
msgid ""
|
||
"\"%s\" is already in use in %s as a shortcut.\n"
|
||
"Try a different shortcut.\n"
|
||
msgstr ""
|
||
"Сполучення клавіш \"%s\" вже використовується у %s.\n"
|
||
"Спробуйте інше.\n"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
||
msgid "Please expand: \"%s\" is not a sufficient Description"
|
||
msgstr "Опишіть детальніше: \"%s\" занадто коротке"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
||
msgid "Some widgetsets do not allow separators in the main menubar"
|
||
msgstr "Деякі бібліотеки віджетів не допускають роздільників у головному рядку меню"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsshortcuts
|
||
msgid "%s: Shortcuts"
|
||
msgstr "%s: Сполучення"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
||
msgid "%s: Shortcuts and accelerator keys"
|
||
msgstr "%s: Сполучення клавіш і швидкі клавіші"
|
||
|
||
#: lazarusidestrconsts.lismenueditorsssonclicks
|
||
msgid "%s.%s.%s - OnClick: %s"
|
||
msgstr "%s.%s.%s - OnClick: %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorssubmenu
|
||
msgid "%s submenu"
|
||
msgstr "Підменю %s"
|
||
|
||
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
||
msgid "Standard templates"
|
||
msgstr "Стандартні шаблони"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatedescription
|
||
msgid "Template description:"
|
||
msgstr "Опис шаблону:"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplates
|
||
msgid "&Templates"
|
||
msgstr "&Шаблони"
|
||
|
||
#: lazarusidestrconsts.lismenueditortemplatesaved
|
||
msgid "Template saved"
|
||
msgstr "Шаблон збережено"
|
||
|
||
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
||
msgid ""
|
||
"There are no user-saved menu templates.\n"
|
||
"\n"
|
||
"Only standard default templates are available.\n"
|
||
msgstr ""
|
||
"Немає шаблонів меню, збережених користувачем.\n"
|
||
"\n"
|
||
"Доступні лише стандартні типові шаблони.\n"
|
||
|
||
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
||
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
||
msgstr "TSCList.GetScanListCompName: некоректний індекс %d у FScanList"
|
||
|
||
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
||
msgid ""
|
||
"You have to change the shortcut from %s\n"
|
||
"to avoid a conflict\n"
|
||
msgstr ""
|
||
"Слід змінити сполучення клавіш %s\n"
|
||
"для уникнення конфлікту.\n"
|
||
|
||
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
||
msgid "You must enter text for the Caption"
|
||
msgstr "Потрібно ввести текст заголовка"
|
||
|
||
#: lazarusidestrconsts.lismenuencloseinifdef
|
||
msgid "Enclose in $IFDEF ..."
|
||
msgstr "Вкласти в $IFDEF ..."
|
||
|
||
#: lazarusidestrconsts.lismenuencloseselection
|
||
msgid "Enclose Selection ..."
|
||
msgstr "Задужкувати вибране ..."
|
||
|
||
#: lazarusidestrconsts.lismenuevaluate
|
||
msgid "E&valuate/Modify ..."
|
||
msgstr "Об&числити/Змінити..."
|
||
|
||
#: lazarusidestrconsts.lismenuexampleprojects
|
||
msgid "Example Projects ..."
|
||
msgstr "Приклади проектів ..."
|
||
|
||
#: lazarusidestrconsts.lismenuextractproc
|
||
msgid "Extract Procedure ..."
|
||
msgstr "Витягти процедуру ..."
|
||
|
||
#: lazarusidestrconsts.lismenufile
|
||
msgid "&File"
|
||
msgstr "&Файл"
|
||
|
||
#: lazarusidestrconsts.lismenufind
|
||
msgctxt "lazarusidestrconsts.lismenufind"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: lazarusidestrconsts.lismenufind2
|
||
msgid "&Find ..."
|
||
msgstr "&Знайти ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||
msgid "Find Other End of Code Block"
|
||
msgstr "Знайти інший кінець блоку коду"
|
||
|
||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||
msgid "Find Start of Code Block"
|
||
msgstr "Знайти початок блоку коду"
|
||
|
||
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
||
msgid "Find Declaration at Cursor"
|
||
msgstr "Знайти опис під курсором"
|
||
|
||
#: lazarusidestrconsts.lismenufindidentifierrefs
|
||
msgid "Find Identifier References ..."
|
||
msgstr "Знайти посилання на ідентифікатор ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindinfiles
|
||
msgid "Find &in Files ..."
|
||
msgstr "&Пошук у файлах ..."
|
||
|
||
#: lazarusidestrconsts.lismenufindnext
|
||
msgid "Find &Next"
|
||
msgstr "Шукати &далі"
|
||
|
||
#: lazarusidestrconsts.lismenufindprevious
|
||
msgid "Find &Previous"
|
||
msgstr "Знайти &попередній"
|
||
|
||
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
||
msgid "Find References Of Used Unit"
|
||
msgstr "Знайти посилання використаних модулів"
|
||
|
||
#: lazarusidestrconsts.lismenugeneraloptions
|
||
msgid "Options ..."
|
||
msgstr "Параметри ..."
|
||
|
||
#: lazarusidestrconsts.lismenugotoincludedirective
|
||
msgid "Goto Include Directive"
|
||
msgstr "Перейти за директивою Include"
|
||
|
||
#: lazarusidestrconsts.lismenugotoline
|
||
msgid "Goto Line ..."
|
||
msgstr "Перейти до рядка ..."
|
||
|
||
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
||
msgid "Guess Misplaced IFDEF/ENDIF"
|
||
msgstr "Вгадати невідповідність IFDEF/ENDIF"
|
||
|
||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||
msgid "Guess Unclosed Block"
|
||
msgstr "Вгадати незакінчений блок"
|
||
|
||
#: lazarusidestrconsts.lismenuhelp
|
||
msgid "&Help"
|
||
msgstr "&Довідка"
|
||
|
||
#: lazarusidestrconsts.lismenuideinternals
|
||
msgid "IDE Internals"
|
||
msgstr "Нутрощі ІСР"
|
||
|
||
#: lazarusidestrconsts.lismenuincrementalfind
|
||
msgid "Incremental Find"
|
||
msgstr "Пошук за зростанням"
|
||
|
||
#: lazarusidestrconsts.lismenuindentselection
|
||
msgid "Indent Selection"
|
||
msgstr "Зсунути виділене"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
||
msgid "ChangeLog Entry"
|
||
msgstr "Елемент ChangeLog"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcharacter
|
||
msgid "Insert from Character Map ..."
|
||
msgstr "Вставити з Таблиці символів ..."
|
||
|
||
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
||
msgid "Insert CVS Keyword"
|
||
msgstr "Вставити ключ CVS"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertdatetime
|
||
msgid "Current Date and Time"
|
||
msgstr "Поточні дата і час"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertfilename
|
||
msgid "Insert Full Filename ..."
|
||
msgstr "Вставити повну назву файлу ..."
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgeneral
|
||
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
|
||
msgid "Insert General"
|
||
msgstr "Вставити загальні"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnotice
|
||
msgid "GPL Notice"
|
||
msgstr "Примітки GPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
||
msgid "GPL Notice (translated)"
|
||
msgstr "Зауваження GPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
||
msgid "LGPL Notice"
|
||
msgstr "Примітки LGPL"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
||
msgid "LGPL Notice (translated)"
|
||
msgstr "Зауваження LGPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmitnotice
|
||
msgid "MIT Notice"
|
||
msgstr "Зауваження MIT"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
||
msgid "MIT Notice (translated)"
|
||
msgstr "Зауваження MIT (перекладено)"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
||
msgid "Modified LGPL Notice"
|
||
msgstr "Нотатки Зміненої LGPL "
|
||
|
||
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
||
msgid "Modified LGPL Notice (translated)"
|
||
msgstr "Зауваження зміненої LGPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.lismenuinsertusername
|
||
msgid "Current Username"
|
||
msgstr "Поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts.lismenuinspect
|
||
msgctxt "lazarusidestrconsts.lismenuinspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "&Слідкувати за ..."
|
||
|
||
#: lazarusidestrconsts.lismenujumpback
|
||
msgid "Jump Back"
|
||
msgstr "Перейти назад"
|
||
|
||
#: lazarusidestrconsts.lismenujumpforward
|
||
msgid "Jump Forward"
|
||
msgstr "Перейти вперед"
|
||
|
||
#: lazarusidestrconsts.lismenujumpto
|
||
msgid "Jump to"
|
||
msgstr "Перейти до"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementation
|
||
msgid "Jump to Implementation"
|
||
msgstr "Перейти до реалізації"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
||
msgid "Jump to Implementation uses"
|
||
msgstr "Перейти до uses в реалізації"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoinitialization
|
||
msgid "Jump to Initialization"
|
||
msgstr "Перейти до ініціалізації"
|
||
|
||
#: lazarusidestrconsts.lismenujumptointerface
|
||
msgid "Jump to Interface"
|
||
msgstr "Перейти до інтерфейсу"
|
||
|
||
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
||
msgid "Jump to Interface uses"
|
||
msgstr "Перейти до uses в інтерфейсі"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonextbookmark
|
||
msgid "Jump to Next Bookmark"
|
||
msgstr "Перейти до наст. Закладки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptonexterror
|
||
msgid "Jump to Next Error"
|
||
msgstr "Перехід до наст. помилки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
||
msgid "Jump to Previous Bookmark"
|
||
msgstr "Перейти до попер. Закладки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptopreverror
|
||
msgid "Jump to Previous Error"
|
||
msgstr "Перейти до попер. помилки"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
||
msgid "Jump to Procedure begin"
|
||
msgstr "Перейти до початку процедури"
|
||
|
||
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
||
msgid "Jump to Procedure header"
|
||
msgstr "Перейти до заголовка процедури"
|
||
|
||
#: lazarusidestrconsts.lismenulowercaseselection
|
||
msgid "Lowercase Selection"
|
||
msgstr "Вибір в нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lismenumacrolistview
|
||
msgid "Editor Macros ..."
|
||
msgstr "Макрос редактора ..."
|
||
|
||
#: lazarusidestrconsts.lismenumakeresourcestring
|
||
msgid "Make Resource String ..."
|
||
msgstr "Створити рядок ресурсу ..."
|
||
|
||
#: lazarusidestrconsts.lismenumultipaste
|
||
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
||
msgid "MultiPaste ..."
|
||
msgstr "Мультивставка ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewcomponent
|
||
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
||
msgid "New Component"
|
||
msgstr "Новий компонент"
|
||
|
||
#: lazarusidestrconsts.lismenunewcustom
|
||
msgid "New %s"
|
||
msgstr "Створити %s"
|
||
|
||
#: lazarusidestrconsts.lismenunewform
|
||
msgid "New Form"
|
||
msgstr "Нова форма"
|
||
|
||
#: lazarusidestrconsts.lismenunewother
|
||
msgid "New ..."
|
||
msgstr "Новий..."
|
||
|
||
#: lazarusidestrconsts.lismenunewpackage
|
||
msgid "New Package ..."
|
||
msgstr "Новий пакунок ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewproject
|
||
msgid "New Project ..."
|
||
msgstr "Новий проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewprojectfromfile
|
||
msgid "New Project from File ..."
|
||
msgstr "Новий проект з файлу ..."
|
||
|
||
#: lazarusidestrconsts.lismenunewunit
|
||
msgctxt "lazarusidestrconsts.lismenunewunit"
|
||
msgid "New Unit"
|
||
msgstr "Новий модуль"
|
||
|
||
#: lazarusidestrconsts.lismenuok
|
||
msgctxt "lazarusidestrconsts.lismenuok"
|
||
msgid "&OK"
|
||
msgstr "&Гаразд"
|
||
|
||
#: lazarusidestrconsts.lismenuonlinehelp
|
||
msgid "Online Help"
|
||
msgstr "Мережева довідка"
|
||
|
||
#: lazarusidestrconsts.lismenuopen
|
||
msgid "&Open ..."
|
||
msgstr "&Відкрити ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
||
msgid "Open Filename at Cursor"
|
||
msgstr "Відкрити назву файлу над курсором"
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackage
|
||
msgid "Open Loaded Package ..."
|
||
msgstr "Відкрити завантажений пакунок ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackagefile
|
||
msgid "Open Package File (.lpk) ..."
|
||
msgstr "Відкрити файл пакунка (.lpk) ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||
msgid "Open Package of Current Unit"
|
||
msgstr "Відкрити пакунок поточного модуля"
|
||
|
||
#: lazarusidestrconsts.lismenuopenproject
|
||
msgid "Open Project ..."
|
||
msgstr "Відкрити проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecent
|
||
msgid "Open &Recent"
|
||
msgstr "Відкрити не&давні"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||
msgid "Open Recent Package"
|
||
msgstr "Відкрити недавній пакунок"
|
||
|
||
#: lazarusidestrconsts.lismenuopenrecentproject
|
||
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
||
msgid "Open Recent Project"
|
||
msgstr "Відкрити недавній проект"
|
||
|
||
#: lazarusidestrconsts.lismenuopenunit
|
||
msgid "Open Unit ..."
|
||
msgstr "Відкрити модуль ..."
|
||
|
||
#: lazarusidestrconsts.lismenupackage
|
||
msgid "Pa&ckage"
|
||
msgstr "Па&кунок"
|
||
|
||
#: lazarusidestrconsts.lismenupackagegraph
|
||
msgid "Package Graph"
|
||
msgstr "Граф пакунків"
|
||
|
||
#: lazarusidestrconsts.lismenupackagelinks
|
||
msgid "Package Links ..."
|
||
msgstr "Зв'язки пакунка ..."
|
||
|
||
#: lazarusidestrconsts.lismenupastefromclipboard
|
||
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
||
msgid "Paste from clipboard"
|
||
msgstr "Вставити з буфера обміну"
|
||
|
||
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
||
msgid "New package component"
|
||
msgstr "Новий компонент пакунка"
|
||
|
||
#: lazarusidestrconsts.lismenuprocedurelist
|
||
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
|
||
msgid "Procedure List ..."
|
||
msgstr "Список процедур ..."
|
||
|
||
#: lazarusidestrconsts.lismenuproject
|
||
msgid "&Project"
|
||
msgstr "&Проект"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectinspector
|
||
msgid "Project Inspector"
|
||
msgstr "Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuprojectoptions
|
||
msgid "Project Options ..."
|
||
msgstr "Параметри проекту ..."
|
||
|
||
#: lazarusidestrconsts.lismenuprojectrun
|
||
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
||
msgid "&Run"
|
||
msgstr "Вико&нати"
|
||
|
||
#: lazarusidestrconsts.lismenupublishproject
|
||
msgid "Publish Project ..."
|
||
msgstr "Опублікувати проект ..."
|
||
|
||
#: lazarusidestrconsts.lismenuquickcompile
|
||
msgid "Quick Compile"
|
||
msgstr "Швидка компіляція"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
||
msgid "Quick Syntax Check"
|
||
msgstr "Швидка перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
||
msgid "Quick syntax check OK"
|
||
msgstr "Швидка перевірка синтаксису OK"
|
||
|
||
#: lazarusidestrconsts.lismenuremovefromproject
|
||
msgid "Remove from Project ..."
|
||
msgstr "Прибрати з проекту ..."
|
||
|
||
#: lazarusidestrconsts.lismenurenameidentifier
|
||
msgid "Rename Identifier ..."
|
||
msgstr "Перейменувати ID ..."
|
||
|
||
#: lazarusidestrconsts.lismenureportingbug
|
||
msgctxt "lazarusidestrconsts.lismenureportingbug"
|
||
msgid "Reporting a Bug"
|
||
msgstr "Повідомити про ваду"
|
||
|
||
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
||
msgid "Resave forms with enabled i18n"
|
||
msgstr "Перезаписати форми з увімкненою інтернаціоналізацією"
|
||
|
||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||
msgid "Rescan FPC Source Directory"
|
||
msgstr "Переглянути теку кодів FPC"
|
||
|
||
#: lazarusidestrconsts.lismenuresetdebugger
|
||
msgid "Reset Debugger"
|
||
msgstr "Скидання зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lismenurevert
|
||
msgid "Revert"
|
||
msgstr "Зворотній експорт"
|
||
|
||
#: lazarusidestrconsts.lismenurun
|
||
msgctxt "lazarusidestrconsts.lismenurun"
|
||
msgid "&Run"
|
||
msgstr "&Виконання"
|
||
|
||
#: lazarusidestrconsts.lismenurunfile
|
||
msgid "Run File"
|
||
msgstr "Виконати файл"
|
||
|
||
#: lazarusidestrconsts.lismenurunparameters
|
||
msgid "Run &Parameters ..."
|
||
msgstr "Пара&метри виконання ..."
|
||
|
||
#: lazarusidestrconsts.lismenuruntocursor
|
||
msgid "Step over to &Cursor"
|
||
msgstr "Виконати до &курсора"
|
||
|
||
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
||
msgid "Run without Debugging"
|
||
msgstr "Запустити без зневадження"
|
||
|
||
#: lazarusidestrconsts.lismenusave
|
||
msgctxt "lazarusidestrconsts.lismenusave"
|
||
msgid "&Save"
|
||
msgstr "&Зберегти"
|
||
|
||
#: lazarusidestrconsts.lismenusaveas
|
||
msgid "Save &As ..."
|
||
msgstr "Зберегти &як ..."
|
||
|
||
#: lazarusidestrconsts.lismenusaveproject
|
||
msgid "Save Project"
|
||
msgstr "Зберегти проект"
|
||
|
||
#: lazarusidestrconsts.lismenusaveprojectas
|
||
msgid "Save Project As ..."
|
||
msgstr "Зберегти проект як ..."
|
||
|
||
#: lazarusidestrconsts.lismenusearch
|
||
msgid "&Search"
|
||
msgstr "П&ошук"
|
||
|
||
#: lazarusidestrconsts.lismenuselect
|
||
msgid "Select"
|
||
msgstr "Виділити"
|
||
|
||
#: lazarusidestrconsts.lismenuselectall
|
||
msgctxt "lazarusidestrconsts.lismenuselectall"
|
||
msgid "Select All"
|
||
msgstr "Виділити все"
|
||
|
||
#: lazarusidestrconsts.lismenuselectcodeblock
|
||
msgid "Select Code Block"
|
||
msgstr "Виділити блок коду"
|
||
|
||
#: lazarusidestrconsts.lismenuselectline
|
||
msgid "Select Line"
|
||
msgstr "Виділити рядок"
|
||
|
||
#: lazarusidestrconsts.lismenuselectparagraph
|
||
msgid "Select Paragraph"
|
||
msgstr "Виділити абзац"
|
||
|
||
#: lazarusidestrconsts.lismenuselecttobrace
|
||
msgid "Select to Brace"
|
||
msgstr "Виділити до дужки"
|
||
|
||
#: lazarusidestrconsts.lismenuselectword
|
||
msgid "Select Word"
|
||
msgstr "Виділити слово"
|
||
|
||
#: lazarusidestrconsts.lismenusetfreebookmark
|
||
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Встановити вільну закладку"
|
||
|
||
#: lazarusidestrconsts.lismenushowexecutionpoint
|
||
msgid "S&how Execution Point"
|
||
msgstr "По&казати точку виконання"
|
||
|
||
#: lazarusidestrconsts.lismenushowsmarthint
|
||
msgid "Context sensitive smart hint"
|
||
msgstr "Контекстно-залежна розумна підказка"
|
||
|
||
#: lazarusidestrconsts.lismenusortselection
|
||
msgid "Sort Selection ..."
|
||
msgstr "Сортування вибраного ..."
|
||
|
||
#: lazarusidestrconsts.lismenusource
|
||
msgid "S&ource"
|
||
msgstr "&Сирці"
|
||
|
||
#: lazarusidestrconsts.lismenustepinto
|
||
msgid "Step In&to"
|
||
msgstr "Увій&ти"
|
||
|
||
#: lazarusidestrconsts.lismenustepintocontext
|
||
msgid "Step Into (Context)"
|
||
msgstr "Увійти (Контекст)"
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstr
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
||
msgid "Step Into Instruction"
|
||
msgstr "Увійти в інструкцію"
|
||
|
||
#: lazarusidestrconsts.lismenustepintoinstrhint
|
||
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
||
msgid "Step Into Instruction"
|
||
msgstr "Увійти в інструкцію"
|
||
|
||
#: lazarusidestrconsts.lismenustepout
|
||
msgid "Step O&ut"
|
||
msgstr "Пове&рнутись"
|
||
|
||
#: lazarusidestrconsts.lismenustepover
|
||
msgid "&Step Over"
|
||
msgstr "&Переступити"
|
||
|
||
#: lazarusidestrconsts.lismenustepovercontext
|
||
msgid "Step Over (Context)"
|
||
msgstr "Переступити (Контекст)"
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstr
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
||
msgid "Step Over Instruction"
|
||
msgstr "Переступити інструкцію"
|
||
|
||
#: lazarusidestrconsts.lismenustepoverinstrhint
|
||
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
||
msgid "Step Over Instruction"
|
||
msgstr "Переступити інструкцію"
|
||
|
||
#: lazarusidestrconsts.lismenuswapcaseselection
|
||
msgid "Swap Case in Selection"
|
||
msgstr "Перемкнути регістр в виділенні"
|
||
|
||
#: lazarusidestrconsts.lismenutabstospacesselection
|
||
msgid "Tabs to Spaces in Selection"
|
||
msgstr "Табуляція в пробіли в виділенні"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateabout
|
||
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
||
msgid "About"
|
||
msgstr "Про"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatecontents
|
||
msgid "Contents"
|
||
msgstr "Зміст"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
||
msgid "Standard Edit Menu"
|
||
msgstr "Стандартне меню Зміни"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
||
msgid "Standard File Menu"
|
||
msgstr "Стандартне меню Файл"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
||
msgid "Standard Help Menu"
|
||
msgstr "Стандартне меню Довідка"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefind
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
||
msgid "Find"
|
||
msgstr "Знайти"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatefindnext
|
||
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
||
msgid "Find Next"
|
||
msgstr "Шукати далі"
|
||
|
||
#: lazarusidestrconsts.lismenutemplateopenrecent
|
||
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
|
||
msgid "Open Recent"
|
||
msgstr "Відкрити недавні"
|
||
|
||
#: lazarusidestrconsts.lismenutemplatetutorial
|
||
msgid "Tutorial"
|
||
msgstr "Посібник"
|
||
|
||
#: lazarusidestrconsts.lismenutogglecomment
|
||
msgid "Toggle Comment in Selection"
|
||
msgstr "Перемкнути коментар в виборі"
|
||
|
||
#: lazarusidestrconsts.lismenutools
|
||
msgid "&Tools"
|
||
msgstr "&Інструменти"
|
||
|
||
#: lazarusidestrconsts.lismenuuncommentselection
|
||
msgid "Uncomment Selection"
|
||
msgstr "Розкоментувати вибране"
|
||
|
||
#: lazarusidestrconsts.lismenuunindentselection
|
||
msgid "Unindent Selection"
|
||
msgstr "Скасувати відступ вибраного"
|
||
|
||
#: lazarusidestrconsts.lismenuuppercaseselection
|
||
msgid "Uppercase Selection"
|
||
msgstr "Верхній регістр для вибраного"
|
||
|
||
#: lazarusidestrconsts.lismenuuseunit
|
||
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
||
msgid "Add Unit to Uses Section ..."
|
||
msgstr "Додати модуль в секцію Uses ..."
|
||
|
||
#: lazarusidestrconsts.lismenuview
|
||
msgid "&View"
|
||
msgstr "&Вигляд"
|
||
|
||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||
msgid "Anchor Editor"
|
||
msgstr "Редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts.lismenuviewassembler
|
||
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
||
msgid "Assembler"
|
||
msgstr "Асемблер"
|
||
|
||
#: lazarusidestrconsts.lismenuviewbreakpoints
|
||
msgid "BreakPoints"
|
||
msgstr "Точки зупину"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcallstack
|
||
msgid "Call Stack"
|
||
msgstr "Стек викликів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
||
msgid "Code Browser"
|
||
msgstr "Оглядач коду"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
||
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
||
msgid "Code Explorer"
|
||
msgstr "Оглядач коду"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||
msgid "Component Palette"
|
||
msgstr "Палітра компонентів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewcomponents
|
||
msgid "&Components"
|
||
msgstr "&Компоненти"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugevents
|
||
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
||
msgid "Event Log"
|
||
msgstr "Журнал подій"
|
||
|
||
#: lazarusidestrconsts.lismenuviewdebugoutput
|
||
msgid "Debug Output"
|
||
msgstr "Повідомлення зневаджувача"
|
||
|
||
#: lazarusidestrconsts.lismenuviewforms
|
||
msgid "Forms ..."
|
||
msgstr "Форми ..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewhistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
||
msgid "History"
|
||
msgstr "Історія"
|
||
|
||
#: lazarusidestrconsts.lismenuviewjumphistory
|
||
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
||
msgid "Jump History"
|
||
msgstr "Історії переходів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewlocalvariables
|
||
msgid "Local Variables"
|
||
msgstr "Локальні змінні"
|
||
|
||
#: lazarusidestrconsts.lismenuviewmessages
|
||
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
||
msgid "Messages"
|
||
msgstr "Повідомлення"
|
||
|
||
#: lazarusidestrconsts.lismenuviewobjectinspector
|
||
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
||
msgid "Object Inspector"
|
||
msgstr "Інспектор об'єктів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewprojectsource
|
||
msgid "&View Project Source"
|
||
msgstr "&Показати код проекту"
|
||
|
||
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
||
msgid "Terminal Output"
|
||
msgstr "Вивід терміналу"
|
||
|
||
#: lazarusidestrconsts.lismenuviewregisters
|
||
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
||
msgid "Registers"
|
||
msgstr "Регістри"
|
||
|
||
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
||
msgid "Restriction Browser"
|
||
msgstr "Оглядач обмежень"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsearchresults
|
||
msgid "Search Results"
|
||
msgstr "Результати пошуку"
|
||
|
||
#: lazarusidestrconsts.lismenuviewsourceeditor
|
||
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор тексту"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtaborder
|
||
msgid "Tab Order"
|
||
msgstr "Порядок за Таб"
|
||
|
||
#: lazarusidestrconsts.lismenuviewthreads
|
||
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
||
msgid "Threads"
|
||
msgstr "Нитки"
|
||
|
||
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
||
msgid "Toggle Form/Unit View"
|
||
msgstr "Перемкнути форму/модуль"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
||
msgid "Unit Dependencies"
|
||
msgstr "Залежності модулів"
|
||
|
||
#: lazarusidestrconsts.lismenuviewunitinfo
|
||
msgid "Unit Information ..."
|
||
msgstr "Інформація про модуль..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewunits
|
||
msgid "Units ..."
|
||
msgstr "Модулі..."
|
||
|
||
#: lazarusidestrconsts.lismenuviewwatches
|
||
msgid "Watches"
|
||
msgstr "Вікно спостережень"
|
||
|
||
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
||
msgid "What Needs Building"
|
||
msgstr "Що потребує збирання"
|
||
|
||
#: lazarusidestrconsts.lismenuwindow
|
||
msgid "&Window"
|
||
msgstr "&Вікно"
|
||
|
||
#: lazarusidestrconsts.lismeother
|
||
msgctxt "lazarusidestrconsts.lismeother"
|
||
msgid "Other tabs"
|
||
msgstr "Інші таби"
|
||
|
||
#: lazarusidestrconsts.lismeprojects
|
||
msgid "Projects"
|
||
msgstr "Проекти"
|
||
|
||
#: lazarusidestrconsts.lismessageseditor
|
||
msgid "Messages Editor"
|
||
msgstr "Редактор повідомлень"
|
||
|
||
#: lazarusidestrconsts.lismessageswindow
|
||
msgid "Messages Window"
|
||
msgstr "Вікно повідомлень"
|
||
|
||
#: lazarusidestrconsts.lismethodclassnotfound
|
||
msgid "Method class not found"
|
||
msgstr "Клас методу не знайдено"
|
||
|
||
#: lazarusidestrconsts.lismissingdirectory
|
||
msgid "missing directory \"%s\""
|
||
msgstr "відсутня тека \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismissingevents
|
||
msgid "Missing Events"
|
||
msgstr "Пропущені події"
|
||
|
||
#: lazarusidestrconsts.lismissingexecutable
|
||
msgid "missing executable \"%s\""
|
||
msgstr "відсутній виконуваний файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismissingidentifiers
|
||
msgid "Missing identifiers"
|
||
msgstr "Відсутні ідентифікатори"
|
||
|
||
#: lazarusidestrconsts.lismissingpackages
|
||
msgid "Missing Packages"
|
||
msgstr "Пропущені пакунки"
|
||
|
||
#: lazarusidestrconsts.lismissingunitschoices
|
||
msgid "Your choices are:"
|
||
msgstr "Ваш вибір:"
|
||
|
||
#: lazarusidestrconsts.lismissingunitscomment
|
||
msgid "Comment Out"
|
||
msgstr "Закоментувати"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||
msgid "For Delphi only"
|
||
msgstr "Лише для Delphi"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1
|
||
msgid "1) Comment out the selected units."
|
||
msgstr "1) Закоментувати вибрані модулі."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo1b
|
||
msgid "1) Use the units only for Delphi."
|
||
msgstr "1) Використовувати модулі лише для Delphi."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo2
|
||
msgid "2) Search for units. Found paths are added to project settings."
|
||
msgstr "2) Шукати модулі. Знайдені шляхи додати до параметрів проекту."
|
||
|
||
#: lazarusidestrconsts.lismissingunitsinfo3
|
||
msgid "3) Abort now, install packages or fix paths and try again."
|
||
msgstr "3) Перервати зараз, встановити пакунки або виправити шляхи і спробувати знов."
|
||
|
||
#: lazarusidestrconsts.lismissingunitssearch
|
||
msgid "Search Unit Path"
|
||
msgstr "Шлях пошуку модуля"
|
||
|
||
#: lazarusidestrconsts.lismissingunitsskip
|
||
msgid "Skip this Unit"
|
||
msgstr "Пропустити цей Модуль"
|
||
|
||
#: lazarusidestrconsts.lismitnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (c) <year> <copyright holders>\n"
|
||
"\n"
|
||
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
||
"\n"
|
||
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
||
"\n"
|
||
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
||
msgstr ""
|
||
"<description>\n"
|
||
"\n"
|
||
"© <year> <copyright holders>\n"
|
||
"\n"
|
||
"Дана ліцензія дозволяє особам, які мають копію даного програмного забезпечення та супутньої документації (надалі іменуються «Програмне Забезпечення»), безоплатно використовувати Програмне Забезпечення без обмежень, включаючи необмежене право на використання, копіювання, змінення, додавання, публікування, розповсюдження, ліцензування та/або продаж копій Програмного Забезпечення, а також і особам, яким надається дане Програмне Забезпечення, при дотриманні таких умов:\n"
|
||
"\n"
|
||
"Зазначене вище повідомлення про авторське право і дані умови повинні бути включені в усі копії або значущі частини Програмного Забезпечення.\n"
|
||
"\n"
|
||
"ПРОГРАМНЕ ЗАБЕЗПЕЧЕННЯ НАДАЄТЬСЯ «ЯК Є», БЕЗ ЖОДНИХ ГАРАНТІЙ, ПРЯМО ПЕРЕДБАЧЕНИХ АБО ТАКИХ, ЩО МАЮТЬСЯ НА УВАЗІ, ЗОКРЕМА, АЛЕ НЕ ОБМЕЖУЮЧИСЬ ГАРАНТІЯМИ ТОВАРНОЇ ПРИДАТНОСТІ, ВІДПОВІДНОСТІ ЙОГО ПЕВНОМУ ПРИЗНАЧЕННЮ І ВІДСУТНОСТІ ПОРУШЕНЬ ПРАВ. НІ В ЯКОМУ РАЗІ АВТОРИ АБО ПРАВОВЛАСНИКИ НЕ БУДУТЬ НЕСТИ ВІДПОВІДАЛЬНІСТЬ ЗА БУДЬ-ЯКИМИ ЗАЯВАМИ ПРО ВІДШКОДУВАННЯ ВТРАТ, ЗБИТКІВ АБО ІНШИМИ ВИМОГАМИ ПРО ПОРУШЕННЯ УМОВ ЧИННИХ КОНТРАКТІВ, ДЕЛІКТІВ ЧИ ІНШОГО, ЩО ВИНИКЛИ ЧЕРЕЗ АБО ПОВ'ЯЗАНІ З ПРОГРАМНИМ ЗАБЕЗПЕЧЕННЯМ АБО ВИКОРИСТАННЯМ ПРОГРАМНОГО ЗАБЕЗПЕЧЕННЯ АБО ІНШИМИ ДІЯМИ З ПРОГРАМНИМ ЗАБЕЗПЕЧЕННЯМ.\n"
|
||
|
||
#: lazarusidestrconsts.lismmadditionsandoverrides
|
||
msgid "Additions and Overrides"
|
||
msgstr "Додатки і перекриття"
|
||
|
||
#: lazarusidestrconsts.lismmaddscustomoptions
|
||
msgid "Adds custom options:"
|
||
msgstr "Додати власні параметри:"
|
||
|
||
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
||
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
||
msgstr "Додати довільні параметри FPC, наприклад, -O1 -ghtl -dFlag"
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackages
|
||
msgid "Apply to all packages."
|
||
msgstr "Застосувати до всіх пакунків."
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
||
msgid "Apply to all packages and projects."
|
||
msgstr "Застосувати до всіх пакунків і проектів."
|
||
|
||
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
||
msgid "Apply to all packages matching name \"%s\""
|
||
msgstr "Застосувати до всіх пакунків з назвами \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmapplytoproject
|
||
msgid "Apply to project."
|
||
msgstr "Застосувати до проекту."
|
||
|
||
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
||
msgid "Create a new group of options"
|
||
msgstr "Створити нову групу параметрів"
|
||
|
||
#: lazarusidestrconsts.lismmcustomoption
|
||
msgid "Custom Option"
|
||
msgstr "Власний параметр"
|
||
|
||
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
||
msgid "Delete the selected target or option"
|
||
msgstr "Видалити вибрану ціль або параметр"
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
||
msgid "Does not add custom options:"
|
||
msgstr "Власні параметри не додано:"
|
||
|
||
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
||
msgid "Does not have IDE Macro %s:=%s"
|
||
msgstr "Не має макросу ІСР %s:=%s"
|
||
|
||
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
||
msgid "Does not override OutDir (-FU)"
|
||
msgstr "Не перекривається OutDir (-FU)"
|
||
|
||
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
||
msgid "Exclude all packages matching name \"%s\""
|
||
msgstr "Виключити всі пакунки з назвами \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
||
msgid "expected \":=\" after macro name, but found \"%s\""
|
||
msgstr "після назви макросу очікувалось \":=\", а виявлено \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
||
msgid "expected macro name, but found \"%s\""
|
||
msgstr "очікувалась назва макросу, а виявлено \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmfromto
|
||
msgid "From %s to %s"
|
||
msgstr "З %s до %s"
|
||
|
||
#: lazarusidestrconsts.lismmidemacro
|
||
msgid "IDE Macro"
|
||
msgstr "Макрос ІСР"
|
||
|
||
#: lazarusidestrconsts.lismmidemacro2
|
||
msgid "IDE Macro %s:=%s"
|
||
msgstr "Макрос ІСР %s:=%s"
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterat
|
||
msgid "invalid character \"%s\" at %s"
|
||
msgstr "неправильний символ \"%s\" у %s"
|
||
|
||
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
||
msgid "invalid character in macro value \"%s\""
|
||
msgstr "неправильний символ у значенні макросу \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmmissingmacroname
|
||
msgid "missing macro name"
|
||
msgstr "пропущена назва макросу"
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
||
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
||
msgid "Move selected item down"
|
||
msgstr "Перемістити вибраний елемент вниз"
|
||
|
||
#: lazarusidestrconsts.lismmmoveselecteditemup
|
||
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
||
msgid "Move selected item up"
|
||
msgstr "Перемістити вибраний елемент вгору"
|
||
|
||
#: lazarusidestrconsts.lismmnewtarget
|
||
msgid "New Target"
|
||
msgstr "Нова ціль"
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
||
msgid "Override OutDir (-FU): %s"
|
||
msgstr "Перекривається OutDir (-FU): %s"
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
||
msgid "Override output directory (-FU)"
|
||
msgstr "Перекриття вихідної теки (-FU)"
|
||
|
||
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
||
msgid "Override output directory -FU of target"
|
||
msgstr "Перекриття вихідної теки -FU цілі"
|
||
|
||
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
||
msgid "Redo last undo to this grid"
|
||
msgstr "Повернути останнє скасоване для цієї сітки"
|
||
|
||
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
||
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
||
msgstr "Задайте макрос ІСР, наприклад: LCLWidgetType:=win32"
|
||
|
||
#: lazarusidestrconsts.lismmsets
|
||
msgid "Set \"%s\""
|
||
msgstr "Задайте \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
||
msgid "Stored in IDE (environmentoptions.xml)"
|
||
msgstr "Збережено в ІСР (environmentoptions.xml)"
|
||
|
||
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
||
msgid "Stored in project (.lpi)"
|
||
msgstr "Збережено у проекті (.lpi)"
|
||
|
||
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
||
msgid "Stored in session of project (.lps)"
|
||
msgstr "Збережено у сеансі проекту (.lps)"
|
||
|
||
#: lazarusidestrconsts.lismmtargets
|
||
msgid "Targets: "
|
||
msgstr "Цілі:"
|
||
|
||
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
||
msgid "Undo last change to this grid"
|
||
msgstr "Скасувати останню зміну для цієї сітки"
|
||
|
||
#: lazarusidestrconsts.lismmusesystemencoding
|
||
msgid "Use system encoding"
|
||
msgstr "Використати системне кодування"
|
||
|
||
#: lazarusidestrconsts.lismmusesystemencodinghint
|
||
msgid "Disable support for UTF-8 default string encoding."
|
||
msgstr "Вимкнути підтримку типового кодування рядків UTF-8."
|
||
|
||
#: lazarusidestrconsts.lismmvalues
|
||
msgid "Value \"%s\""
|
||
msgstr "Значення \"%s\""
|
||
|
||
#: lazarusidestrconsts.lismmwas
|
||
msgid "(was \"%s\")"
|
||
msgstr "(було \"%s\")"
|
||
|
||
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
||
msgid "WidgetSet change is available only for LCL projects"
|
||
msgstr "Зміна WidgetSet доступна лише для LCL"
|
||
|
||
#: lazarusidestrconsts.lismode
|
||
msgid ", Mode: %s"
|
||
msgstr ", Режим: %s"
|
||
|
||
#: lazarusidestrconsts.lismodifiedlgplnotice
|
||
msgid ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
||
"\n"
|
||
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
||
"\n"
|
||
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
||
"\n"
|
||
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
msgstr ""
|
||
"<description>\n"
|
||
"\n"
|
||
"Copyright (C) <year> <name of author> <contact>\n"
|
||
"\n"
|
||
"Ця бібліотека є вільним програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation з такими змінами: \n"
|
||
"\n"
|
||
"Як особливий виняток, власники авторських прав на цю бібліотеку дають вам дозвіл компонувати цю бібліотеку з незалежними модулями для створення виконуваних файлів, незалежно від умов ліцензії цих незалежних модулів, а також копіювати і поширювати отриманий виконуваний файл відповідно до умов на ваш вибір, за умови, що ви виконаєте для кожного пов'язаного незалежного модуля умови ліцензії цього модуля. Незалежний модуль - це модуль, який не отриманий з або на основі цієї бібліотеки. Якщо ви зміните цю бібліотеку, ви можете розширити цей виняток для вашої версії бібліотеки, але ви не зобов'язані це робити. Якщо ви не хочете це робити, видаліть цей виняток з вашої версії.\n"
|
||
"\n"
|
||
"Ця програма поширюється з надією, що вона буде корисною, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується її придатність для певної мети. Докладнішу інформацію дивіться в ліцензії GNU LGPL. \n"
|
||
"\n"
|
||
"Ви повинні були отримати копію ліцензії GNU LGPL з цією бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
||
|
||
#: lazarusidestrconsts.lismodify
|
||
msgid "&Modify"
|
||
msgstr "&Змінити"
|
||
|
||
#: lazarusidestrconsts.lismore
|
||
msgctxt "lazarusidestrconsts.lismore"
|
||
msgid "More"
|
||
msgstr "Більше"
|
||
|
||
#: lazarusidestrconsts.lismoresub
|
||
msgctxt "lazarusidestrconsts.lismoresub"
|
||
msgid "More"
|
||
msgstr "Більше"
|
||
|
||
#: lazarusidestrconsts.lismove
|
||
msgid "Move"
|
||
msgstr "Перемістити"
|
||
|
||
#: lazarusidestrconsts.lismovefiles
|
||
msgid "Move Files"
|
||
msgstr "Перемістити файли"
|
||
|
||
#: lazarusidestrconsts.lismovefiles2
|
||
msgid "Move files?"
|
||
msgstr "Перемістити файли?"
|
||
|
||
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
||
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
||
msgstr "Перемістити %s файл(и,ів) з %s до теки%s%s%sу %s?"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositiondown
|
||
msgid "Move \"%s\" one position down"
|
||
msgstr "Перемістити \"%s\" на позицію вниз"
|
||
|
||
#: lazarusidestrconsts.lismoveonepositionup
|
||
msgid "Move \"%s\" one position up"
|
||
msgstr "Перемістити \"%s\" на позицію вверх"
|
||
|
||
#: lazarusidestrconsts.lismoveorcopyfiles
|
||
msgid "Move or Copy files?"
|
||
msgstr "Перемістити або скопіювати файли?"
|
||
|
||
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
||
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
||
msgstr "Перемістити або скопіювати %s файл(и,ів) з %s до теки%s%s%sу %s?"
|
||
|
||
#: lazarusidestrconsts.lismovepage
|
||
msgid "Move Page"
|
||
msgstr "Перемістити сторінку"
|
||
|
||
#: lazarusidestrconsts.lismoveselecteddown
|
||
msgid "Move selected item down (Ctrl+Down)"
|
||
msgstr "Змістити вибраний ел-т вниз (Ctrl+Down)"
|
||
|
||
#: lazarusidestrconsts.lismoveselectedup
|
||
msgid "Move selected item up (Ctrl+Up)"
|
||
msgstr "Змістити вибраний ел-т вверх (Ctrl+Up)"
|
||
|
||
#: lazarusidestrconsts.lismoveto
|
||
msgid "Move to: "
|
||
msgstr "Перемістити до:"
|
||
|
||
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
||
msgid "Moving these units will break their uses sections. See Messages window for details."
|
||
msgstr "Переміщення цих модулів зіпсує їхні секції Uses. Детальніше дивіться у вікні повідомлень."
|
||
|
||
#: lazarusidestrconsts.lismpcstyle
|
||
msgid "C style: \" => \\\""
|
||
msgstr "Стиль C: \" => \\\""
|
||
|
||
#: lazarusidestrconsts.lismpescapequotes
|
||
msgid "Escape "es"
|
||
msgstr "Екранувати &лапки"
|
||
|
||
#: lazarusidestrconsts.lismpmultipaste
|
||
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
||
msgid "MultiPaste"
|
||
msgstr "Мультивставка"
|
||
|
||
#: lazarusidestrconsts.lismppascalstyle
|
||
msgid "Pascal style: ' => ''"
|
||
msgstr "Стиль Pascal: ' => ''"
|
||
|
||
#: lazarusidestrconsts.lismppasteoptions
|
||
msgid "Paste &options"
|
||
msgstr "Параметри &вставки"
|
||
|
||
#: lazarusidestrconsts.lismppreview
|
||
msgid "&Preview"
|
||
msgstr "&Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.lismptextaftereachline
|
||
msgid "Text &after each line"
|
||
msgstr "Текст п&ісля кожним рядком"
|
||
|
||
#: lazarusidestrconsts.lismptextbeforeeachline
|
||
msgid "Text &before each line"
|
||
msgstr "Текст п&еред кожним рядком"
|
||
|
||
#: lazarusidestrconsts.lismptrimclipboardcontents
|
||
msgid "&Trim clipboard contents"
|
||
msgstr "&Обрізати вміст буфера"
|
||
|
||
#: lazarusidestrconsts.lisms
|
||
msgid "(ms)"
|
||
msgstr "(мс)"
|
||
|
||
#: lazarusidestrconsts.lismsgcolors
|
||
msgid "Message colors"
|
||
msgstr "Кольори повідомлення"
|
||
|
||
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
||
msgid "Multiple directories are separated with semicolons"
|
||
msgstr "Декілька тек, відокремлених крапкою з комою"
|
||
|
||
#: lazarusidestrconsts.lismultiplepack
|
||
msgid ", multiple packages: "
|
||
msgstr ", декілька пакунків:"
|
||
|
||
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
||
msgid "Save messages to file (*.txt)"
|
||
msgstr "Зберегти повідомлення в файл (*.txt)"
|
||
|
||
#: lazarusidestrconsts.lisname
|
||
msgctxt "lazarusidestrconsts.lisname"
|
||
msgid "Name"
|
||
msgstr "Назва"
|
||
|
||
#: lazarusidestrconsts.lisnameconflict
|
||
msgid "Name conflict"
|
||
msgstr "Конфлікт назв"
|
||
|
||
#: lazarusidestrconsts.lisnameofactivebuildmode
|
||
msgid "Name of active build mode"
|
||
msgstr "Назва активного режиму збирання"
|
||
|
||
#: lazarusidestrconsts.lisnameofnewprocedure
|
||
msgid "Name of new procedure"
|
||
msgstr "Назва нової процедури"
|
||
|
||
#: lazarusidestrconsts.lisnever
|
||
msgctxt "lazarusidestrconsts.lisnever"
|
||
msgid "Never"
|
||
msgstr "Ніколи"
|
||
|
||
#: lazarusidestrconsts.lisnew
|
||
msgctxt "lazarusidestrconsts.lisnew"
|
||
msgid "New"
|
||
msgstr "Новий"
|
||
|
||
#: lazarusidestrconsts.lisnewclass
|
||
msgid "New Class"
|
||
msgstr "Новий клас"
|
||
|
||
#: lazarusidestrconsts.lisnewconsoleapplication
|
||
msgid "New console application"
|
||
msgstr "Новий консольний застосунок"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
||
msgid "Create a new editor file.%sChoose a type."
|
||
msgstr "Створити новий файл редактора.%s Виберіть тип."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
||
msgid "Create a new empty text file."
|
||
msgstr "Створити новий порожній текстовий файл."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
||
msgid "Create a new project.%sChoose a type."
|
||
msgstr "Створити новий проект.%sВиберіть тип."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
||
msgid "Create a new standard package.%sA package is a collection of units and components."
|
||
msgstr "Створити новий стандартний пакунок%sПакунок - це набір модулів і компонентів."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
||
msgid "Create a new unit with a datamodule."
|
||
msgstr "Створити новий модуль з модулем даних."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
||
msgid "Create a new unit with a frame."
|
||
msgstr "Створити новий модуль з фреймом."
|
||
|
||
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
||
msgid "Create a new unit with a LCL form."
|
||
msgstr "Створити новий модуль з формою LCL."
|
||
|
||
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
||
msgid "Inherit from a project form or component"
|
||
msgstr "Успадкувати з форми або компонента проекту"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
||
msgid "No item selected"
|
||
msgstr "Не вибрано пункту"
|
||
|
||
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
||
msgid "Please select an item first."
|
||
msgstr "Виберіть спочатку елемент"
|
||
|
||
#: lazarusidestrconsts.lisnewencoding
|
||
msgid "New encoding:"
|
||
msgstr "Нове кодування:"
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname
|
||
msgid "Macro %d"
|
||
msgstr "Макрос %d"
|
||
|
||
#: lazarusidestrconsts.lisnewmacroname2
|
||
msgid "New Macroname"
|
||
msgstr "Нова назва макросу"
|
||
|
||
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
||
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
||
msgstr "Реалізації нових методів вставлено між наявними методами цього класу. За алфавітом, в кінці або в порядку оголошення.Реалізації нових методів вставлено між наявними методами цього класу. За алфавітом, в кінці або в порядку оголошення."
|
||
|
||
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
||
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
||
msgstr "Оголошення нових методів і членів у розділах class..end вставляються за алфавітом чи в кінці.Оголошення нових методів і членів у розділах class..end вставляються за алфавітом чи в кінці."
|
||
|
||
#: lazarusidestrconsts.lisnewpage
|
||
msgid "New page"
|
||
msgstr "Нова сторінка"
|
||
|
||
#: lazarusidestrconsts.lisnewproject
|
||
msgid "(new project)"
|
||
msgstr "(новий проект)"
|
||
|
||
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
||
msgid "New recorded macros. Not to be saved"
|
||
msgstr "Новий записаний макрос. Не збережений"
|
||
|
||
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
||
msgid "New units are added to uses sections"
|
||
msgstr "Нові модулі додаються в секцію uses"
|
||
|
||
#: lazarusidestrconsts.lisno
|
||
msgid "No"
|
||
msgstr "Ні"
|
||
|
||
#: lazarusidestrconsts.lisnobackupfiles
|
||
msgid "No backup files"
|
||
msgstr "Немає резервних файлів"
|
||
|
||
#: lazarusidestrconsts.lisnobuildprofilesselected
|
||
msgid "No profiles are selected to be built."
|
||
msgstr "Профілів збирання не вибрано."
|
||
|
||
#: lazarusidestrconsts.lisnochange
|
||
msgid "No change"
|
||
msgstr "Без змін"
|
||
|
||
#: lazarusidestrconsts.lisnocodeselected
|
||
msgid "No code selected"
|
||
msgstr "Не вибрано коду"
|
||
|
||
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
||
msgid "No compiler options inherited."
|
||
msgstr "Не успадковані параметри компілятора"
|
||
|
||
#: lazarusidestrconsts.lisnohints
|
||
msgid "no hints"
|
||
msgstr "підказок немає"
|
||
|
||
#: lazarusidestrconsts.lisnoidewindowselected
|
||
msgid "No IDE window selected"
|
||
msgstr "Вікно ІСР не вибране"
|
||
|
||
#: lazarusidestrconsts.lisnolfmfile
|
||
msgid "No LFM file"
|
||
msgstr "Файл LFM відсутній"
|
||
|
||
#: lazarusidestrconsts.lisnomacroselected
|
||
msgid "No macro selected"
|
||
msgstr "Макрос не вибраний"
|
||
|
||
#: lazarusidestrconsts.lisnomessageselected
|
||
msgid "(no message selected)"
|
||
msgstr "(повідомлення не вибрано)"
|
||
|
||
#: lazarusidestrconsts.lisnoname
|
||
msgid "noname"
|
||
msgstr "без назви"
|
||
|
||
#: lazarusidestrconsts.lisnone
|
||
msgid "%snone"
|
||
msgstr "%sжоден"
|
||
|
||
#: lazarusidestrconsts.lisnoneclicktochooseone
|
||
msgid "none, click to choose one"
|
||
msgstr "жоден, клацніть щоб вибрати"
|
||
|
||
#: lazarusidestrconsts.lisnoneselected
|
||
msgid "(None selected)"
|
||
msgstr "(Не вибрано)"
|
||
|
||
#: lazarusidestrconsts.lisnonodeselected
|
||
msgid "no node selected"
|
||
msgstr "не вибрано вузлів"
|
||
|
||
#: lazarusidestrconsts.lisnopascalfile
|
||
msgid "No Pascal file"
|
||
msgstr "Файл Pascal відсутній"
|
||
|
||
#: lazarusidestrconsts.lisnoprogramfilesfound
|
||
msgid "No program file \"%s\" found."
|
||
msgstr "Файл програми \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
||
msgid "No ResourceString Section found"
|
||
msgstr "Не знайдено розділу в ResourceString"
|
||
|
||
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
||
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
||
msgstr "Як правило фільтр є регулярним виразом. В простому синтаксисі a . є нормальним символом, a * відповідає за все, a ? відповідає за будь-який символ, а кома і крапка з комою відділяють альтернативи. Наприклад, простий синтаксис *.pas;*.pp переписується на ^(.*\\.pas|.*\\.pp)$"
|
||
|
||
#: lazarusidestrconsts.lisnostringconstantfound
|
||
msgid "No string constant found"
|
||
msgstr "Рядкову константу не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisnotadesigntimepackage
|
||
msgid "Not a designtime package"
|
||
msgstr "Не пакунок часу розробки"
|
||
|
||
#: lazarusidestrconsts.lisnotaninstallpackage
|
||
msgid "Not an install package"
|
||
msgstr "Не встановлювальний пакунок"
|
||
|
||
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
||
msgid "Not a valid Pascal identifier"
|
||
msgstr "Не є допустимим ідентифікатором Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnote
|
||
msgctxt "lazarusidestrconsts.lisnote"
|
||
msgid "Note"
|
||
msgstr "Зауваження"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposbottom
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
||
msgid "Bottom"
|
||
msgstr "Нижній"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposleft
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabposright
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.lisnotebooktabpostop
|
||
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
||
msgid "Top"
|
||
msgstr "Верхній"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
||
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
||
msgstr "ЗАУВАЖЕННЯ: Неможливо створити означений шаблон для текстів Free Pascal"
|
||
|
||
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
||
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
||
msgstr "ЗАУВАЖЕННЯ: Неможливо створити означений шаблон для текстів Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisnotemplateselected
|
||
msgid "no template selected"
|
||
msgstr "шаблон не вибрано"
|
||
|
||
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
|
||
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
|
||
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
|
||
msgstr "Не вдалось знайти %s у %s у рядку %s, у стовпці %s.%sМожливо, повідомлення застаріло."
|
||
|
||
#: lazarusidestrconsts.lisnotimplemented
|
||
msgid "Not implemented"
|
||
msgstr "Не реалізовано"
|
||
|
||
#: lazarusidestrconsts.lisnotimplementedyet
|
||
msgid "Not implemented yet:%s%s"
|
||
msgstr "Ще не реалізовано:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisnotinstalled
|
||
msgid "not installed"
|
||
msgstr "не встановлено"
|
||
|
||
#: lazarusidestrconsts.lisnotnow
|
||
msgid "Not now"
|
||
msgstr "Не зараз"
|
||
|
||
#: lazarusidestrconsts.lisnowloadedscheme
|
||
msgid "Now loaded: "
|
||
msgstr "Завантажено: "
|
||
|
||
#: lazarusidestrconsts.lisnpcreate
|
||
msgid "Create"
|
||
msgstr "Створити"
|
||
|
||
#: lazarusidestrconsts.lisnpcreateanewproject
|
||
msgid "Create a new project"
|
||
msgstr "Створити новий проект"
|
||
|
||
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
||
msgid "Number of files to convert: %s"
|
||
msgstr "К-сть файлів для конвертування: %s"
|
||
|
||
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
||
msgid "Object Inspector becomes visible when components are selected in designer."
|
||
msgstr "Показувати інспектор об'єктів при виборі компонентів у редакторі форм"
|
||
|
||
#: lazarusidestrconsts.lisobjectpascaldefault
|
||
msgid "Object Pascal - default"
|
||
msgstr "Object Pascal - типово"
|
||
|
||
#: lazarusidestrconsts.lisobjectpath
|
||
msgid "object path"
|
||
msgstr "шлях до об'єкта"
|
||
|
||
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
||
msgid "Switch to Object Inspector Favorites tab"
|
||
msgstr "Перейти на вкладку Обране Інспектора об'єктів"
|
||
|
||
#: lazarusidestrconsts.lisoff
|
||
msgid "? (Off)"
|
||
msgstr "? (Викл)"
|
||
|
||
#: lazarusidestrconsts.lisofpackage
|
||
msgid " of package %s"
|
||
msgstr " пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lisoftheprojectinspector
|
||
msgid " of the Project Inspector"
|
||
msgstr " в інспекторі проекту"
|
||
|
||
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
||
msgid "Add to favorite properties"
|
||
msgstr "Додати до обраних властивостей"
|
||
|
||
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
||
msgid "Choose a base class for the favorite property \"%s\"."
|
||
msgstr "Виберіть базовий клас для обраної властивості \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisoifclassnotfound
|
||
msgid "Class \"%s\" not found."
|
||
msgstr "Клас \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
||
msgid "Remove from favorite properties"
|
||
msgstr "Вилучити з обраних властивостей"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
||
msgid "auto install dynamic"
|
||
msgstr "авто-встановити динамічно"
|
||
|
||
#: lazarusidestrconsts.lisoipautoinstallstatic
|
||
msgid "auto install static"
|
||
msgstr "авто-встановити статично"
|
||
|
||
#: lazarusidestrconsts.lisoipdescription
|
||
msgid "Description: "
|
||
msgstr "Опис: "
|
||
|
||
#: lazarusidestrconsts.lisoipdescriptiondescription
|
||
msgid "%sDescription: %s"
|
||
msgstr "%sОпис: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipfilename
|
||
msgid "Filename: %s"
|
||
msgstr "Назва файлу: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalleddynamic
|
||
msgid "installed dynamic"
|
||
msgstr "встановлено динамічно"
|
||
|
||
#: lazarusidestrconsts.lisoipinstalledstatic
|
||
msgid "installed static"
|
||
msgstr "встановлено статично"
|
||
|
||
#: lazarusidestrconsts.lisoiplicenselicense
|
||
msgid "%sLicense: %s"
|
||
msgstr "%sЛіцензія: %s"
|
||
|
||
#: lazarusidestrconsts.lisoipmissing
|
||
msgid "missing"
|
||
msgstr "відсутній"
|
||
|
||
#: lazarusidestrconsts.lisoipmodified
|
||
msgid "modified"
|
||
msgstr "змінено"
|
||
|
||
#: lazarusidestrconsts.lisoipopenloadedpackage
|
||
msgid "Open Loaded Package"
|
||
msgstr "Відкрити завантажений пакунок"
|
||
|
||
#: lazarusidestrconsts.lisoippackagename
|
||
msgid "Package Name"
|
||
msgstr "Назва Пакунку"
|
||
|
||
#: lazarusidestrconsts.lisoippleaseselectapackage
|
||
msgid "Please select a package"
|
||
msgstr "Виберіть пакунок"
|
||
|
||
#: lazarusidestrconsts.lisoipreadonly
|
||
msgid "readonly"
|
||
msgstr "тільки для читання"
|
||
|
||
#: lazarusidestrconsts.lisoipstate
|
||
msgctxt "lazarusidestrconsts.lisoipstate"
|
||
msgid "State"
|
||
msgstr "Стан"
|
||
|
||
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "%sThis package is installed, but the lpk file was not found"
|
||
msgstr "%sЦей пакунок вже встановлений, але файлу lpk не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisok
|
||
msgctxt "lazarusidestrconsts.lisok"
|
||
msgid "OK"
|
||
msgstr "Гаразд"
|
||
|
||
#: lazarusidestrconsts.lisoldclass
|
||
msgid "Old Class"
|
||
msgstr "Старий клас"
|
||
|
||
#: lazarusidestrconsts.lison
|
||
msgid "? (On)"
|
||
msgstr "? (Вкл)"
|
||
|
||
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
||
msgid "On break line (i.e. return or enter key)"
|
||
msgstr "При розриві рядка (тобто при натисканні клавіші Enter)"
|
||
|
||
#: lazarusidestrconsts.lisonly32bit
|
||
msgid "only 32bit"
|
||
msgstr "лише 32біт"
|
||
|
||
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
||
msgid "Only available on Windows. Run the tool hidden."
|
||
msgstr "Лише для Windows. Запускати прихованим."
|
||
|
||
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
||
msgid "Only available on Windows. Run tool in a new console."
|
||
msgstr "Лише для Windows. Запускати у новій консолі."
|
||
|
||
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
||
msgid "Only messages fitting this regular expression:"
|
||
msgstr "Лише повідомлення, що відповідають регулярному виразу:"
|
||
|
||
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
||
msgid "Only messages with these FPC IDs (comma separated):"
|
||
msgstr "Лише повідомлення з такими ідентифікаторами FPC (розділені комами):"
|
||
|
||
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
||
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
||
msgstr "Лише зареєструвати файли пакунків Lazarus (.lpk). Не збирати."
|
||
|
||
#: lazarusidestrconsts.lisonlysearchforwholewords
|
||
msgid "Only search for whole words"
|
||
msgstr "Шукати лише для повних слів"
|
||
|
||
#: lazarusidestrconsts.lisonpastefromclipboard
|
||
msgid "On paste from clipboard"
|
||
msgstr "При вставці з буферу обміну"
|
||
|
||
#: lazarusidestrconsts.lisopen
|
||
msgctxt "lazarusidestrconsts.lisopen"
|
||
msgid "Open"
|
||
msgstr "Відкрити"
|
||
|
||
#: lazarusidestrconsts.lisopenasxmlfile
|
||
msgid "Open as XML file"
|
||
msgstr "Відкрити як XML-файл"
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunit
|
||
msgid "Open designer on open unit"
|
||
msgstr "Відкривати дизайнер при відкритті модуля"
|
||
|
||
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
||
msgid "Form is loaded in designer always when source unit is opened."
|
||
msgstr "Форма завантажується в Дизайнер при кожному відкритті сирцевого модуля."
|
||
|
||
#: lazarusidestrconsts.lisopenexistingfile
|
||
msgid "Open existing file"
|
||
msgstr "Відкрити наявний файл"
|
||
|
||
#: lazarusidestrconsts.lisopenfile
|
||
msgctxt "lazarusidestrconsts.lisopenfile"
|
||
msgid "Open File"
|
||
msgstr "Відкрити Файл"
|
||
|
||
#: lazarusidestrconsts.lisopenfile2
|
||
msgctxt "lazarusidestrconsts.lisopenfile2"
|
||
msgid "Open file"
|
||
msgstr "Відкрити файл"
|
||
|
||
#: lazarusidestrconsts.lisopenlfm
|
||
msgid "Open %s"
|
||
msgstr "Відкрити %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage
|
||
msgid "Open Package?"
|
||
msgstr "Відкрити пакунок?"
|
||
|
||
#: lazarusidestrconsts.lisopenpackage2
|
||
msgid "Open package %s"
|
||
msgstr "Відкрити пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lisopenpackagefile
|
||
msgid "Open Package File"
|
||
msgstr "Відкрити файл пакунка"
|
||
|
||
#: lazarusidestrconsts.lisopenproject
|
||
msgid "Open Project?"
|
||
msgstr "Відкрити проект?"
|
||
|
||
#: lazarusidestrconsts.lisopenproject2
|
||
msgid "Open project"
|
||
msgstr "Відкрити проект"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectagain
|
||
msgid "Open project again"
|
||
msgstr "Відкрити проект знову"
|
||
|
||
#: lazarusidestrconsts.lisopenprojectfile
|
||
msgid "Open Project File"
|
||
msgstr "Відкрити файл проекту"
|
||
|
||
#: lazarusidestrconsts.lisopensymlink
|
||
msgid "Open symlink"
|
||
msgstr "Відкрити символьне посилання"
|
||
|
||
#: lazarusidestrconsts.lisopentarget
|
||
msgid "Open target"
|
||
msgstr "Відкрити ціль"
|
||
|
||
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
||
msgid "Open the file as normal source"
|
||
msgstr "Відкрити файл як текст програми"
|
||
|
||
#: lazarusidestrconsts.lisopenthepackage
|
||
msgid "Open the package %s?"
|
||
msgstr "Відкрити пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lisopentheproject
|
||
msgid "Open the project %s?"
|
||
msgstr "Відкрити проект %s"
|
||
|
||
#: lazarusidestrconsts.lisopentooloptions
|
||
msgid "Open Tool Options"
|
||
msgstr "Відкрити діалог параметрів"
|
||
|
||
#: lazarusidestrconsts.lisopenunit
|
||
msgid "Open Unit"
|
||
msgstr "Відкрити модуль"
|
||
|
||
#: lazarusidestrconsts.lisopenurl
|
||
msgid "Open URL"
|
||
msgstr "Відкрити URL"
|
||
|
||
#: lazarusidestrconsts.lisopenxml
|
||
msgid "Open XML"
|
||
msgstr "Відкритий XML"
|
||
|
||
#: lazarusidestrconsts.lisoptions
|
||
msgctxt "lazarusidestrconsts.lisoptions"
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
||
msgid "Options changed, recompiling clean with -B"
|
||
msgstr "Опції змінені, перезбираю начисто з -B"
|
||
|
||
#: lazarusidestrconsts.lisoptionvalueignored
|
||
msgid "ignored"
|
||
msgstr "проігноровано"
|
||
|
||
#: lazarusidestrconsts.lisor
|
||
msgid "or"
|
||
msgstr "або"
|
||
|
||
#: lazarusidestrconsts.lisos
|
||
msgid ", OS: %s"
|
||
msgstr ", ОС: %s"
|
||
|
||
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
||
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
|
||
msgstr "список шляхів до \"інших модулів\" пакунка \"%s\" містить теку \"%s\", яка вже є у списку шляхів пошуку модулів."
|
||
|
||
#: lazarusidestrconsts.lisoverridelanguage
|
||
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
||
msgstr "Підмінити мову. Наприклад --language=de. Для можливих величин див. теку languages"
|
||
|
||
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
||
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
||
msgstr "%sперевизначити типовий компілятор. напр. ppc386 ppcx64 ppcppc і т.д. типовий міститься в environmentoptions.xml"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
||
msgid "%soverride the project or IDE build mode."
|
||
msgstr "%sперекрити режим збирання проекту чи ІСР."
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
||
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
||
msgstr "%sперевизначити цп проекту. напр. i386 x86_64 powerpc powerpc_64 etc. типовий: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
||
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
||
msgstr "%sперевизначити операційну систему проекту. напр. win32 linux. типова: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
||
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
||
msgstr "%sперевизначити набір віджетів проекту. напр. gtk gtk2 qt win32 carbon. типовий: %s"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefile
|
||
msgid "Overwrite file?"
|
||
msgstr "Переписати файл?"
|
||
|
||
#: lazarusidestrconsts.lisoverwritefileondisk
|
||
msgid "Overwrite file on disk"
|
||
msgstr "Переписати файл на диску"
|
||
|
||
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
||
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
||
msgstr "'Власник' вже використовується в TReader/TWriter. Виберіть іншу назву."
|
||
|
||
#: lazarusidestrconsts.lispackage
|
||
msgid "Package"
|
||
msgstr "Пакунок"
|
||
|
||
#: lazarusidestrconsts.lispackage2
|
||
msgid "package %s"
|
||
msgstr "пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispackage3
|
||
msgid ", package %s"
|
||
msgstr ", пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispackageinfo
|
||
msgid "Package info"
|
||
msgstr "Інфо про пакунок"
|
||
|
||
#: lazarusidestrconsts.lispackagenamebeginswith
|
||
msgid "Package name begins with ..."
|
||
msgstr "Назва пакунка починається з ..."
|
||
|
||
#: lazarusidestrconsts.lispackagenamecontains
|
||
msgid "Package name contains ..."
|
||
msgstr "Назва пакунка містить ..."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
||
msgid "Package needs an output directory."
|
||
msgstr "Пакунку необхідна вихідна тека."
|
||
|
||
#: lazarusidestrconsts.lispackageneedsinstallation
|
||
msgid "Package needs installation"
|
||
msgstr "Пакунок потрібно встановити"
|
||
|
||
#: lazarusidestrconsts.lispackageoption
|
||
msgid "Package \"%s\" Option"
|
||
msgstr "Параметри пакунка \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispackageoutputdirectories
|
||
msgid "Package output directories"
|
||
msgstr "Вихідні теки пакунка"
|
||
|
||
#: lazarusidestrconsts.lispackagesourcedirectories
|
||
msgid "Package source directories"
|
||
msgstr "Теки з сирцями пакунка"
|
||
|
||
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
||
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
||
msgstr "пакунків=%s/%s модулів=%s/%s ідентифікаторів=%s/%s рядків=%s байтів=%s"
|
||
|
||
#: lazarusidestrconsts.lispackageunit
|
||
msgid "package unit"
|
||
msgstr "модуль пакунка"
|
||
|
||
#: lazarusidestrconsts.lispage
|
||
msgid "Page"
|
||
msgstr "Сторінка"
|
||
|
||
#: lazarusidestrconsts.lispagename
|
||
msgid "Page name"
|
||
msgstr "Назва сторінки"
|
||
|
||
#: lazarusidestrconsts.lispagenamealreadyexists
|
||
msgid "Page name \"%s\" already exists. Not added."
|
||
msgstr "Назва сторінки \"%s\" вже існує. Не додано."
|
||
|
||
#: lazarusidestrconsts.lispanic
|
||
msgctxt "lazarusidestrconsts.lispanic"
|
||
msgid "Panic"
|
||
msgstr "Паніка"
|
||
|
||
#: lazarusidestrconsts.lisparsed
|
||
msgid ", parsed "
|
||
msgstr ", проаналізовано "
|
||
|
||
#: lazarusidestrconsts.lisparser
|
||
msgid "parser \"%s\": %s"
|
||
msgstr "парсер \"%s\": %s"
|
||
|
||
#: lazarusidestrconsts.lispasscount
|
||
msgid "Pass Count"
|
||
msgstr "Кількість Проходів"
|
||
|
||
#: lazarusidestrconsts.lispaste
|
||
msgctxt "lazarusidestrconsts.lispaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lispasteclipboard
|
||
msgid "paste clipboard"
|
||
msgstr "вставити буфер обміну"
|
||
|
||
#: lazarusidestrconsts.lispastefromclipboard
|
||
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
||
msgid "Paste from clipboard."
|
||
msgstr "Вставити з буфера обміну."
|
||
|
||
#: lazarusidestrconsts.lispastelcolors
|
||
msgid "Pastel Colors"
|
||
msgstr "Пастельні кольори"
|
||
|
||
#: lazarusidestrconsts.lispath
|
||
msgid "Path"
|
||
msgstr "Шлях"
|
||
|
||
#: lazarusidestrconsts.lispatheditbrowse
|
||
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
||
msgid "Browse"
|
||
msgstr "Переглянути"
|
||
|
||
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
||
msgid "Delete Invalid Paths"
|
||
msgstr "Видалити недійсні Шляхи"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathdown
|
||
msgid "Move path down (Ctrl+Down)"
|
||
msgstr "Зсунути шлях вниз (Ctrl+Down)"
|
||
|
||
#: lazarusidestrconsts.lispatheditmovepathup
|
||
msgid "Move path up (Ctrl+Up)"
|
||
msgstr "Зсунути шлях вверх (Ctrl+Up)"
|
||
|
||
#: lazarusidestrconsts.lispatheditoraddhint
|
||
msgid "Add new path to the list"
|
||
msgstr "Додати новий шлях до списку"
|
||
|
||
#: lazarusidestrconsts.lispatheditordeletehint
|
||
msgid "Delete the selected path"
|
||
msgstr "Видалити вибраний шлях"
|
||
|
||
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
||
msgid "Remove non-existent (gray) paths from the list"
|
||
msgstr "Видалити зі списку шляхи, які не існують (сірі)"
|
||
|
||
#: lazarusidestrconsts.lispatheditorreplacehint
|
||
msgid "Replace the selected path with a new path"
|
||
msgstr "Замінити вибраний шлях новим шляхом"
|
||
|
||
#: lazarusidestrconsts.lispatheditortempladdhint
|
||
msgid "Add template to the list"
|
||
msgstr "Додати шаблон в список"
|
||
|
||
#: lazarusidestrconsts.lispatheditpathtemplates
|
||
msgid "Path templates"
|
||
msgstr "Шляхи шаблонів"
|
||
|
||
#: lazarusidestrconsts.lispatheditsearchpaths
|
||
msgid "Search paths:"
|
||
msgstr "Шляхи пошуку:"
|
||
|
||
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
||
msgid "path of the instantfpc cache"
|
||
msgstr "шлях кешу instantfpc"
|
||
|
||
#: lazarusidestrconsts.lispathofthemakeutility
|
||
msgid "Path of the make utility"
|
||
msgstr "Шлях утиліти make"
|
||
|
||
#: lazarusidestrconsts.lispathtoinstance
|
||
msgid "Path to failed Instance:"
|
||
msgstr "Шлях до невдалого примірника:"
|
||
|
||
#: lazarusidestrconsts.lispause
|
||
msgctxt "lazarusidestrconsts.lispause"
|
||
msgid "Pause"
|
||
msgstr "Пауза"
|
||
|
||
#: lazarusidestrconsts.lispckcleartousethepackagename
|
||
msgid "Clear to use the package name"
|
||
msgstr "Очистити для використання назви пакунка"
|
||
|
||
#: lazarusidestrconsts.lispckdisablei18noflfm
|
||
msgid "Disable I18N of lfm"
|
||
msgstr "Вимкнути I18N в lfm"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
||
msgid "Add Files from File System"
|
||
msgstr "Додати файли з файлової системи"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddotheritems
|
||
msgid "Add other items"
|
||
msgstr "Додати інші елементи"
|
||
|
||
#: lazarusidestrconsts.lispckeditaddtoproject
|
||
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Додати до проекту"
|
||
|
||
#: lazarusidestrconsts.lispckeditapplychanges
|
||
msgid "Apply changes"
|
||
msgstr "Застосувати зміни"
|
||
|
||
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
||
msgid "Call %sRegister%s procedure of selected unit"
|
||
msgstr "Викликати процедуру %sRegister%s вибраного модуля"
|
||
|
||
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
||
msgid "Clean up dependencies ..."
|
||
msgstr "Очистити залежності ..."
|
||
|
||
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
||
msgid "Clear default/preferred filename of dependency"
|
||
msgstr "Очистити типову/бажану назву файлу залежності"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileeverything
|
||
msgid "Compile everything?"
|
||
msgstr "Скомпілювати всі?"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompilepackage
|
||
msgid "Compile package"
|
||
msgstr "Скомпілювати пакунок"
|
||
|
||
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
||
msgid "Compiler Options for Package %s"
|
||
msgstr "Параметри компілятора для пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
||
msgid "Create fpmake.pp"
|
||
msgstr "Створити fpmake.pp"
|
||
|
||
#: lazarusidestrconsts.lispckeditcreatemakefile
|
||
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
||
msgid "Create Makefile"
|
||
msgstr "Створити Makefile"
|
||
|
||
#: lazarusidestrconsts.lispckeditdefault
|
||
msgid "%s, default: %s"
|
||
msgstr "%s, стандартний: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditdependencyproperties
|
||
msgid "Dependency Properties"
|
||
msgstr "Властивості залежності"
|
||
|
||
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
||
msgid "Edit general options"
|
||
msgstr "Змінити загальні параметри"
|
||
|
||
#: lazarusidestrconsts.lispckeditfileproperties
|
||
msgid "File Properties"
|
||
msgstr "Властивості файлу"
|
||
|
||
#: lazarusidestrconsts.lispckeditinstall
|
||
msgid "Install"
|
||
msgstr "Встановити"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
||
msgid "Invalid maximum version"
|
||
msgstr "Неправильна максимальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
||
msgid "Invalid minimum version"
|
||
msgstr "Неправильна мінімальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditmaximumversion
|
||
msgid "Maximum Version:"
|
||
msgstr "Максимальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditminimumversion
|
||
msgid "Minimum Version:"
|
||
msgstr "Мінімальна версія"
|
||
|
||
#: lazarusidestrconsts.lispckeditmodified
|
||
msgid "Modified: %s"
|
||
msgstr "Змінено: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencydown
|
||
msgid "Move dependency down"
|
||
msgstr "Пересунути залежність вниз"
|
||
|
||
#: lazarusidestrconsts.lispckeditmovedependencyup
|
||
msgid "Move dependency up"
|
||
msgstr "Пересунути залежність вверх"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackage
|
||
msgid "Package %s"
|
||
msgstr "Пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
||
msgid "Package \"%s\" has changed.%sSave package?"
|
||
msgstr "Пакунок \"%s\" змінено.%s Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
||
msgid "package %s not saved"
|
||
msgstr "пакунок%s не збережений"
|
||
|
||
#: lazarusidestrconsts.lispckeditpage
|
||
msgid "%s, Page: %s"
|
||
msgstr "%s, Сторінка: %s"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadddependency
|
||
msgid "Re-Add dependency"
|
||
msgstr "Оновити залежність"
|
||
|
||
#: lazarusidestrconsts.lispckeditreaddfile
|
||
msgid "Re-Add file"
|
||
msgstr "Оновити файл"
|
||
|
||
#: lazarusidestrconsts.lispckeditreadonly
|
||
msgid "Read Only: %s"
|
||
msgstr "Тільки для читання:%s"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
||
msgid "Recompile All Required"
|
||
msgstr "Необхідно перекомпілювати все"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompileclean
|
||
msgid "Recompile Clean"
|
||
msgstr "Перебудувати начисто"
|
||
|
||
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
||
msgid "Re-Compile this and all required packages?"
|
||
msgstr "Перекомпілювати це, а також і всі потрібні пакунки?"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisteredplugins
|
||
msgid "Registered plugins"
|
||
msgstr "Зареєстровані доповнення"
|
||
|
||
#: lazarusidestrconsts.lispckeditregisterunit
|
||
msgid "Register unit"
|
||
msgstr "Зареєструвати модуль"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency
|
||
msgid "Remove dependency"
|
||
msgstr "Видалити залежність"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependency2
|
||
msgid "Remove Dependency?"
|
||
msgstr "Видалити залежність?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
||
msgstr "Видалити залежність \"%s\"%sз пакунка \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedfiles
|
||
msgid "Removed Files"
|
||
msgstr "Видалені файли"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Видалені необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile
|
||
msgid "Remove file"
|
||
msgstr "Видалити файл"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefile2
|
||
msgid "Remove file?"
|
||
msgstr "Видалити файл?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
||
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
||
msgstr "Видалити файл \"%s\"%s з пакунка \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
||
msgid "Remove selected item"
|
||
msgstr "Видалити вибраний елемент"
|
||
|
||
#: lazarusidestrconsts.lispckeditrequiredpackages
|
||
msgid "Required Packages"
|
||
msgstr "Необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts.lispckeditsavepackage
|
||
msgid "Save Package"
|
||
msgstr "Зберегти пакунок"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
||
msgid "Store file name as default for this dependency"
|
||
msgstr "Зберегти назву файлу як типову для цієї залежності"
|
||
|
||
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
||
msgid "Store file name as preferred for this dependency"
|
||
msgstr "Зберегти назву файлу як бажану для цієї залежності"
|
||
|
||
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
||
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Максимальна версія \"%s\" не є правильною версією пакунка.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
||
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
||
msgstr "Мінімальна версія \"%s\" не є правильною версією пакунка.%s(гарний приклад 1.2.3.4)"
|
||
|
||
#: lazarusidestrconsts.lispckedituninstall
|
||
msgid "Uninstall"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts.lispckeditviewpackagesource
|
||
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
|
||
msgid "View Package Source"
|
||
msgstr "Продивитись код пакунка"
|
||
|
||
#: lazarusidestrconsts.lispckexplbase
|
||
msgid "Base, cannot be uninstalled"
|
||
msgstr "Базовий, не може бути видаленим"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstalled
|
||
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
||
msgid "Installed"
|
||
msgstr "Встановлено"
|
||
|
||
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
||
msgid "Install on next start"
|
||
msgstr "Встановити при наст. запуску"
|
||
|
||
#: lazarusidestrconsts.lispckexplstate
|
||
msgid "%sState: "
|
||
msgstr "%sСтан: "
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
||
msgid "Uninstall on next start (unless needed by an installed package)"
|
||
msgstr "Видалити при наступному запуску (якщо не потрібен іншому пакунку)"
|
||
|
||
#: lazarusidestrconsts.lispckexpluninstallpackage
|
||
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
||
msgid "Uninstall package %s"
|
||
msgstr "Деінсталювати пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
||
msgid "Add options to dependent packages and projects"
|
||
msgstr "Додати параметри до підпорядкованих пакунків і проектів"
|
||
|
||
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
||
msgid "Add paths to dependent packages/projects"
|
||
msgstr "Додати шляхи до залежних пакунків/проектів"
|
||
|
||
#: lazarusidestrconsts.lispckoptsauthor
|
||
msgid "Author"
|
||
msgstr "Автор"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
||
msgid "Automatically rebuild as needed"
|
||
msgstr "Перебудувати за необхідністю автоматично"
|
||
|
||
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
||
msgid "Auto rebuild when rebuilding all"
|
||
msgstr "перебудувати при перезбиранні всіх"
|
||
|
||
#: lazarusidestrconsts.lispckoptscustom
|
||
msgid "Custom"
|
||
msgstr "Спеціальний"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
||
msgid "Description / Abstract"
|
||
msgstr "Опис / Абстрактно"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntime
|
||
msgid "Designtime"
|
||
msgstr "Час розробки"
|
||
|
||
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
||
msgid "Designtime and runtime"
|
||
msgstr "При розробці і запуску"
|
||
|
||
#: lazarusidestrconsts.lispckoptsideintegration
|
||
msgid "IDE Integration"
|
||
msgstr "Інтегрування в ІСР"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinclude
|
||
msgid "Include"
|
||
msgstr "Вставити"
|
||
|
||
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
||
msgid "Invalid package type"
|
||
msgstr "Неправильний тип пакунка"
|
||
|
||
#: lazarusidestrconsts.lispckoptslibrary
|
||
msgid "Library"
|
||
msgstr "Бібліотека"
|
||
|
||
#: lazarusidestrconsts.lispckoptslicense
|
||
msgid "License"
|
||
msgstr "Ліцензія"
|
||
|
||
#: lazarusidestrconsts.lispckoptslinker
|
||
msgid "Linker"
|
||
msgstr "Компонувальник"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmajor
|
||
msgid "Major"
|
||
msgstr "Важливий"
|
||
|
||
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
||
msgid "Manual compilation (never automatically)"
|
||
msgstr "Компіляція вручну (ніякої автоматизації)"
|
||
|
||
#: lazarusidestrconsts.lispckoptsminor
|
||
msgid "Minor"
|
||
msgstr "Другорядний"
|
||
|
||
#: lazarusidestrconsts.lispckoptsobject
|
||
msgid "Object"
|
||
msgstr "Об'єкт"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackageoptions
|
||
msgid "Package Options"
|
||
msgstr "Параметри пакунка"
|
||
|
||
#: lazarusidestrconsts.lispckoptspackagetype
|
||
msgid "Package type"
|
||
msgstr "Тип пакунка"
|
||
|
||
#: lazarusidestrconsts.lispckoptsprovides
|
||
msgid "Provides"
|
||
msgstr "Забезпечує"
|
||
|
||
#: lazarusidestrconsts.lispckoptsrelease
|
||
msgid "Release"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts.lispckoptsruntime
|
||
msgid "Runtime"
|
||
msgstr "Час виконання"
|
||
|
||
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
||
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
||
msgstr "Пакунок \"%s\" має мітку Автовстановлення.%sЦе означає, що він автоматично вмонтується в ІСР. Встановлювані пакунки%sмають бути пакунками для розробки."
|
||
|
||
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
||
msgid "This package provides the same as the following packages:"
|
||
msgstr "Цей пакунок пропонує те саме що і наступні пакунки:"
|
||
|
||
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
||
msgid "Update / Rebuild"
|
||
msgstr "Оновити/Перебудувати"
|
||
|
||
#: lazarusidestrconsts.lispckoptsusage
|
||
msgid "Usage"
|
||
msgstr "Використання"
|
||
|
||
#: lazarusidestrconsts.lispckpackage
|
||
msgid "Package:"
|
||
msgstr "Пакунок:"
|
||
|
||
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
||
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
||
msgstr "Пошукові шляхи для fpdoc xml-файлів. Кілька шляхів повинні бути розділені комою."
|
||
|
||
#: lazarusidestrconsts.lispckshowunneededdependencies
|
||
msgid "Show unneeded dependencies"
|
||
msgstr "Показати непотрібні залежності"
|
||
|
||
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
||
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
||
msgstr "Коли форму буде збережено, ІСР може зберігати всі властивості TTranslateString до файлу po. Для цього необхідно включити I18N для цього пакунка, забезпечити вихідну теку po і зняти цей прапорець."
|
||
|
||
#: lazarusidestrconsts.lispdabort
|
||
msgctxt "lazarusidestrconsts.lispdabort"
|
||
msgid "Abort"
|
||
msgstr "Перервати"
|
||
|
||
#: lazarusidestrconsts.lispdprogress
|
||
msgid "Progress"
|
||
msgstr "Перебіг"
|
||
|
||
#: lazarusidestrconsts.lispecollapsedirectory
|
||
msgid "Collapse directory"
|
||
msgstr "Згорнути директорію"
|
||
|
||
#: lazarusidestrconsts.lispeconflictfound
|
||
msgid "Conflict found"
|
||
msgstr "Знайдений конфлікт"
|
||
|
||
#: lazarusidestrconsts.lispeeditvirtualunit
|
||
msgid "Edit Virtual Unit"
|
||
msgstr "Змінити віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts.lispeexpanddirectory
|
||
msgid "Expand directory"
|
||
msgstr "Розгорнути каталог"
|
||
|
||
#: lazarusidestrconsts.lispefilename
|
||
msgid "Filename:"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts.lispefixfilescase
|
||
msgid "Fix Files Case"
|
||
msgstr "Виправити регістр файлів"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitfilename
|
||
msgid "Invalid unit filename"
|
||
msgstr "Неправильна назва файлу модуля"
|
||
|
||
#: lazarusidestrconsts.lispeinvalidunitname
|
||
msgid "Invalid unitname"
|
||
msgstr "Неправильна назва модуля"
|
||
|
||
#: lazarusidestrconsts.lispemissingfilesofpackage
|
||
msgid "Missing files of package %s"
|
||
msgstr "Загублені файли пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
||
msgid "New file not in include path"
|
||
msgstr "Новий файл не в шляху включення"
|
||
|
||
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
||
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
|
||
msgid "No files missing. All files exist."
|
||
msgstr "Немає втрачених файлів. Всі на місці."
|
||
|
||
#: lazarusidestrconsts.lisperemovefiles
|
||
msgid "Remove files"
|
||
msgstr "Видалити файли"
|
||
|
||
#: lazarusidestrconsts.lisperevertpackage
|
||
msgid "Revert Package"
|
||
msgstr "Повернути пакунок"
|
||
|
||
#: lazarusidestrconsts.lispesavepackageas
|
||
msgid "Save Package As ..."
|
||
msgstr "Зберегти пакунок як ..."
|
||
|
||
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
||
msgid "Show directory hierarchy"
|
||
msgstr "Показати структуру тек"
|
||
|
||
#: lazarusidestrconsts.lispeshowmissingfiles
|
||
msgid "Show Missing Files"
|
||
msgstr "Показати загублені файли"
|
||
|
||
#: lazarusidestrconsts.lispesortfiles
|
||
msgid "Sort Files Permanently"
|
||
msgstr "Сортувати файли остаточно"
|
||
|
||
#: lazarusidestrconsts.lispesortfilesalphabetically
|
||
msgid "Sort files alphabetically"
|
||
msgstr "Сортувати файли за алфавітом"
|
||
|
||
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
||
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
||
msgstr "Файл \"%s\" зараз не є в шляху включення пакунка.%sДодати \"%s\" в шлях включення?"
|
||
|
||
#: lazarusidestrconsts.lispeunitname
|
||
msgid "Unitname:"
|
||
msgstr "Назва модуля:"
|
||
|
||
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
||
msgid "Use all units in directory"
|
||
msgstr "Викор. всі модулі в теці"
|
||
|
||
#: lazarusidestrconsts.lispeusenounitsindirectory
|
||
msgid "Use no units in directory"
|
||
msgstr "Не викор. модулі в теці"
|
||
|
||
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
||
msgid "Clean up package dependencies"
|
||
msgstr "Очищення залежностей пакунків"
|
||
|
||
#: lazarusidestrconsts.lispkgclearselection
|
||
msgid "Clear Selection"
|
||
msgstr "Зняти вибір"
|
||
|
||
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
||
msgid "CompiledSrcPath addition"
|
||
msgstr "Додавання CompiledSrcPath"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
||
msgid "Output directory"
|
||
msgstr "Вихідна тека"
|
||
|
||
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
||
msgid "Package Source Directory Mark"
|
||
msgstr "Позначити теку сирців пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgdefsunitpath
|
||
msgid "Unit Path"
|
||
msgstr "Шлях до модулів"
|
||
|
||
#: lazarusidestrconsts.lispkgdeletedependencies
|
||
msgid "Delete dependencies"
|
||
msgstr "Видалити залежності"
|
||
|
||
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
||
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
||
msgstr "Ви дійсно бажаєте забути всі зміни до пакунка %s і завантажити його з файлу?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
||
msgid "New unit not in unitpath"
|
||
msgstr "Новий модуль не знаходиться в шляху до модулів"
|
||
|
||
#: lazarusidestrconsts.lispkgeditpublishpackage
|
||
msgid "Publish Package"
|
||
msgstr "Опублікувати пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgeditrevertpackage
|
||
msgid "Revert package?"
|
||
msgstr "Повернути пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
||
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
||
msgstr "Файлу \"%s\"%sзараз немає у списку шляхів модулів пакунка.%sДодати \"%s\" до шляхів модуля?"
|
||
|
||
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
||
msgid "More functions for the package"
|
||
msgstr "Більше функцій для пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypebinary
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
||
msgid "Binary"
|
||
msgstr "Бінарне"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeinclude
|
||
msgid "Include file"
|
||
msgstr "Включити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypeissues
|
||
msgid "Issues xml file"
|
||
msgstr "xml файл питань"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelfm
|
||
msgid "LFM - Lazarus form text"
|
||
msgstr "Текст форми LFM - Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypelrs
|
||
msgid "LRS - Lazarus resource"
|
||
msgstr "Ресурс LRS - Lazarus"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypemainunit
|
||
msgid "Main Unit"
|
||
msgstr "Основний модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypetext
|
||
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
||
msgid "Text"
|
||
msgstr "Текст"
|
||
|
||
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
||
msgid "Virtual Unit"
|
||
msgstr "Віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
||
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Тека пакунка. Параметром є ID пакунка, наприклад \"Name\" або \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
||
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Шлях пошуку заголовних файлів пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
||
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Назва пакунка. Параметром є ID пакунка, наприклад \"Name\" або \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
||
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Вихідна тека пакунка. Параметром є ID пакунка, напр., \"Name\" or \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
||
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Шлях пошуку сирців пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
||
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
||
msgstr "Шлях пошуку модуля пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||
msgid "%sAdding new Dependency for package %s: package %s"
|
||
msgstr "%sДодавання нової залежності для пакунка %s: пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||
msgid "%sAdding new Dependency for project %s: package %s"
|
||
msgstr "%sДодавання нової залежності до проекту %s: пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
||
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
||
msgstr "Додати модуль до операторної частини uses пакунка. Унеможливити це тільки для модулів, які в жодному випадку не треба компілювати"
|
||
|
||
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
||
msgid "Ambiguous units found"
|
||
msgstr "Знайдено модулі з однаково розпізнаними назвами"
|
||
|
||
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
||
msgid "Automatically installed packages"
|
||
msgstr "Автом. встановлені пакунки"
|
||
|
||
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
||
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
||
msgstr "%sОбидва пакунки є пов'язаними. Це означає, що або один із них використовує інший, або обидва вони використовуються третім пакунком."
|
||
|
||
#: lazarusidestrconsts.lispkgmangbrokendependency
|
||
msgid "Broken dependency"
|
||
msgstr "Залежність порушена"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
||
msgid "Circular dependencies found"
|
||
msgstr "Знайдені кругові залежності"
|
||
|
||
#: lazarusidestrconsts.lispkgmangcompilepackage
|
||
msgid "Compile package %s"
|
||
msgstr "Скомпілювати пакунок %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeletefailed
|
||
msgid "Delete failed"
|
||
msgstr "Видалення не вдалося"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
||
msgid "Delete Old Package File?"
|
||
msgstr "Видалити старий файл пакунка?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
||
msgid "Delete old package file \"%s\"?"
|
||
msgstr "Видалити старий файл пакунка \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
||
msgid "Dependency without Owner: %s"
|
||
msgstr "Залежність без власника:%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
||
msgid "Error reading file"
|
||
msgstr "Помилка читання файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
||
msgid "Error Reading Package"
|
||
msgstr "Помилка читання пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
||
msgid "Error: updating po files failed for package %s"
|
||
msgstr "Помилка: оновлення po файлу не вдалось для пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
||
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
||
msgid "Error writing file"
|
||
msgstr "Помилка запису файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
||
msgid "Error Writing Package"
|
||
msgstr "Помилка запису пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
||
msgid "File is already in package"
|
||
msgstr "Файл вже є у пакунку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfileisinproject
|
||
msgid "File is in Project"
|
||
msgstr "Файл в проекті"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
||
msgid "Filename differs from Packagename"
|
||
msgstr "Назва файлу відрізняється від назви пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
||
msgid "Filename is used by other package"
|
||
msgstr "Назву файлу використано іншим пакунком"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
||
msgid "Filename is used by project"
|
||
msgstr "Назву файлу використано проектом"
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotfound
|
||
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
||
msgid "File \"%s\" not found."
|
||
msgstr "Файл \"%s\" не знайдено."
|
||
|
||
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
||
msgid "File not saved"
|
||
msgstr "Файл не збережений"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
||
msgid "Installing the package %s will automatically install the package:"
|
||
msgstr "При встановленні пакунка %s буде автоматично встановлено пакунок:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
||
msgid "Installing the package %s will automatically install the packages:"
|
||
msgstr "При встановленні пакунка %s будуть автоматично встановлені пакунки:"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
||
msgid "invalid Compiler filename"
|
||
msgstr "неправильна назва файлу компілятора"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
||
msgid "Invalid file extension"
|
||
msgstr "Неправильне розширення файлу"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
||
msgid "Invalid package file extension"
|
||
msgstr "Неправильне розширення файлу пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
||
msgid "Invalid package filename"
|
||
msgstr "Неправильна назва файлу пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
||
msgid "Invalid package name"
|
||
msgstr "Неправильна назва пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
||
msgid "Invalid Package Name"
|
||
msgstr "Неправильна назва пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
||
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
||
msgstr "Завантаження пакунка %s замінить пакунок%s%s з файлу %s.%sСтарий пакунок змінено.%sЗберегти старий пакунок%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangnewpackage
|
||
msgid "NewPackage"
|
||
msgstr "НовийПакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackage
|
||
msgid "Package: %s"
|
||
msgstr "Пакунок: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
||
msgid "Package conflicts"
|
||
msgstr "Конфлікти пакунків"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
||
msgid "Package is not a designtime package"
|
||
msgstr "Пакунок не є пакунком часу розробки"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
||
msgid "Package is required"
|
||
msgstr "Потрібен пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
||
msgid "package main source file"
|
||
msgstr "головний сирцевий файл пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
||
msgid "Package name already exists"
|
||
msgstr "Така назва пакунка вже існує"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
||
msgid "Packages must have the extension .lpk"
|
||
msgstr "Пакунки повинні мати розширення файлів .lpk"
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
||
msgid "Please compile the package first."
|
||
msgstr "Спочатку скомпілюйте пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
||
msgid "Please save the file before adding it to a package."
|
||
msgstr "Збережіть файл перед додаванням в пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangproject
|
||
msgid "Project: %s"
|
||
msgstr "Проект: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
||
msgid "Rebuild Lazarus?"
|
||
msgstr "Перебудувати Lazarus?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
||
msgid "Rename File lowercase?"
|
||
msgstr "Перейменувати файл в нижній регістр?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
||
msgid "Replace existing file \"%s\"?"
|
||
msgstr "Замінити наявний файл \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangreplacefile
|
||
msgid "Replace File"
|
||
msgstr "Замінити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
||
msgid "One or more required packages were not found. See package graph for details."
|
||
msgstr "Один або кілька необхідних пакунків не були знайдені. Дивіться граф пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
||
msgid ""
|
||
"The package %s is already open in the IDE.\n"
|
||
"You cannot save a package with the same name.\n"
|
||
msgstr ""
|
||
"Пакунок %s вже відкрито в ІСР.\n"
|
||
"Неможливо зберегти пакунок з такою ж назвою.\n"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackage
|
||
msgid "Save package?"
|
||
msgstr "Зберегти пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
||
msgid "Save Package %s (*.lpk)"
|
||
msgstr "Зберегти пакунок%s (*.lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
||
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
||
msgstr "Чи треба змінити назву файлу на нижн. рег. на %s\"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangskipthispackage
|
||
msgid "Skip this package"
|
||
msgstr "Пропустити цей пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
||
msgid "static packages config file"
|
||
msgstr "статичний файл налаштувань пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
||
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
||
msgstr "Файл компілятора для пакунка %s не є виконуваним:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
||
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
||
msgid "The file \"%s\"%sis already in the package %s."
|
||
msgstr "Файл \"%s\"%sвже у пакунку %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
||
msgid "The file \"%s\" is not a Lazarus package."
|
||
msgstr "Файл \"%s\" не є пакунком Lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
||
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
||
msgstr "Назва файлу \"%s\" не відповідає назві пакунка \"%s\" у файлі.%sЗмінити назву пакунка на \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
||
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
||
msgstr "Назва файлу \"%s\" є частиною поточного проекту.%sПроекти і пакунки не мають ділити файли."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
||
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
||
msgstr "Назва файлу \"%s\"використовується%sпакунком \"%s\"%sу файлі \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
||
msgid "The file \"%s\" of package %s was not found."
|
||
msgstr "Файл \"%s\" пакунка %s не знайдений."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
||
msgid "The following package failed to load:"
|
||
msgstr "Наступний пакунок не вдалось завантажити"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
||
msgid "The following packages failed to load:"
|
||
msgstr "Наступні пакунки не вдалось завантажити:"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
||
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
||
msgstr "%sТакі модулі будуть додані до розділу uses %s%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
||
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
|
||
msgstr "Пакунок \"%s\" не компілюється.%sВидалити його зі списку встановлення?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
||
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
||
msgstr "Назва пакунка \"%s\" у%s\"%s\" не є правильною назвою пакунка Lazarus."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
||
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
||
msgstr "Пакунок %s є пакунком тільки часу виконання.%sТакі пакунки не можуть бути встановлені в ІСР."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
||
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
||
msgstr "Пакунок \"%s\" компілюється автоматично, а його вихідна тека - \"%s\", яка знаходиться в типовому шляху пошуку модулів компілятора. Пакунок використовує інші пакунки, які також використовують типовий шлях пошуку модулів компілятора. Це створює нескінченний цикл.%sВи можете вирішити цю проблему, видаливши шлях з конфігурації компілятора (напр. fpc.cfg),%sабо вимкнувши автооновлення цього пакунка, або видаливши залежності."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
||
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
||
msgstr "Пакунок \"%s\" відмічено для встановлення, але його не було знайдено.%sВидалити залежність зі списку установки пакунків?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
||
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
||
msgstr "Пакунок %s потребується для %s, який був позначеним для установки.%sДивись діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
||
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
||
msgstr "Назва пакунка \"%s\" є некоректною.%sВиберіть інший пакунок (напр., package1.lpk)."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
||
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
||
msgstr "Назва пакунка \"%s\" %sфайлу \"%s\" є некоректною."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
||
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок \"%s\" відмічено.%sЗараз Lazarus підтримує тільки статично пов'язані пакунки. Поточне видалення потребує перезбирання і перезапуску Lazarus.%sВи бажаєте перезібрати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
||
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
||
msgstr "Пакунок \"%s\" позначено для встановлення.%sЗараз Lazarus підтримує тільки статично пов'язані пакунки. Поточна установка потребує перезбирання і перезапуску Lazarus.%sВи бажаєте перезібрати Lazarus зараз?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
||
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
||
msgstr "Проект вимагає пакунка \"%s\".%sАле його не знайдено. Див. Проект -> Інспектор проекту."
|
||
|
||
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
||
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
||
msgstr "Існує два модулі з однаковими назвами:%s1. \"%s\" з %s%s2. \"%s\" з %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
||
msgid "There is a circular dependency in the packages. See package graph."
|
||
msgstr "В пакунках є кільцева залежність. Дивіться граф пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
||
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
||
msgstr "Існує модуль FPC з такою самою назвою, як і пакунок:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
||
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
||
msgstr "Існує модуль FPC з такою самою назвою, як:%s\"%s\" з %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
||
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
||
msgstr "Вже існує іншій пакунок з назвою \"%s\".%sКонфліктний пакунок:\"%s\"%sФайл: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
||
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
||
msgstr "Вже завантажено пакунок \"%s\" %sз файлу \"%s\".%sДив. Пакунок -> Діаграма пакунків.%sЗаміна неможлива."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
||
msgid "There is an unsaved package in the required packages. See package graph."
|
||
msgstr "Посеред необхідних пакунків є не збережений. Див. діаграму пакунків."
|
||
|
||
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
||
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
||
msgstr "Існує модуль з такою самою назвою, як і пакунок: %s1. \"%s\" з %s%s2. \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
||
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
||
msgstr "Це віртуальний пакунок. В нього немає коду. Збережіть спочатку пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
||
msgid "Unable to create directory"
|
||
msgstr "Неможливо створити теку"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
||
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
||
msgstr "Неможливо створити теку виведення \"%s\"%sдля пакунка %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
||
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
||
msgstr "Неможливо створити теку сирців пакунка \"%s\"%sдля пакунка %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
||
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
||
msgstr "Неможливо створити теку цілі для Lazarus:%s\"%s\".%sЦя тека потрібна для оновленого ІСР Lazarus з вашими пакунками."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
||
msgid "Unable to delete file \"%s\"."
|
||
msgstr "Неможливо видалити файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
||
msgid "Unable to delete file"
|
||
msgstr "Неможливо видалити файл"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
||
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
||
msgstr "Неможливо видалити старий файл \"%s\"%sдля пакунка %s."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
||
msgid "Unable to load package"
|
||
msgstr "Неможливо завантажити пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
||
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
||
msgstr "Неможливо відкрити пакунок\"%s\".%sЦей пакунок було позначено для встановлення."
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
||
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
||
msgstr "Неможливо прочитати файл стану \"%s\"%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
||
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
||
msgstr "Неможливо записати пакунок \"%s\"%sу файл \"%s\".%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
||
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
||
msgstr "Неможливо записати файл стану \"%s\"%sпакунку %s.%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
||
msgid "Uninstall package?"
|
||
msgstr "Видалити пакунок?"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
||
msgid "Uninstall package %s?"
|
||
msgstr "Видалити пакунок%s?"
|
||
|
||
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
||
msgid "Unsaved package"
|
||
msgstr "Не збережений пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgmanguseunit
|
||
msgid "Use unit"
|
||
msgstr "Викор. модуль"
|
||
|
||
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
||
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
||
msgstr "Увага: файл \"%s\"%sналежить поточному проекту."
|
||
|
||
#: lazarusidestrconsts.lispkgmgrkeep
|
||
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
||
msgid "keep"
|
||
msgstr "залишити"
|
||
|
||
#: lazarusidestrconsts.lispkgmgrnew
|
||
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
||
msgid "new"
|
||
msgstr "новий"
|
||
|
||
#: lazarusidestrconsts.lispkgmgrremove
|
||
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
||
msgid "remove"
|
||
msgstr "видалити"
|
||
|
||
#: lazarusidestrconsts.lispkgselectapackage
|
||
msgid "Select a package"
|
||
msgstr "Виберіть пакунок"
|
||
|
||
#: lazarusidestrconsts.lispkgsinstalled
|
||
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
||
msgid "Installed"
|
||
msgstr "Встановлено"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
||
msgid "Cannot register components without unit"
|
||
msgstr "Неможливо зареєструвати компоненти без модуля"
|
||
|
||
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
||
msgid "Component Class \"%s\" already defined"
|
||
msgstr "Клас компонента \"%s\" вже визначено"
|
||
|
||
#: lazarusidestrconsts.lispkgsysfilename
|
||
msgid "%s%sFile Name: \"%s\""
|
||
msgstr "%s%sНазва файлу: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
||
msgid "Invalid component class"
|
||
msgstr "Неправильний клас компонента"
|
||
|
||
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
||
msgid "Invalid Unitname: %s"
|
||
msgstr "Неправильна назва модуля: %s"
|
||
|
||
#: lazarusidestrconsts.lispkgsyslpkfilename
|
||
msgid "%s%slpk file: \"%s\""
|
||
msgstr "%s%slpk файл: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
||
msgid "Package file not found"
|
||
msgstr "Файл пакунка не знайдений"
|
||
|
||
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
||
msgid "Package registration error"
|
||
msgstr "Помилка реєстрації пакунка"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
||
msgid "Register procedure is nil"
|
||
msgstr "Порожня процедура реєстрації"
|
||
|
||
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
||
msgid "RegisterUnit was called, but no package is registering."
|
||
msgstr "Було викликано RegisterUnit, але пакунків не зареєстровано."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
||
msgid "%s%sThe lpk file was not found."
|
||
msgstr "%s%sФайл lpk не знайдено."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
||
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
||
msgstr "Пакунок \"%s\" встановлено, але не знайдено правильного файлу з пакунком (.lpk).%sБуло створено зламаний холостий пакунок."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
||
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
||
msgstr "Це пакунок за замовчуванням. Використовується тільки для компонентів без пакунка. Такі компоненти є застарілими."
|
||
|
||
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
||
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
||
msgstr "Цей пакунок встановлений але lpk-файл не був знайдений. Всі компоненти дезактивовані. Будь-ласка, виправте проблему."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitname
|
||
msgid "%s%sUnit Name: \"%s\""
|
||
msgstr "%s%sНазва модуля: \"%s\""
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
||
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
||
msgstr "Модуль \"%s\" не знайдений у lpk файлі.%sНапевне цей lpk файл не був використаний для збирання цього ІСР. Або пакунок зловживає процедурою RegisterUnit."
|
||
|
||
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
||
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
|
||
msgid "Unit \"%s\" was removed from package (lpk)"
|
||
msgstr "Модуль \"%s\" був видалений з пакунка (lpk)"
|
||
|
||
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
||
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
||
msgstr "Перелічені залежності не потрібні через автоматичне перенесення залежностей між пакунками."
|
||
|
||
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
||
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
||
msgstr "Проект перекриває вихідні теки перелічених пакунків.%sДив. Проект -> Параметри проекту (розділ параметрів компілятора) -> Додатки і перекриття%s%s"
|
||
|
||
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
||
msgid "This file is not in any loaded package."
|
||
msgstr "Цього файлу немає у всіх завантажених пакунках."
|
||
|
||
#: lazarusidestrconsts.lispkgtransitivity
|
||
msgid "Transitivity"
|
||
msgstr "Перенесення"
|
||
|
||
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
||
msgid "Unable to read package file \"%s\".%sError: %s"
|
||
msgstr "Неможливо прочитати файл пакунка \"%s\".%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisplay
|
||
msgid "Play"
|
||
msgstr "Відтворити"
|
||
|
||
#: lazarusidestrconsts.lispldglobal
|
||
msgctxt "lazarusidestrconsts.lispldglobal"
|
||
msgid "Global"
|
||
msgstr "Глобальна"
|
||
|
||
#: lazarusidestrconsts.lispldonline
|
||
msgid "Online"
|
||
msgstr "Мережні"
|
||
|
||
#: lazarusidestrconsts.lispldpackagelinks
|
||
msgid "Package Links"
|
||
msgstr "Зв'язки пакунка"
|
||
|
||
#: lazarusidestrconsts.lispldshowgloballinksin
|
||
msgid "Show global links in "
|
||
msgstr "Показувати глобальні зв'язки у "
|
||
|
||
#: lazarusidestrconsts.lispldshowonlinelinks
|
||
msgid "Show online links"
|
||
msgstr "Показувати мережні посилання"
|
||
|
||
#: lazarusidestrconsts.lispldshowuserlinksin
|
||
msgid "Show user links in "
|
||
msgstr "Показувати користувацькі зв'язки у "
|
||
|
||
#: lazarusidestrconsts.lisplduser
|
||
msgid "User"
|
||
msgstr "Користувацька"
|
||
|
||
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
||
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
||
msgstr "Виправте помилку, показану у вікні повідомленя, яке зазвичай є нижче редактора вихідного коду."
|
||
|
||
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
||
msgid "Please open a unit before run."
|
||
msgstr "Відкрийте модуль перед запуском."
|
||
|
||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||
msgid "Please select some code to extract a new procedure/method."
|
||
msgstr "Виділіть трохи коду, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts.lisplistall
|
||
msgctxt "lazarusidestrconsts.lisplistall"
|
||
msgid "<All>"
|
||
msgstr "<Всі>"
|
||
|
||
#: lazarusidestrconsts.lisplistchangefont
|
||
msgid "Change Font"
|
||
msgstr "Змінити Шрифт"
|
||
|
||
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
||
msgid "Copy method name to the clipboard"
|
||
msgstr "Копіювати назву методу з буферу обміну"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterany
|
||
msgid "Filter by matching any part of method"
|
||
msgstr "Фільтр за збіжністю будь-якої частини метода"
|
||
|
||
#: lazarusidestrconsts.lisplistfilterstart
|
||
msgid "Filter by matching with start of method"
|
||
msgstr "Фільтр за збіжністю початку метода"
|
||
|
||
#: lazarusidestrconsts.lisplistjumptoselection
|
||
msgid "Jump To Selection"
|
||
msgstr "Перейти до Обраного"
|
||
|
||
#: lazarusidestrconsts.lisplistnone
|
||
msgid "<None>"
|
||
msgstr "<нічого>"
|
||
|
||
#: lazarusidestrconsts.lisplistobjects
|
||
msgid "&Objects"
|
||
msgstr "&Об'єкти"
|
||
|
||
#: lazarusidestrconsts.lisplistprocedurelist
|
||
msgid "Procedure List"
|
||
msgstr "Список процедур"
|
||
|
||
#: lazarusidestrconsts.lisplisttype
|
||
msgctxt "lazarusidestrconsts.lisplisttype"
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts.lispochoosepofiledirectory
|
||
msgid "Choose .po file directory"
|
||
msgstr "Виберіть теку з файлом .po"
|
||
|
||
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
||
msgid "Do not save any session info"
|
||
msgstr "Не зберігати ніякої сесії"
|
||
|
||
#: lazarusidestrconsts.lispointer
|
||
msgid "Pointer"
|
||
msgstr "Вказівник"
|
||
|
||
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
||
msgid "Save in .lps file in IDE config directory"
|
||
msgstr "Зберегти у файлі .lps у теці конфігурації ІСР"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpifil
|
||
msgid "Save in .lpi file"
|
||
msgstr "Зберегти в файлі .lpi"
|
||
|
||
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
||
msgid "Save in .lps file in project directory"
|
||
msgstr "Зберегти в файлі .lpi в теці проекту"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationin
|
||
msgid "Save session information in"
|
||
msgstr "Зберегти інформацію про сесію в"
|
||
|
||
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
||
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
||
msgstr ".lpi - головний файл інформації проекту, .lps - окремий файл лише для даних сеансу."
|
||
|
||
#: lazarusidestrconsts.lisposition
|
||
msgid "Position"
|
||
msgstr "Положення"
|
||
|
||
#: lazarusidestrconsts.lispositionoutsideofsource
|
||
msgid "%s (position outside of source)"
|
||
msgstr "%s (положення за межами сирців)"
|
||
|
||
#: lazarusidestrconsts.lisppuinwrongdirectory
|
||
msgid "ppu in wrong directory=%s."
|
||
msgstr "PPU у неправильній теці=%s."
|
||
|
||
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
||
msgid "%s.ppu not found. Check your fpc.cfg."
|
||
msgstr "%s.ppu не знайдено. Перевірте файл fpc.cfg."
|
||
|
||
#: lazarusidestrconsts.lisprecedingword
|
||
msgid "Preceding word"
|
||
msgstr "Попереднє слово"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
||
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
||
msgstr "тека головних налаштувань, де Lazarus зберігає свої файли налаштувань. За замовчуванням"
|
||
|
||
#: lazarusidestrconsts.lisprimaryconfigpath
|
||
msgid "Primary config path"
|
||
msgstr "Основний шлях конфігурації"
|
||
|
||
#: lazarusidestrconsts.lisprior
|
||
msgid "prior %s"
|
||
msgstr "перед %s"
|
||
|
||
#: lazarusidestrconsts.lispriority
|
||
msgctxt "lazarusidestrconsts.lispriority"
|
||
msgid "Priority"
|
||
msgstr "Пріоритет"
|
||
|
||
#: lazarusidestrconsts.lisprivate
|
||
msgid "Private"
|
||
msgstr "Приватний"
|
||
|
||
#: lazarusidestrconsts.lisprivatemethod
|
||
msgid "Private Method"
|
||
msgstr "Приватний метод"
|
||
|
||
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
||
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
||
msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%sПопередження:%sПроект використовує такі пакунки часу розробки, які можуть знадобитись для відкриття форми у дизайнері. Якщо Ви продовжите, ви можете отримати помилки через відсутність компонентів і завантаження форми, найпевніше, призведе до неприємних результатів.%sРекомендується скасувати та спочатку встановити ці пакунки."
|
||
|
||
#: lazarusidestrconsts.lisprocedure
|
||
msgctxt "lazarusidestrconsts.lisprocedure"
|
||
msgid "Procedure"
|
||
msgstr "Процедура"
|
||
|
||
#: lazarusidestrconsts.lisprocedurewithinterface
|
||
msgid "Procedure with interface"
|
||
msgstr "Процедура з інтерфейсом"
|
||
|
||
#: lazarusidestrconsts.lisprogram
|
||
msgctxt "lazarusidestrconsts.lisprogram"
|
||
msgid "Program"
|
||
msgstr "Програма"
|
||
|
||
#: lazarusidestrconsts.lisprogramdetected
|
||
msgid "Program detected"
|
||
msgstr "Виявлена програма"
|
||
|
||
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
||
msgid "A Free Pascal command line program with some useful settings added."
|
||
msgstr "Програма Free Pascal для командного рядка з деякими корисними налаштуваннями."
|
||
|
||
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
||
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
||
msgstr "Текст програми повинен мати розширення Pascal, напр., .pas, .pp або .lpr"
|
||
|
||
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
||
msgid "Add Files to Project"
|
||
msgstr "Додати файли до проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
||
msgid "Dependency already exists"
|
||
msgstr "Залежність вже існує"
|
||
|
||
#: lazarusidestrconsts.lisprojaddeditorfile
|
||
msgid "Add Editor Files"
|
||
msgstr "Додати файли редактора"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||
msgid "Invalid Min-Max version"
|
||
msgstr "Неправильна версія (Min-Max)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
||
msgid "Invalid Pascal unit name"
|
||
msgstr "Неправильна назва модуля Pascal"
|
||
|
||
#: lazarusidestrconsts.lisprojaddinvalidversion
|
||
msgid "Invalid version"
|
||
msgstr "Неправильна версія"
|
||
|
||
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
||
msgid "Maximum Version (optional):"
|
||
msgstr "Максимальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
||
msgid "Minimum Version (optional):"
|
||
msgstr "Мінімальна версія (необов'язково)"
|
||
|
||
#: lazarusidestrconsts.lisprojaddnewrequirement
|
||
msgid "New Requirement"
|
||
msgstr "Нова вимога"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagename
|
||
msgid "Package Name:"
|
||
msgstr "Назва пакунка:"
|
||
|
||
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
||
msgid "Package not found"
|
||
msgstr "Пакунок не знайдений"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
||
msgstr "Залежності \"%s\" не знайдено.%sВиберіть наявний пакунок."
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
||
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr "Максимальна версія \"%s\" некоректна.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
||
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
||
msgid "The Maximum Version is lower than the Minimim Version."
|
||
msgstr "Максимальна версія менше за мінімальну."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
||
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
||
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
||
msgstr "Мінімальна версія \"%s\" є некоректною.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||
msgid "The project has already a dependency for the package \"%s\"."
|
||
msgstr "Проект вже залежить від пакунка \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
||
msgstr "Назва модуля \"%s\" вже існує у проекті%sу файлі: \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
||
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
||
msgstr "Назва модуля \"%s\" вже є у вибраному%sу файлі: \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
||
msgid "The unit name \"%s\" is not a valid Pascal identifier."
|
||
msgstr "Назва модуля \"%s\" не є правильним ідентифікатором Pascal. "
|
||
|
||
#: lazarusidestrconsts.lisprojaddtoproject
|
||
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
||
msgid "Add to Project"
|
||
msgstr "Додати до проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
||
msgid "Unit name already exists"
|
||
msgstr "Назва модуля вже існує"
|
||
|
||
#: lazarusidestrconsts.lisproject
|
||
msgid "Project %s"
|
||
msgstr "Проект %s"
|
||
|
||
#: lazarusidestrconsts.lisproject2
|
||
msgid "Project: "
|
||
msgstr "Проект:"
|
||
|
||
#: lazarusidestrconsts.lisproject3
|
||
msgid "project"
|
||
msgstr "проект"
|
||
|
||
#: lazarusidestrconsts.lisprojectchanged
|
||
msgid "Project changed"
|
||
msgstr "Проект змінено"
|
||
|
||
#: lazarusidestrconsts.lisprojectchangedondisk
|
||
msgid "Project changed on disk"
|
||
msgstr "Проект змінився на диску"
|
||
|
||
#: lazarusidestrconsts.lisprojectcount
|
||
msgid "%d projects"
|
||
msgstr "%d проектів"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectory
|
||
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
||
msgid "Project directory"
|
||
msgstr "Тека проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
||
msgid "Title in taskbar shows also directory path of the project"
|
||
msgstr "Назва на панелі завдань показує також шлях до теки проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectfilename
|
||
msgid "Project filename"
|
||
msgstr "Назва файлу проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectincpath
|
||
msgid "Project Include Path"
|
||
msgstr "Шляхи, що включені до проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectinfofiledetected
|
||
msgid "Project info file detected"
|
||
msgstr "Виявлено info-файл проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectinformation
|
||
msgid "Project information"
|
||
msgstr "Інформація про проект"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnable
|
||
msgid "Project is runnable"
|
||
msgstr "Проект є виконуваним"
|
||
|
||
#: lazarusidestrconsts.lisprojectisrunnablehint
|
||
msgid "Generates a binary executable which can be run."
|
||
msgstr "Створюється двійковий виконуваний файл, який можна запустити."
|
||
|
||
#: lazarusidestrconsts.lisprojectmacro
|
||
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
||
msgid "Project"
|
||
msgstr "Проект"
|
||
|
||
#: lazarusidestrconsts.lisprojectmacroproperties
|
||
msgid "Project macro properties"
|
||
msgstr "Властивості макросів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectoption
|
||
msgid "Project Option"
|
||
msgstr "Параметр проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutdir
|
||
msgid "Project Output directory (e.g. the ppu directory)"
|
||
msgstr "Вихідна тека проекту (напр. тека ppu)"
|
||
|
||
#: lazarusidestrconsts.lisprojectoutputdirectory
|
||
msgid "Project output directory"
|
||
msgstr "Вихідна тека проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectpathhint
|
||
msgid "Directory where project's main file must be"
|
||
msgstr "Тека з основним файлом проекту повинна бути"
|
||
|
||
#: lazarusidestrconsts.lisprojectsession
|
||
msgid "Project Session"
|
||
msgstr "Сеанс проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectsessionchanged
|
||
msgid "Project session changed"
|
||
msgstr "Сеанс проекту змінився"
|
||
|
||
#: lazarusidestrconsts.lisprojectsourcedirectories
|
||
msgid "Project source directories"
|
||
msgstr "Теки кодів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
||
msgid "%0:s%0:s At address %1:x"
|
||
msgstr "%0:s%0:s За адресою %1:x"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
||
msgid "Project %s raised exception class '%s'."
|
||
msgstr "Проект %s зазнав винятку класу '%s'."
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
||
msgid "Project %s raised exception class '%s' with message:%s%s"
|
||
msgstr "Проект %s зазнав винятку класу '%s' з повідомленням:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
||
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
||
msgstr "%0:s%0:s В файлі '%1:s' за адресою %2:x"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
||
msgstr "%0:s%0:s В файлі '%1:s' рядок %2:d"
|
||
|
||
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
||
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
||
msgstr "%0:s%0:s В файлі '%1:s' рядок %2:d:%0:s%3:s"
|
||
|
||
#: lazarusidestrconsts.lisprojectsrcpath
|
||
msgid "Project Src Path"
|
||
msgstr "Шлях до кодів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectunit
|
||
msgid "project unit"
|
||
msgstr "модуль проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectunitpath
|
||
msgid "Project Unit Path"
|
||
msgstr "Шлях до модулів проекту"
|
||
|
||
#: lazarusidestrconsts.lisprojectwizard
|
||
msgid "Project Wizard"
|
||
msgstr "Майстер Проектів"
|
||
|
||
#: lazarusidestrconsts.lisprojfiles
|
||
msgid "Files:"
|
||
msgstr "Файли:"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
||
msgid "Confirm deleting dependency"
|
||
msgstr "Підтвердити видалення залежності"
|
||
|
||
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
||
msgid "Confirm removing file"
|
||
msgstr "Підтвердіть видалення файлу"
|
||
|
||
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
||
msgid "Delete dependency for %s?"
|
||
msgstr "Видалити залежність для %s?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspprojectinspector
|
||
msgid "Project Inspector - %s"
|
||
msgstr "Інспектор проекту - %s"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
||
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
||
msgid "Removed required packages"
|
||
msgstr "Видалені необхідні пакунки"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
||
msgid "Remove file %s from project?"
|
||
msgstr "Видалити файл %s з проекту?"
|
||
|
||
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
||
msgid "Remove %s items from project?"
|
||
msgstr "Вилучити %s елементів з проекту?"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
||
msgid "Unable to read state file %s of project %s%sError: %s"
|
||
msgstr "Неможливо прочитати файл стану %s проекту %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
||
msgid "Unable to write state file for project %s%sError: %s"
|
||
msgstr "Неможливо записати файл стану у проект %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
||
msgid "Always build (even if nothing changed)"
|
||
msgstr "Завжди будувати (навіть якщо нічого не мінялось)"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
||
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
||
msgstr "Може знадобитись, коли є помилка перевірки залежностей; зазвичай не потрібно."
|
||
|
||
#: lazarusidestrconsts.lisprojoptserror
|
||
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
||
msgid "Error"
|
||
msgstr "Помилка"
|
||
|
||
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
||
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
||
msgstr "Неможливо змінити список автостворюваних форм в коді програми.%sВиправте спочатку помилки."
|
||
|
||
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
||
msgid "Project Source Directory Mark"
|
||
msgstr "Мітка теки програмних файлів проекту"
|
||
|
||
#: lazarusidestrconsts.lispromptforvalue
|
||
msgid "Prompt for value"
|
||
msgstr "Довідка за значенням"
|
||
|
||
#: lazarusidestrconsts.lisproperties
|
||
msgid "Properties (replace or remove)"
|
||
msgstr "Властивості (замінити чи видалити)"
|
||
|
||
#: lazarusidestrconsts.lisprotected
|
||
msgid "Protected"
|
||
msgstr "Захищений"
|
||
|
||
#: lazarusidestrconsts.lisprotectedmethod
|
||
msgid "Protected Method"
|
||
msgstr "Захищений метод"
|
||
|
||
#: lazarusidestrconsts.lispublicmethod
|
||
msgid "Public Method"
|
||
msgstr "Спільний метод"
|
||
|
||
#: lazarusidestrconsts.lispublishedmethod
|
||
msgid "Published Method"
|
||
msgstr "Опублікований метод"
|
||
|
||
#: lazarusidestrconsts.lispublishprojdir
|
||
msgid "Publish project directory"
|
||
msgstr "Тека публікації проекту"
|
||
|
||
#: lazarusidestrconsts.lispublishproject
|
||
msgid "Publish Project"
|
||
msgstr "Опублікувати проект"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
||
msgid "Invalid exclude filter"
|
||
msgstr "Неправильний фільтр виключень"
|
||
|
||
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
||
msgid "Invalid include filter"
|
||
msgstr "Неправильний фільтр включень"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
||
msgid "Save .lrs files in the output directory"
|
||
msgstr "Зберігати .lrs файли в кінцеву теку"
|
||
|
||
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
||
msgid "The resource will be available for FPC."
|
||
msgstr "Ресурс буде доступний для FPC."
|
||
|
||
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
||
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
||
msgid "A Pascal unit must have the extension .pp or .pas"
|
||
msgstr "Модуль Pascal повинен мати розширення .pp або .pas"
|
||
|
||
#: lazarusidestrconsts.lispvueditvirtualunit
|
||
msgid "Edit virtual unit"
|
||
msgstr "Редагувати віртуальний модуль"
|
||
|
||
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
||
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
|
||
msgid "There is already an unit with this name.%sFile: %s"
|
||
msgstr "Вже є модуль з такою назвою. %sФайл: %s"
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
|
||
msgid "The unitname is not a valid Pascal identifier."
|
||
msgstr "Назва модуля не є правильним ідентифікатором Pascal. "
|
||
|
||
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
||
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
|
||
msgid "The unitname is used when the IDE extends uses clauses"
|
||
msgstr "Назва модуля використана графічною оболонкою при розширенні користувацьких виразів"
|
||
|
||
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
||
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
|
||
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
||
msgstr "Назва модуля і Назва файлу не збігаються.%sНаприклад: unit1.pas і Unit1"
|
||
|
||
#: lazarusidestrconsts.lispwconvertproject
|
||
msgid "Convert &Delphi Project"
|
||
msgstr "Конвертувати проект &Delphi"
|
||
|
||
#: lazarusidestrconsts.lispwnewproject
|
||
msgid "&New Project"
|
||
msgstr "&Новий проект"
|
||
|
||
#: lazarusidestrconsts.lispwopenproject
|
||
msgid "&Open Project"
|
||
msgstr "Від&крити проект"
|
||
|
||
#: lazarusidestrconsts.lispwopenrecentproject
|
||
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
|
||
msgid "Open &Recent Project"
|
||
msgstr "Відкрити не&давній проект"
|
||
|
||
#: lazarusidestrconsts.lispwviewexampleprojects
|
||
msgid "View &Example Projects"
|
||
msgstr "Переглянути &приклади проектів"
|
||
|
||
#: lazarusidestrconsts.lisquickfixerror
|
||
msgid "QuickFix error"
|
||
msgstr "Помилка QuickFix"
|
||
|
||
#: lazarusidestrconsts.lisquickfixes
|
||
msgid "Quick fixes"
|
||
msgstr "Швидкі виправлення"
|
||
|
||
#: lazarusidestrconsts.lisquickfixremoveunit
|
||
msgid "Quick fix: Remove unit"
|
||
msgstr "Шв. випр: Видалити модуль"
|
||
|
||
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
||
msgid "Search identifier"
|
||
msgstr "Шукати ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisquit
|
||
msgctxt "lazarusidestrconsts.lisquit"
|
||
msgid "Quit"
|
||
msgstr "Вийти"
|
||
|
||
#: lazarusidestrconsts.lisquitlazarus
|
||
msgid "&Quit Lazarus"
|
||
msgstr "&Вийти з Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisrange
|
||
msgctxt "lazarusidestrconsts.lisrange"
|
||
msgid "Range"
|
||
msgstr "Діапазон"
|
||
|
||
#: lazarusidestrconsts.lisreaderror
|
||
msgid "Read Error"
|
||
msgstr "Помилка читання"
|
||
|
||
#: lazarusidestrconsts.lisreallydelete
|
||
msgid "Really delete?"
|
||
msgstr "Справді видалити?"
|
||
|
||
#: lazarusidestrconsts.lisrecenttabs
|
||
msgid "Recent tabs"
|
||
msgstr "Недавні вкладки"
|
||
|
||
#: lazarusidestrconsts.lisrecord
|
||
msgctxt "lazarusidestrconsts.lisrecord"
|
||
msgid "Record"
|
||
msgstr "Запис"
|
||
|
||
#: lazarusidestrconsts.lisrecordedmacros
|
||
msgid "Recorded"
|
||
msgstr "Записано"
|
||
|
||
#: lazarusidestrconsts.lisrecordstruct
|
||
msgid "Record/Structure"
|
||
msgstr "Запис/Структура"
|
||
|
||
#: lazarusidestrconsts.lisredo
|
||
msgctxt "lazarusidestrconsts.lisredo"
|
||
msgid "Redo"
|
||
msgstr "Повернути"
|
||
|
||
#: lazarusidestrconsts.lisregisters
|
||
msgctxt "lazarusidestrconsts.lisregisters"
|
||
msgid "Registers"
|
||
msgstr "Регістри"
|
||
|
||
#: lazarusidestrconsts.lisregularexpression
|
||
msgid "Regular expression"
|
||
msgstr "Регулярний вираз"
|
||
|
||
#: lazarusidestrconsts.lisrelative
|
||
msgid "Relative"
|
||
msgstr "Відносно"
|
||
|
||
#: lazarusidestrconsts.lisrelativepaths
|
||
msgid "Relative paths"
|
||
msgstr "Відносні шляхи"
|
||
|
||
#: lazarusidestrconsts.lisremove
|
||
msgctxt "lazarusidestrconsts.lisremove"
|
||
msgid "Remove"
|
||
msgstr "Видалити"
|
||
|
||
#: lazarusidestrconsts.lisremove2
|
||
msgid "Remove?"
|
||
msgstr "Вилучити?"
|
||
|
||
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
||
msgid "Remove all invalid properties"
|
||
msgstr "Видалити всі некоректні властивості"
|
||
|
||
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
||
msgid "Remove all message type filters"
|
||
msgstr "Вилучити всі фільтри повідомлень за типами"
|
||
|
||
#: lazarusidestrconsts.lisremoveallunits
|
||
msgid "Remove all units"
|
||
msgstr "Видалити всі модулі"
|
||
|
||
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
||
msgid "Remove Compiler Option Hide Message"
|
||
msgstr "Не приховувати повідомлення параметром компілятора"
|
||
|
||
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
||
msgid "Remove %s dependencies from package \"%s\"?"
|
||
msgstr "Вилучити %s залежностей з пакунка \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisremovedpropertys
|
||
msgid "Removed property \"%s\"."
|
||
msgstr "Вилучено властивість \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisremovefilesfrompackage
|
||
msgid "Remove %s files from package \"%s\"?"
|
||
msgstr "Вилучити %s файлів з пакунка \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lisremovefrominstalllist
|
||
msgid "Remove from install list"
|
||
msgstr "Видалити з списку встановлення"
|
||
|
||
#: lazarusidestrconsts.lisremovefromproject
|
||
msgid "Remove from Project"
|
||
msgstr "Видалити з проекту"
|
||
|
||
#: lazarusidestrconsts.lisremovefromsearchpath
|
||
msgid "Remove from search path"
|
||
msgstr "Видалити з пошукового шляху"
|
||
|
||
#: lazarusidestrconsts.lisremoveincludepath
|
||
msgid "Remove include path?"
|
||
msgstr "Видалити включений шлях?"
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable
|
||
msgid "Remove local variable %s"
|
||
msgstr "Видалити локальну змінну %s"
|
||
|
||
#: lazarusidestrconsts.lisremovelocalvariable3
|
||
msgid "Remove local variable \"%s\""
|
||
msgstr "Вилучити локальну змінну \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisremovemessagetypefilter
|
||
msgid "Remove Message Type Filter"
|
||
msgstr "Вилучити фільтр типів повідомлень"
|
||
|
||
#: lazarusidestrconsts.lisremovenonexistingfiles
|
||
msgid "Remove nonexistent files"
|
||
msgstr "Вилучити неіснуючі файли"
|
||
|
||
#: lazarusidestrconsts.lisremoveselectedunits
|
||
msgid "Remove selected units"
|
||
msgstr "Видалити вибрані модулі"
|
||
|
||
#: lazarusidestrconsts.lisremovethem
|
||
msgid "Remove them"
|
||
msgstr "Видалити їх"
|
||
|
||
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
||
msgid "Remove the paths from \"Other sources\""
|
||
msgstr "Видалити шляхи з \"Інші джерела\""
|
||
|
||
#: lazarusidestrconsts.lisremoveunitpath
|
||
msgid "Remove unit path?"
|
||
msgstr "Видалити шлях до модуля?"
|
||
|
||
#: lazarusidestrconsts.lisremoveuses
|
||
msgid "Remove uses \"%s\""
|
||
msgstr "Вилучити \"%s\" з Uses"
|
||
|
||
#: lazarusidestrconsts.lisrename
|
||
msgctxt "lazarusidestrconsts.lisrename"
|
||
msgid "Rename"
|
||
msgstr "Перейменувати"
|
||
|
||
#: lazarusidestrconsts.lisrename2
|
||
msgid "Rename ..."
|
||
msgstr "Перейменувати ..."
|
||
|
||
#: lazarusidestrconsts.lisrenamefile
|
||
msgid "Rename file?"
|
||
msgstr "Перейменувати файл?"
|
||
|
||
#: lazarusidestrconsts.lisrenamefilefailed
|
||
msgid "Rename file failed"
|
||
msgstr "Не вдалося змінити назву файла"
|
||
|
||
#: lazarusidestrconsts.lisrenameshowresult
|
||
msgid "Show list of renamed Identifiers"
|
||
msgstr "Показати список перейменованих ідентифікаторів"
|
||
|
||
#: lazarusidestrconsts.lisrenameto
|
||
msgid "Rename to %s"
|
||
msgstr "Перейменувати на %s"
|
||
|
||
#: lazarusidestrconsts.lisrenametolowercase
|
||
msgid "Rename to lowercase"
|
||
msgstr "Превести в нижній регістр"
|
||
|
||
#: lazarusidestrconsts.lisreopenproject
|
||
msgid "Reopen project"
|
||
msgstr "Перевідкрити проект"
|
||
|
||
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
||
msgid "Reopen with another encoding"
|
||
msgstr "Перевідкрити з іншим кодуванням"
|
||
|
||
#: lazarusidestrconsts.lisrepeat
|
||
msgctxt "lazarusidestrconsts.lisrepeat"
|
||
msgid "Repeat"
|
||
msgstr "Repeat"
|
||
|
||
#: lazarusidestrconsts.lisrepeatcount
|
||
msgid "Repeat Count:"
|
||
msgstr "Повторень:"
|
||
|
||
#: lazarusidestrconsts.lisreplace
|
||
msgctxt "lazarusidestrconsts.lisreplace"
|
||
msgid "Replace"
|
||
msgstr "Заміна"
|
||
|
||
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
||
msgid "Replaced property \"%s\" with \"%s\"."
|
||
msgstr "Властивість \"%s\" замінено на \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisreplacedtypeswiths
|
||
msgid "Replaced type \"%s\" with \"%s\"."
|
||
msgstr "Тип \"%s\" замінено на \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisreplacement
|
||
msgid "Replacement"
|
||
msgstr "Заміна"
|
||
|
||
#: lazarusidestrconsts.lisreplacementfuncs
|
||
msgid "Replacement functions"
|
||
msgstr "Функції заміни"
|
||
|
||
#: lazarusidestrconsts.lisreplacements
|
||
msgid "Replacements"
|
||
msgstr "Заміни"
|
||
|
||
#: lazarusidestrconsts.lisreplaceremoveunknown
|
||
msgid "Fix unknown properties and types"
|
||
msgstr "Виправити невідомі властивості і типи"
|
||
|
||
#: lazarusidestrconsts.lisreplacewholeidentifier
|
||
msgid "Replace whole identifier"
|
||
msgstr "Замінити весь ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisreplacingselectionfailed
|
||
msgid "Replacing selection failed."
|
||
msgstr "Помилка заміни"
|
||
|
||
#: lazarusidestrconsts.lisreportingbugurl
|
||
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
||
|
||
#: lazarusidestrconsts.lisrescan
|
||
msgid "Rescan"
|
||
msgstr "Пересканувати"
|
||
|
||
#: lazarusidestrconsts.lisreset
|
||
msgid "Reset"
|
||
msgstr "Скинути"
|
||
|
||
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
||
msgid "Reset all file filters to defaults?"
|
||
msgstr "Скинути всі фільтри до типових?"
|
||
|
||
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
||
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
||
msgstr "Скинути властивості Left, Top, Width, Height вибраних компонентів до успадкованих значень?"
|
||
|
||
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
||
msgid "Resource name must be unique."
|
||
msgstr "Назва ресурсу має бути унікальною."
|
||
|
||
#: lazarusidestrconsts.lisresourcesaveerror
|
||
msgid "Resource save error"
|
||
msgstr "Помилка збереження ресурсу"
|
||
|
||
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
||
msgid "Resource type of project"
|
||
msgstr "Тип ресурсів проекту"
|
||
|
||
#: lazarusidestrconsts.lisrestart
|
||
msgctxt "lazarusidestrconsts.lisrestart"
|
||
msgid "Restart"
|
||
msgstr "Перезапуск"
|
||
|
||
#: lazarusidestrconsts.lisresult2
|
||
msgid "Result:"
|
||
msgstr "Результат:"
|
||
|
||
#: lazarusidestrconsts.lisreturnparameterindexedword
|
||
msgid ""
|
||
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
||
"\n"
|
||
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
||
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
||
"is always the current macro.\n"
|
||
"\n"
|
||
"Example line:\n"
|
||
"i 0 count-1 forb|\n"
|
||
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
||
"\n"
|
||
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
|
||
msgstr ""
|
||
"Повернути слово, індексоване параметром, з частини поточного рядка перед курсором.\n"
|
||
"\n"
|
||
"Слова в рядку нумеруються 1,2,3,... зліва направо, але останнє слово,\n"
|
||
"яке завжди є розкриваним макросом, має номер 0, тому $PrevWord(0)\n"
|
||
"завжди містить поточний макрос.\n"
|
||
"\n"
|
||
"Приклад:\n"
|
||
"i 0 count-1 forb|\n"
|
||
"Тут $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
||
"\n"
|
||
"В кінці шаблона використайте $PrevWord(-1), який розкривається порожнім рядком, але при цьому виконує важливу операцію очищення всіх знайдених $PrevWord. Для довідки наведемо регулярний вираз, що використовується для виявлення слів для цього макросу: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
|
||
|
||
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
||
msgid ""
|
||
"Return the list of all values of case variable in front of variable.\n"
|
||
"\n"
|
||
"Optional Parameters (comma separated):\n"
|
||
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
|
||
msgstr ""
|
||
"Повертає список всіх значень змінної case перед змінною.\n"
|
||
"\n"
|
||
"Необов'язкові параметри (відокремлюють комою):\n"
|
||
"WithoutExtraIndent // список case буде створено без додаткових відступів\n"
|
||
|
||
#: lazarusidestrconsts.lisrevertfailed
|
||
msgid "Revert failed"
|
||
msgstr "Обертання не вдалося"
|
||
|
||
#: lazarusidestrconsts.lisright
|
||
msgctxt "lazarusidestrconsts.lisright"
|
||
msgid "Right"
|
||
msgstr "Справа"
|
||
|
||
#: lazarusidestrconsts.lisrightanchoring
|
||
msgid "Right anchoring"
|
||
msgstr "Праве якорювання"
|
||
|
||
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
||
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
||
msgstr "Правий бордюр. Значення додається до базового бордюру і використовується для відступу справа від елемента керування."
|
||
|
||
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr "Це елемент керування одного рівня, за яким зафіксовано правий край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
|
||
|
||
#: lazarusidestrconsts.lisrightsides
|
||
msgid "Right sides"
|
||
msgstr "Праві краї"
|
||
|
||
#: lazarusidestrconsts.lisrightspaceequally
|
||
msgid "Right space equally"
|
||
msgstr "За правим краєм"
|
||
|
||
#: lazarusidestrconsts.lisroot
|
||
msgid "Root"
|
||
msgstr "Корінь"
|
||
|
||
#: lazarusidestrconsts.lisrootdirectory
|
||
msgid "Root Directory"
|
||
msgstr "Коренева тека"
|
||
|
||
#: lazarusidestrconsts.lisrun
|
||
msgctxt "lazarusidestrconsts.lisrun"
|
||
msgid "Run"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
||
msgid "\"Run and Design time\" packages have no limitations."
|
||
msgstr "Пакунки часу розробки і виконання не мають обмежень."
|
||
|
||
#: lazarusidestrconsts.lisrunbuttonhint
|
||
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
||
msgid "Run"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts.lisrunning
|
||
msgid "%s (running ...)"
|
||
msgstr "%s (виконується ...)"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
||
msgid "File not executable"
|
||
msgstr "Файл не є виконуваним"
|
||
|
||
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
||
msgid "The host application \"%s\" is not executable."
|
||
msgstr "Головний застосунок \"%s\" не є виконуваним файлом."
|
||
|
||
#: lazarusidestrconsts.lisrunstage
|
||
msgctxt "lazarusidestrconsts.lisrunstage"
|
||
msgid "Run"
|
||
msgstr "Виконати"
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
||
msgid "Runtime only, cannot be installed in IDE"
|
||
msgstr "Для часу виконання, не можна встановити в ІСР"
|
||
|
||
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
||
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
||
msgstr "Пакунки лише часу виконання призначені виключно для проектів. Їх не можна встановити в ІСР, навіть опосередковано."
|
||
|
||
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
||
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
||
msgstr "Пакунки часу виконання можуть використовуватися проектами. Їх не можна встановити в ІСР, якщо вони не потрібні певним пакункам часу розробки."
|
||
|
||
#: lazarusidestrconsts.lisruntofailed
|
||
msgid "Run-to failed"
|
||
msgstr "Виконати-до не вдався"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
||
msgid "Abstract Methods - not yet overridden"
|
||
msgstr "Абстрактні Методи - ще не перекриті"
|
||
|
||
#: lazarusidestrconsts.lissamabstractmethodsof
|
||
msgid "Abstract methods of %s"
|
||
msgstr "Абстрактні методи %s"
|
||
|
||
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
||
msgid "Cursor is not in a class declaration"
|
||
msgstr "Курсор не в оголошенні класу"
|
||
|
||
#: lazarusidestrconsts.lissamideisbusy
|
||
msgid "IDE is busy"
|
||
msgstr "ІСР зайняте"
|
||
|
||
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
||
msgid "%s is an abstract class, it has %s abstract methods."
|
||
msgstr "%s є абстрактним класом, він має %s абстрактних методів."
|
||
|
||
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
||
msgid "No abstract methods found"
|
||
msgstr "Не знайдено абстрактних методів"
|
||
|
||
#: lazarusidestrconsts.lissamoverrideallselected
|
||
msgid "Override all selected"
|
||
msgstr "Перевизначити всі вибрані"
|
||
|
||
#: lazarusidestrconsts.lissamoverridefirstselected
|
||
msgid "Override first selected"
|
||
msgstr "Перевизначити перший вибраний"
|
||
|
||
#: lazarusidestrconsts.lissamselectnone
|
||
msgid "Select none"
|
||
msgstr "Не вибирати нічого"
|
||
|
||
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
||
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
||
msgstr "Можна перевизначити %s абстактних методів.%sВиберіть методи для яких треба створити пробки:"
|
||
|
||
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
||
msgid "There are no abstract methods left to override."
|
||
msgstr "Не лишилось абстрактних методів для перевизначення."
|
||
|
||
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
||
msgid "This method can not be overridden because it is defined in the current class"
|
||
msgstr "Цей метод не можна перевизначити бо він визначений в поточному класі"
|
||
|
||
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
||
msgid "Unable to show abstract methods of the current class, because"
|
||
msgstr "Неможливо показати абстрактні методи поточного класу, бо"
|
||
|
||
#: lazarusidestrconsts.lissave
|
||
msgctxt "lazarusidestrconsts.lissave"
|
||
msgid "Save"
|
||
msgstr "Зберегти"
|
||
|
||
#: lazarusidestrconsts.lissaveall
|
||
msgctxt "lazarusidestrconsts.lissaveall"
|
||
msgid "Save All"
|
||
msgstr "Зберегти всі"
|
||
|
||
#: lazarusidestrconsts.lissaveallchecked
|
||
msgid "Save All Checked"
|
||
msgstr "Зберегти всі відзначені"
|
||
|
||
#: lazarusidestrconsts.lissaveallmodified
|
||
msgid "Save all modified files"
|
||
msgstr "Зберегти всі змінені файли"
|
||
|
||
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
||
msgid "Save All/Original Messages to File ..."
|
||
msgstr "Зберегти всі/початкові повідомлення у файл ..."
|
||
|
||
#: lazarusidestrconsts.lissaveandexitdialog
|
||
msgid "Save and exit dialog"
|
||
msgstr "Зберегти і вийти з діалогу"
|
||
|
||
#: lazarusidestrconsts.lissaveandrebuildide
|
||
msgid "Save and rebuild IDE"
|
||
msgstr "Зберегти і перебудувати ІСР"
|
||
|
||
#: lazarusidestrconsts.lissaveas
|
||
msgctxt "lazarusidestrconsts.lissaveas"
|
||
msgid "Save As"
|
||
msgstr "Зберегти як"
|
||
|
||
#: lazarusidestrconsts.lissavechangedfiles
|
||
msgid "Save changed files?"
|
||
msgstr "Зберегти змінені файли?"
|
||
|
||
#: lazarusidestrconsts.lissavechanges
|
||
msgid "Save changes?"
|
||
msgstr "Зберегти зміни?"
|
||
|
||
#: lazarusidestrconsts.lissavechangestoproject
|
||
msgid "Save changes to project %s?"
|
||
msgstr "Зберегти зміни в проект %s?"
|
||
|
||
#: lazarusidestrconsts.lissavecurrenteditorfile
|
||
msgid "Save current editor file"
|
||
msgstr "Зберегти поточний файл редактора"
|
||
|
||
#: lazarusidestrconsts.lissavedwithidesettings
|
||
msgid "Saved with IDE settings"
|
||
msgstr "Збережено з параметрами ІСР"
|
||
|
||
#: lazarusidestrconsts.lissavedwithprojectsession
|
||
msgid "Saved with project session"
|
||
msgstr "Збережено з сеансом проекту"
|
||
|
||
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
||
msgid "Save editor info of non project files"
|
||
msgstr "Зберегти інформацію редактора про файли, що не відносяться до проекту"
|
||
|
||
#: lazarusidestrconsts.lissavefileas
|
||
msgid "Save file as"
|
||
msgstr "Зберегти файл як"
|
||
|
||
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
||
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
||
msgstr "Зберегти файл \"%s\"%sперед закриттям форми \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
||
msgid "Save info of closed editor files"
|
||
msgstr "Зберегти інформацію про закриті редактором файли"
|
||
|
||
#: lazarusidestrconsts.lissavemacroas
|
||
msgid "Save macro as"
|
||
msgstr "Зберегти макрос як"
|
||
|
||
#: lazarusidestrconsts.lissavemessages
|
||
msgid "Save messages"
|
||
msgstr "Зберегти повідомлення"
|
||
|
||
#: lazarusidestrconsts.lissaveproject
|
||
msgid "Save project %s (*%s)"
|
||
msgstr "Зберегти проект %s (*%s)"
|
||
|
||
#: lazarusidestrconsts.lissavesessionchangestoproject
|
||
msgid "Save session changes to project %s?"
|
||
msgstr "Зберегти зміни сеансу до проекту %s?"
|
||
|
||
#: lazarusidestrconsts.lissavesessionfoldstate
|
||
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
|
||
msgid "Save fold info"
|
||
msgstr "Зберегти згорток до"
|
||
|
||
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
||
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
||
msgstr "Редактор коду підтримує згортання (тимчасове приховування) блоків коду."
|
||
|
||
#: lazarusidestrconsts.lissavesessionjumphistory
|
||
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
|
||
msgid "Save jump history"
|
||
msgstr "Зберегти історію переходів"
|
||
|
||
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
||
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
||
msgstr "Клацання з Ctrl на ідентифікаторі у Редакторі коду зберігається в історії переходів."
|
||
|
||
#: lazarusidestrconsts.lissavesettings
|
||
msgid "Save Settings"
|
||
msgstr "Зберегти налаштування"
|
||
|
||
#: lazarusidestrconsts.lissaveshownmessagestofile
|
||
msgid "Save Shown Messages to File ..."
|
||
msgstr "Записати показані повідомлення до файлу ..."
|
||
|
||
#: lazarusidestrconsts.lissavespace
|
||
msgid "Save "
|
||
msgstr "Зберегти "
|
||
|
||
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
||
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
||
msgstr "Збереження файлу \"%s\" у \"%s\" призведе до втрати символів (рядок %s, стовпець %s)."
|
||
|
||
#: lazarusidestrconsts.lisscalingfactor
|
||
msgid "Scaling factor:"
|
||
msgstr "Масштабний фактор:"
|
||
|
||
#: lazarusidestrconsts.lisscanfilesinparentdir
|
||
msgid "Scan files in parent directory"
|
||
msgstr "Шукати файли у батьківській теці"
|
||
|
||
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
||
msgid "Search for source files in sibling directories (parent directory and its children)"
|
||
msgstr "Шукати сирцеві файли у сусідніх теках (батьківській і її підтеках)"
|
||
|
||
#: lazarusidestrconsts.lisscanning
|
||
msgid "Scanning"
|
||
msgstr "Триває пошук"
|
||
|
||
#: lazarusidestrconsts.lisscanning2
|
||
msgid "%s. Scanning ..."
|
||
msgstr "%s. Пошук ..."
|
||
|
||
#: lazarusidestrconsts.lisscanparentdir
|
||
msgid "Scanning parent directory"
|
||
msgstr "Перегляд батьківської теки"
|
||
|
||
#: lazarusidestrconsts.lissearchpaths2
|
||
msgid "Search paths"
|
||
msgstr "Шляхи пошуку"
|
||
|
||
#: lazarusidestrconsts.lissearchunit
|
||
msgid "Search Unit \"%s\""
|
||
msgstr "Знайти модуль \"%s\""
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
||
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
||
msgstr "вторинна тека налаштувань, де Lazarus шукає свої шаблони налаштувань. За замовчуванням "
|
||
|
||
#: lazarusidestrconsts.lissecondaryconfigpath
|
||
msgid "Secondary config path"
|
||
msgstr "Вторинний шлях конфігурації"
|
||
|
||
#: lazarusidestrconsts.lissecondtest
|
||
msgid "&Second test"
|
||
msgstr "&Друга перевірка"
|
||
|
||
#: lazarusidestrconsts.lisseemessages
|
||
msgid "See messages."
|
||
msgstr "Дивись повідомлення."
|
||
|
||
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
||
msgid "%sSee Project -> Project Inspector"
|
||
msgstr "%sДив.. Проект -> Інспектор проекту"
|
||
|
||
#: lazarusidestrconsts.lisselectahelpitem
|
||
msgid "Select a help item:"
|
||
msgstr "Шукати елемент довідки:"
|
||
|
||
#: lazarusidestrconsts.lisselectanode
|
||
msgid "Select a node"
|
||
msgstr "Виберіть вузол"
|
||
|
||
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
||
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
||
msgstr "Виберіть іншу бібліотеку віджетів LCL (макрос LCLWidgetType)"
|
||
|
||
#: lazarusidestrconsts.lisselectdfmfiles
|
||
msgid "Select Delphi form files (*.dfm)"
|
||
msgstr "Виберіть файли форм Delphi (*.dfm)"
|
||
|
||
#: lazarusidestrconsts.lisselected
|
||
msgctxt "lazarusidestrconsts.lisselected"
|
||
msgid "Selected"
|
||
msgstr "Вибраний"
|
||
|
||
#: lazarusidestrconsts.lisselectedaddition
|
||
msgid "Selected addition:"
|
||
msgstr "Вибраний додаток:"
|
||
|
||
#: lazarusidestrconsts.lisselectedandchildcontrols
|
||
msgid "Selected and child controls"
|
||
msgstr "Вибрані і дочірні елементи керування"
|
||
|
||
#: lazarusidestrconsts.lisselectedbottomneighbour
|
||
msgid "(selected bottom neighbour)"
|
||
msgstr "(вибраний нижній сусід)"
|
||
|
||
#: lazarusidestrconsts.lisselectedcommandsmapping
|
||
msgid "Selected Command's Mapping"
|
||
msgstr "Картографія вибраної команди"
|
||
|
||
#: lazarusidestrconsts.lisselectedforinstallation
|
||
msgid "selected for installation"
|
||
msgstr "вибрано для встановлення"
|
||
|
||
#: lazarusidestrconsts.lisselectedforuninstallation
|
||
msgid "selected for uninstallation"
|
||
msgstr "вибрано для вилучення"
|
||
|
||
#: lazarusidestrconsts.lisselectedleftneighbour
|
||
msgid "(selected left neighbour)"
|
||
msgstr "(вибраний лівий сусід)"
|
||
|
||
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
||
msgid "Selected message in messages window:"
|
||
msgstr "Повідомлення, вибране у вікні повідомлень:"
|
||
|
||
#: lazarusidestrconsts.lisselectedmodeswerebuilt
|
||
msgid "Selected %d modes were successfully built."
|
||
msgstr "Збирання у вибраних режимах (%d шт.) успішно завершено."
|
||
|
||
#: lazarusidestrconsts.lisselectedrightneighbour
|
||
msgid "(selected right neighbour)"
|
||
msgstr "(вибраний правий сусід)"
|
||
|
||
#: lazarusidestrconsts.lisselectedtopneighbour
|
||
msgid "(selected top neighbour)"
|
||
msgstr "(вибраний верхній сусід)"
|
||
|
||
#: lazarusidestrconsts.lisselectfile
|
||
msgid "Select the file"
|
||
msgstr "Вибрати файл"
|
||
|
||
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
||
msgid "Select FPC source directory"
|
||
msgstr "Вибрати теку початкових кодів FPC"
|
||
|
||
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
||
msgid "Selection exceeds string constant"
|
||
msgstr "Вибір перевищує рядкову константу"
|
||
|
||
#: lazarusidestrconsts.lisselectiontool
|
||
msgid "Selection tool"
|
||
msgstr "Інструмент вибору"
|
||
|
||
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
||
msgid "Select Lazarus source directory"
|
||
msgstr "Вибрати теку початкових кодів Lazarus"
|
||
|
||
#: lazarusidestrconsts.lisselectpathto
|
||
msgid "Select path to %s"
|
||
msgstr "Виберіть шлях до %s"
|
||
|
||
#: lazarusidestrconsts.lisselecttargetdirectory
|
||
msgid "Select target directory"
|
||
msgstr "Виберіть цільову теку"
|
||
|
||
#: lazarusidestrconsts.lissetallcolors
|
||
msgid "Set all colors:"
|
||
msgstr "Задати всі кольори:"
|
||
|
||
#: lazarusidestrconsts.lissetdefault
|
||
msgid "Set default"
|
||
msgstr "Встановити за замовчуванням"
|
||
|
||
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
||
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
||
msgstr "Задайте для перекладу повідомлень компілятора іншою мовою (наприклад, не англійською). Наприклад: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
||
|
||
#: lazarusidestrconsts.lissetupdefaultindentation
|
||
msgid "(Set up default indentation)"
|
||
msgstr "(Встановити типові відступи)"
|
||
|
||
#: lazarusidestrconsts.lisshort
|
||
msgid "Short:"
|
||
msgstr "Коротко:"
|
||
|
||
#: lazarusidestrconsts.lisshortnopath
|
||
msgid "Short, no path"
|
||
msgstr "Коротке, без шляху"
|
||
|
||
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
||
msgid "Should the component \"%s\" be auto created when the application starts?"
|
||
msgstr "Чи повинен компонент \"%s\" автоматично створюватись при запуску застосунку?"
|
||
|
||
#: lazarusidestrconsts.lisshow
|
||
msgid "Show"
|
||
msgstr "Показати"
|
||
|
||
#: lazarusidestrconsts.lisshowabstractmethodsof
|
||
msgid "Show abstract methods of \"%s\""
|
||
msgstr "Показати абстрактні методи \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
||
msgid "Show component tree"
|
||
msgstr "Показати дерево компонентів"
|
||
|
||
#: lazarusidestrconsts.lisshowconsole
|
||
msgid "Show console"
|
||
msgstr "Показати консоль"
|
||
|
||
#: lazarusidestrconsts.lisshowdeclarationhints
|
||
msgid "Show declaration hints"
|
||
msgstr "Виводити підказки оголошень"
|
||
|
||
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
||
msgid "Show differences between modes ..."
|
||
msgstr "Показати відмінності між режимами ..."
|
||
|
||
#: lazarusidestrconsts.lisshowemptyunitspackages
|
||
msgid "Show empty units/packages"
|
||
msgstr "Показати порожні модулі/пакунки"
|
||
|
||
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
||
msgid "Show FPC message \"lines compiled\""
|
||
msgstr "Показувати повідомлення FPC \"рядків скомпільовано\""
|
||
|
||
#: lazarusidestrconsts.lisshowglyphsfor
|
||
msgid "Show Glyphs for"
|
||
msgstr "Показувати значки для"
|
||
|
||
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
||
msgid "Show gutter"
|
||
msgstr "Показувати смужку"
|
||
|
||
#: lazarusidestrconsts.lisshowhelp
|
||
msgid "Show help"
|
||
msgstr "Показати довідку"
|
||
|
||
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
||
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
||
msgid "Show hints"
|
||
msgstr "Показувати довідки в Інспекторі об'єкту"
|
||
|
||
#: lazarusidestrconsts.lisshowidentifiers
|
||
msgid "Show identifiers"
|
||
msgstr "Показувати змінні"
|
||
|
||
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
||
msgid "Show information box"
|
||
msgstr "Показувати панель інформації"
|
||
|
||
#: lazarusidestrconsts.lisshowmessagetypeid
|
||
msgid "Show Message Type ID"
|
||
msgstr "Виводити ідентифікатор типу повідомлення"
|
||
|
||
#: lazarusidestrconsts.lisshowonlymodified
|
||
msgid "Show only modified"
|
||
msgstr "Показати лише змінене"
|
||
|
||
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
||
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
||
msgstr "Показувати лише одну кнопку на панелі завдань для всього ІСР замість однієї на кожне вікно. Деякі віконні менеджери (наприклад, Cinnamon) не підтримують дану можливість і завжди показують по одній кнопці на вікно."
|
||
|
||
#: lazarusidestrconsts.lisshowoverviewgutter
|
||
msgid "Show overview Gutter"
|
||
msgstr "Показати смужку огляду"
|
||
|
||
#: lazarusidestrconsts.lisshowpackages
|
||
msgid "Show packages"
|
||
msgstr "Показувати пакунки"
|
||
|
||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||
msgid "Show position of source editor"
|
||
msgstr "Показати позицію редактора коду"
|
||
|
||
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
||
msgid "Show recently used identifiers at top"
|
||
msgstr "Показувати часто вживані ідентифікатори вгорі"
|
||
|
||
#: lazarusidestrconsts.lisshowrelativepaths
|
||
msgid "Show relative paths"
|
||
msgstr "Показувати відносні шляхи"
|
||
|
||
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
||
msgid "Shows all controls in tree hierarchy."
|
||
msgstr "Показати всі елементи керування у деревовидній ієрархії."
|
||
|
||
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
||
msgid "A box at the bottom shows description for the selected property."
|
||
msgstr "Поле внизу показує опис вибраної властивості."
|
||
|
||
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
||
msgid "Show setup dialog for most important settings"
|
||
msgstr "Показати діалог налаштування найбільш важливих параметрів"
|
||
|
||
#: lazarusidestrconsts.lisshowspecialcharacters
|
||
msgid "Show special characters"
|
||
msgstr "Показувати спеціальні символи"
|
||
|
||
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
||
msgid "Show statusbar"
|
||
msgstr "Показувати рядок стану"
|
||
|
||
#: lazarusidestrconsts.lisshowunits
|
||
msgid "Show units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.lisshowunitswithinitialization
|
||
msgid "Show units with initialization/finalization sections"
|
||
msgstr "Показувати модулі з розділами ініціалізації/фіналізації"
|
||
|
||
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
||
msgid "These units may initialize global data used by the program/application. Remove with care."
|
||
msgstr "Ці модулі можуть ініціалізувати глобальні дані, що використовуються програмою/застосунком. Вилучайте обережно."
|
||
|
||
#: lazarusidestrconsts.lisshowunusedunits
|
||
msgid "Show unused units ..."
|
||
msgstr "Показати не використані модулі ..."
|
||
|
||
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
||
msgid "Show value hints while debugging"
|
||
msgstr "Виводити підказки зі значеннями під час зневадження"
|
||
|
||
#: lazarusidestrconsts.lisshowversionandexit
|
||
msgid "show version and exit"
|
||
msgstr "показати версію і вийти"
|
||
|
||
#: lazarusidestrconsts.lisshrinktosmal
|
||
msgid "Shrink to smallest"
|
||
msgstr "Зменшити до найменшого"
|
||
|
||
#: lazarusidestrconsts.lissibling
|
||
msgid "Sibling"
|
||
msgstr "Рівень"
|
||
|
||
#: lazarusidestrconsts.lissimpleprogram
|
||
msgid "Simple Program"
|
||
msgstr "Проста програма"
|
||
|
||
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
||
msgid "A most simple Free Pascal command line program."
|
||
msgstr "Найпростіша програма Free Pascal для командного рядка."
|
||
|
||
#: lazarusidestrconsts.lissimplesyntax
|
||
msgid "Simple syntax"
|
||
msgstr "Простий синтаксис"
|
||
|
||
#: lazarusidestrconsts.lisskiperrors
|
||
msgid "Skip errors"
|
||
msgstr "Пропустити помилки"
|
||
|
||
#: lazarusidestrconsts.lisskipfile
|
||
msgid "Skip file"
|
||
msgstr "Пропустити файл"
|
||
|
||
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
||
msgid "Skip file and continue loading"
|
||
msgstr "Пропустити файл і продовжити завантаження"
|
||
|
||
#: lazarusidestrconsts.lisskiploadinglastproject
|
||
msgid "Skip loading last project"
|
||
msgstr "Пропустити завантаження останнього проекту"
|
||
|
||
#: lazarusidestrconsts.lisskipthesewarnings
|
||
msgid "Skip these warnings"
|
||
msgstr "Пропустити ці попередження"
|
||
|
||
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
||
msgid "Slower but more accurate."
|
||
msgstr "Повільніше, але точніше"
|
||
|
||
#: lazarusidestrconsts.lissmallerratherthanfaster
|
||
msgid "Smaller rather than faster"
|
||
msgstr "Зменшити за рахунок швидкодії"
|
||
|
||
#: lazarusidestrconsts.lissmatches
|
||
msgid "Matches"
|
||
msgstr "Збіги"
|
||
|
||
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
||
msgid "Sorry, this type is not yet implemented"
|
||
msgstr "Вибачте, цей тип ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts.lissortforscope
|
||
msgid "Sort for scope"
|
||
msgstr "Упорядкувати за областю дії"
|
||
|
||
#: lazarusidestrconsts.lissorting
|
||
msgid "Sorting"
|
||
msgstr "Упорядкування"
|
||
|
||
#: lazarusidestrconsts.lissortselascending
|
||
msgid "Ascending"
|
||
msgstr "За зростанням"
|
||
|
||
#: lazarusidestrconsts.lissortselcasesensitive
|
||
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
||
msgid "&Case Sensitive"
|
||
msgstr "&Чутливий до Регістру"
|
||
|
||
#: lazarusidestrconsts.lissortseldescending
|
||
msgid "Descending"
|
||
msgstr "Спадаюче"
|
||
|
||
#: lazarusidestrconsts.lissortseldomain
|
||
msgid "Domain"
|
||
msgstr "Домен"
|
||
|
||
#: lazarusidestrconsts.lissortselignorespace
|
||
msgid "Ignore Space"
|
||
msgstr "Ігнорувати пробіли"
|
||
|
||
#: lazarusidestrconsts.lissortsellines
|
||
msgid "Lines"
|
||
msgstr "Рядки"
|
||
|
||
#: lazarusidestrconsts.lissortseloptions
|
||
msgctxt "lazarusidestrconsts.lissortseloptions"
|
||
msgid "Options"
|
||
msgstr "Параметри"
|
||
|
||
#: lazarusidestrconsts.lissortselparagraphs
|
||
msgid "Paragraphs"
|
||
msgstr "Абзаци"
|
||
|
||
#: lazarusidestrconsts.lissortselpreview
|
||
msgctxt "lazarusidestrconsts.lissortselpreview"
|
||
msgid "Preview"
|
||
msgstr "Попередній перегляд"
|
||
|
||
#: lazarusidestrconsts.lissortselsort
|
||
msgid "Accept"
|
||
msgstr "Прийняти"
|
||
|
||
#: lazarusidestrconsts.lissortselsortselection
|
||
msgid "Sort selection"
|
||
msgstr "Сортування вибраного"
|
||
|
||
#: lazarusidestrconsts.lissortselwords
|
||
msgctxt "lazarusidestrconsts.lissortselwords"
|
||
msgid "Words"
|
||
msgstr "Слова"
|
||
|
||
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
|
||
msgid "Sort Unicode range list alphabetically"
|
||
msgstr "Упорядкувати список діапазонів Unicode за алфавітом"
|
||
|
||
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
||
msgid "Source and Destination are the same:%s%s"
|
||
msgstr "Код і призначення однакові:%s%s"
|
||
|
||
#: lazarusidestrconsts.lissourcebreakpoint
|
||
msgid "&Source Breakpoint ..."
|
||
msgstr "Точка зупинки &джерела ..."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
||
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
|
||
msgstr "Початкова тека \"%s\"%sі тека призачення \"%s\"%sзбігаються. Може ви не зрозуміли особливості.%sЦе очистить/перестворить цільову теку і скопіює до неї пакунок/проект."
|
||
|
||
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
||
msgid "Source directory \"%s\" does not exist."
|
||
msgstr "Теки сирців \"%s\" не існує."
|
||
|
||
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
||
msgid "Source Editor Window Manager"
|
||
msgstr "Керування вікном редактора сирців"
|
||
|
||
#: lazarusidestrconsts.lissourcemodified
|
||
msgid "Source modified"
|
||
msgstr "Код змінено"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
||
msgid "Source of page \"%s\" has changed. Save?"
|
||
msgstr "Код сторінки \"%s\" змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
||
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
||
msgstr "Сирці сторінок були змінені. Зберегти сторінки \"%s\"? (%d більше)"
|
||
|
||
#: lazarusidestrconsts.lissourcepaths
|
||
msgid "Source paths"
|
||
msgstr "Шляхи до програмних файлів"
|
||
|
||
#: lazarusidestrconsts.lisspaceequally
|
||
msgid "Space equally"
|
||
msgstr "Вирівняти по ширині"
|
||
|
||
#: lazarusidestrconsts.lissrcos
|
||
msgid "Src OS"
|
||
msgstr "Джр ОС"
|
||
|
||
#: lazarusidestrconsts.lisssearching
|
||
msgid "Searching"
|
||
msgstr "Пошук"
|
||
|
||
#: lazarusidestrconsts.lisssearchtext
|
||
msgid "Search text"
|
||
msgstr "Шукати текст"
|
||
|
||
#: lazarusidestrconsts.lisstartconversion
|
||
msgid "Start Conversion"
|
||
msgstr "Почати перетворення"
|
||
|
||
#: lazarusidestrconsts.lisstartide
|
||
msgid "Start IDE"
|
||
msgstr "Запустити ІСР"
|
||
|
||
#: lazarusidestrconsts.lisstartwithanewproject
|
||
msgid "Start with a new project"
|
||
msgstr "Розпочати з нового проекту"
|
||
|
||
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
||
msgid "Statusbar shows the property's name and the class where it is published."
|
||
msgstr "Рядок стану показує назву властивості і клас, де її опубліковано."
|
||
|
||
#: lazarusidestrconsts.lisstop
|
||
msgctxt "lazarusidestrconsts.lisstop"
|
||
msgid "Stop"
|
||
msgstr "Завершити"
|
||
|
||
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
||
msgid "Stop current debugging and rebuild project?"
|
||
msgstr "Завершити зневаджування і перебудувати проект?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging
|
||
msgid "Stop Debugging?"
|
||
msgstr "Завершити зневадження?"
|
||
|
||
#: lazarusidestrconsts.lisstopdebugging2
|
||
msgid "Stop debugging?"
|
||
msgstr "Завершити зневаджування?"
|
||
|
||
#: lazarusidestrconsts.lisstoponexception
|
||
msgid "Stop on exception"
|
||
msgstr "Зупинитись на винятку"
|
||
|
||
#: lazarusidestrconsts.lisstopthedebugging
|
||
msgid "Stop the debugging?"
|
||
msgstr "Завершити зневаджування?"
|
||
|
||
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
||
msgid "Store path delimiters \\ and / as"
|
||
msgstr "Зберігати роздільники шляху \\ та / як"
|
||
|
||
#: lazarusidestrconsts.lisstrangelpifile
|
||
msgid "Strange lpi file"
|
||
msgstr "Дивний lpi файл"
|
||
|
||
#: lazarusidestrconsts.lisstreamingerror
|
||
msgid "Streaming error"
|
||
msgstr "Помилка потоків"
|
||
|
||
#: lazarusidestrconsts.lisstring
|
||
msgid "String"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts.lisstyle
|
||
msgctxt "lazarusidestrconsts.lisstyle"
|
||
msgid "Style"
|
||
msgstr "Стиль"
|
||
|
||
#: lazarusidestrconsts.lissubprocedure
|
||
msgid "Sub Procedure"
|
||
msgstr "Підпроцедура"
|
||
|
||
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
||
msgid "Sub Procedure on same level"
|
||
msgstr "Підпроцедура того ж рівня"
|
||
|
||
#: lazarusidestrconsts.lissuccess
|
||
msgid "Success"
|
||
msgstr "Успішно"
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexported
|
||
msgid "Successfully exported to \"%s\"."
|
||
msgstr "Успішно експортовано до \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
||
msgid "Successfully exported %d BuildModes to \"%s\"."
|
||
msgstr " %d режимів збирання успішно експортовано до \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
||
msgid "Successfully exported compiler options to \"%s\"."
|
||
msgstr "Параметри компілятора успішно експортовано до \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimported
|
||
msgid "Successfully imported from \"%s\"."
|
||
msgstr "Успішно імпортовано з \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
||
msgid "Successfully imported %d BuildModes from \"%s\"."
|
||
msgstr " %d режимів збирання успішно імпортовано з \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
||
msgid "Successfully imported compiler options from \"%s\"."
|
||
msgstr "Параметри компілятора успішно імпортовано з \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
||
msgid "Suggest default name of new file in lowercase"
|
||
msgstr "Запропонувати типову назву нового файлу у нижньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lissuspiciousincludepath
|
||
msgid "Suspicious include path"
|
||
msgstr "Підозрілий шлях включення"
|
||
|
||
#: lazarusidestrconsts.lissuspiciousunitpath
|
||
msgid "Suspicious unit path"
|
||
msgstr "Підозрілий шлях модуля"
|
||
|
||
#: lazarusidestrconsts.lissvnrevision
|
||
msgid "SVN Revision: "
|
||
msgstr "Версія SVN"
|
||
|
||
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
||
msgid "Invalid variable name"
|
||
msgstr "Неправильна назва змінної"
|
||
|
||
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
||
msgid "\"%s\" is not a valid identifier."
|
||
msgstr "\"%s\" не є коректним ідентифікатором."
|
||
|
||
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
||
msgid "Override system variable"
|
||
msgstr "Змінювання системної змінної"
|
||
|
||
#: lazarusidestrconsts.lisswitchfiltersettings
|
||
msgid "Switch Filter Settings"
|
||
msgstr "Перемкнути налаштування фільтру"
|
||
|
||
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
||
msgid "Switch to Favorites tab after asking for component name."
|
||
msgstr "Перейти на вкладку Обране після запиту назви компонента."
|
||
|
||
#: lazarusidestrconsts.lissyntaxmode
|
||
msgid "Syntax mode"
|
||
msgstr "Синтаксичний режим"
|
||
|
||
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
||
msgid "system.ppu not found. Check your fpc.cfg."
|
||
msgstr "system.ppu не знайдено. Перевірте ваш fpc.cfg."
|
||
|
||
#: lazarusidestrconsts.listab
|
||
msgid "Tab"
|
||
msgstr "ТАБ"
|
||
|
||
#: lazarusidestrconsts.listaborderconfirmsort
|
||
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
||
msgstr "Сортувати вкладки всіх контролів-нащадків \"%s\" за позиціями?"
|
||
|
||
#: lazarusidestrconsts.listaborderdownhint
|
||
msgid "Move the selected control down in tab order"
|
||
msgstr "Змістити вибраний ел-т вниз у Таб-порядку"
|
||
|
||
#: lazarusidestrconsts.listaborderof
|
||
msgid "Tab Order of %s"
|
||
msgstr "Таб-порядок %s"
|
||
|
||
#: lazarusidestrconsts.listaborderrecursionhint
|
||
msgid "Calculate tab order recursively for child controls"
|
||
msgstr "Розраховувати порядок за tab для дочірніх елементів керування рекурсивноРозраховувати порядок за tab для дочірніх елементів керування рекурсивно"
|
||
|
||
#: lazarusidestrconsts.listaborderrecursively
|
||
msgid "recursively"
|
||
msgstr "рекурсивно"
|
||
|
||
#: lazarusidestrconsts.listabordersorthint
|
||
msgid "Calculate tab order for controls by their X- and Y- positions"
|
||
msgstr "Обчислити Таб-порядок елементів за їх X- та Y- позиціями"
|
||
|
||
#: lazarusidestrconsts.listaborderuphint
|
||
msgid "Move the selected control up in tab order"
|
||
msgstr "Змістити вибраний ел-т вгору у Таб-порядку"
|
||
|
||
#: lazarusidestrconsts.listabsfor
|
||
msgid "Tabs for %s"
|
||
msgstr "Вкладки для %s"
|
||
|
||
#: lazarusidestrconsts.listakesnapshot
|
||
msgid "Take a Snapshot"
|
||
msgstr "Зробити знімок"
|
||
|
||
#: lazarusidestrconsts.listarget
|
||
msgid "Target:"
|
||
msgstr "Ціль:"
|
||
|
||
#: lazarusidestrconsts.listarget2
|
||
msgid ", Target: %s"
|
||
msgstr ", ціль: %s"
|
||
|
||
#: lazarusidestrconsts.listargetcpu
|
||
msgid "Target CPU"
|
||
msgstr "Для ЦП:"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
||
msgid "Target file name: (-o, empty = use unit output directory)"
|
||
msgstr "Назва цільового файлу: (-o, порожньо = викор. вихідну теку модуля)"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameo
|
||
msgid "Target file name (-o):"
|
||
msgstr "Назва цільового файлу (-o):"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameofproject
|
||
msgid "Target filename of project"
|
||
msgstr "Назва цільового файлу проекту"
|
||
|
||
#: lazarusidestrconsts.listargetfilenameplusparams
|
||
msgid "Target filename + params"
|
||
msgstr "Назва цільового файлу + параметри"
|
||
|
||
#: lazarusidestrconsts.listargetisreadonly
|
||
msgid "Target is read only"
|
||
msgstr "Ціль доступна лише для читання"
|
||
|
||
#: lazarusidestrconsts.listargetos
|
||
msgctxt "lazarusidestrconsts.listargetos"
|
||
msgid "Target OS"
|
||
msgstr "Для якої ОС"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcell
|
||
msgid "Editable Cell"
|
||
msgstr "Редагована комірка"
|
||
|
||
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
||
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
||
msgstr "Вставляє редаговану комірку. По комірках можна переміщатися за допомогою клавіші tab.%0:sМакрос \"param\" приймає список розділених комами аргументів.%0:sПерший аргумент є типовим значенням.%0:sДругий аргумент (необов'язковий) може бути використаний щоб пов'язати комірку з іншою (синхронна зміна)%0:s%0:s а param(\"foo\") do param(foo);%0:sВставляє 2 незалежних комірки, з типовим текстом \"foo\"%0:sЛапки необов'язковіl%0:s%0:s Якщо param(\"foo\") > 0 та param(\"foo\",sync=1) < 99 тоді%0:sВставляє 2 пов'язані комірки, редагування однієї змінить іншу також%0:sЗначення \"1\" вказує позицію іншого \"param()\", так що якщо є ще параметри:%0:s якщо param(\"bar\") та param(foo) > 0 і param(foo,sync=2) < 99 тоді%0:s2-га і третя пов'язуються. (3-тя вказує на \"2\") %0:s%0:s\"синх може бути скорочений до \"s\":%0:s якщо param(\"foo\") > 0 та param(\"foo\",s=1) < 99 тоді%0:s%0:s якщо param(\"bar\") та param(\"foo\") > 0 і param(\"foo\",sync) < 99 тоді%0:sДругий і третій пов'язуються.%0:sЗауважте: \"Синх не має позиції і не має \"=\", тому він синхронізує з попередньою коміркою з тим самим типовим текстом (тут це \"foo\")"
|
||
|
||
#: lazarusidestrconsts.listemplatefile
|
||
msgid "Template file"
|
||
msgstr "Файл шаблону"
|
||
|
||
#: lazarusidestrconsts.listestdirectory
|
||
msgid "Test directory"
|
||
msgstr "Тека проб"
|
||
|
||
#: lazarusidestrconsts.listesturl
|
||
msgid "Test URL"
|
||
msgstr "Перевірити URL"
|
||
|
||
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
||
msgid "The Application Bundle was created for \"%s\""
|
||
msgstr "Пакет застосунків був створений для \"%s\""
|
||
|
||
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
||
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
||
msgstr "Клас \"%s\" є елементом керування (TControl) і його не можна вставити на щось інше.%sНеможливо вставити."
|
||
|
||
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
||
msgid "The Codetools found an error:%s%s"
|
||
msgstr "Codetools знайшов помилку:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
||
msgid "The command after \"%s\" is not executable."
|
||
msgstr "Команда після \"%s\" не є виконуваною."
|
||
|
||
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
||
msgid "The command after publishing is invalid:%s\"%s\""
|
||
msgstr "Команда після опублікування є некоректною:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
||
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
||
msgstr "Файл компілятора \"%s\" виглядає неправильним:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
||
msgid "The component %s can not be deleted, because it is not owned by %s."
|
||
msgstr "Компонент %s не може бути видалений, бо %s ним не володіє."
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
||
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
||
msgstr "Редактор компонента для класу \"%s\" викликав помилку:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
||
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
||
msgstr "Редактор компонента для класу \"%s\",%sщо пов'язаний зі словом #%s \"%s\"%sвикликав помилку:%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
||
msgstr "Компонент %s успадкований від %s.%sДля видалення успадкованого компонента слід відкрити об'єкт-предок і видалити його там."
|
||
|
||
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
||
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
||
msgstr "Компонент %s успадкований від %s.%sДля перейменування успадкованого компонента слід відкрити об'єкт-предок і перейменувати його там."
|
||
|
||
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
||
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
||
msgstr "Назви компонентів мають бути унікальними у межах форми/модуля даних. Порівнюються назви, як і звичайні ідентифікатори Pascal, без урахування регістру."
|
||
|
||
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
||
msgid "The configuration will be downgraded/converted."
|
||
msgstr "Конфігурація буде понижена/перетворена."
|
||
|
||
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
||
msgid "The %s contains a nonexistent directory:%s%s"
|
||
msgstr "%s містить теку, яка не існує:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
||
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
||
msgstr "%s містить символ зірочки *.%sLazarus інтерпретує його як звичайний символ, не розкриваючи в якості маски файлу."
|
||
|
||
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
||
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
||
msgstr "Поточний FPC не має файлу налаштувань. Ймовірно, компілятор не зможе знайти ряд модулів. Перевірте, що fpc правильно встановлено."
|
||
|
||
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
||
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
||
msgstr "Зневаджувач \"%s\"%sвідсутній або не є виконуваним.%sДив. Інструменти -> Параметри -> Параметри зневаджувача"
|
||
|
||
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
||
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
||
msgstr "Виконуваний файл зневаджувача здебільшого має назву \"%s\". Вкажіть повний шлях до файлу."
|
||
|
||
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
||
msgid "The default mode must be stored in project, not in session."
|
||
msgstr "Типовий режим має зберігатись у проекті, а не у сеансі."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
||
msgid "The destination directory%s\"%s\" does not exist."
|
||
msgstr "Теки призначення%s\"%s\" не існує."
|
||
|
||
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
||
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
||
msgstr "Теки призначення \"%s\" не існує.%sПеревірте назву виконуваного файлу в Меню > Проект > Параметри проекту."
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
||
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
||
msgstr "Каталог \"%s\" більше не містить файлів включення проекту. Видалити його зі списку шляхів пошуку файлів включення проекту?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
||
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
||
msgstr "Каталог \"%s\" більше не містить модулі проекту. Видалити його зі списку шляхів пошуку модулів проекту?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
||
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
||
msgstr "Тека \"%s\" більше не потрібна у шляху до модулів.%sПрибрати її?"
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
||
msgid "The directory \"%s\" is not writable."
|
||
msgstr "Тека \"%s\" недоступна для запису."
|
||
|
||
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
||
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
|
||
msgstr "Теки \"%s\" немає у шляху до модулів.%sДодати її?"
|
||
|
||
#: lazarusidestrconsts.listhedirectorywasnotfound
|
||
msgid "The directory %s was not found."
|
||
msgstr "Директорія %s не знайдена."
|
||
|
||
#: lazarusidestrconsts.listhefile
|
||
msgid "The file \"%s\""
|
||
msgstr "Файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
||
msgid "The file %s does not look like a lpi file."
|
||
msgstr "Файл %s не схожий на lpi файл."
|
||
|
||
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
||
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
||
msgstr "Індекс файлів потрібен для забезпечення роботи функції пошуку і їй подібних. Під час сканування можна редагувати початковий код і компілювати, але функція пошуку і їй подібні будуть повідомляти, що необхідні модулі не знайдені. Це може зайняти кілька хвилин."
|
||
|
||
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
||
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
||
msgstr "Файл \"%s\" є символьним посиланням.%sВідкрити замість нього \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
||
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
||
msgstr "Файл \"%s\" не є проектом Lazarus.%sСтворити новий прокт для цього \"%s\"?"
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisinvalid
|
||
msgid "The file mask \"%s\" is invalid."
|
||
msgstr "Файлова маска \"%s\" недійсна."
|
||
|
||
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
||
msgid "The file mask \"%s\" is not a valid regular expression."
|
||
msgstr "Файлова маска \"%s\" не є правильним регулярним виразом."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
||
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
||
msgstr "Файл \"%s\"схожий на програму. %sЗакрити поточний проект і створити новий проект Lazarus для цієї програми?%s\"Ні\" відкриє файл як звичайний код."
|
||
|
||
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
||
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
||
msgstr "Схоже, що файл %s є програмним в існуючому проекті Lazarus."
|
||
|
||
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
||
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
||
msgstr "Файл \"%s\"%sзнайдений в одному з каталогів початкового коду пакунка %s, і він виглядає як скомпільований модуль. Такі модулі повинні бути у вихідній теці пакунка, інакше інші пакунки можуть мати проблеми з використанням цього пакунка.%sВидалити невизначений файл?"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
||
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
||
msgstr "Файлу \"%s\" не знайдено.%sБажаєте пошукати його самостійно?"
|
||
|
||
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
||
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
||
msgstr "Файл \"%s\" не знайдено.%sЗнехтувати продовжить завантаження проекту,%sПерервати зупинить завантаження."
|
||
|
||
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
||
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
||
msgstr "Такі методи, що використовуються %s відсутні у джерелі%s%s%s%s%sПрибрати завислі посилання?"
|
||
|
||
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
||
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
||
msgstr "Джерельна тека FPC \"%s\" виглядає неправильною:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
||
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
||
msgstr "Виконуваний файл компілятора Free Pascal зазвичай має назву \"%s\". Ви також можете використовувати компілятор для певної платформи, наприклад, \"%s\". Задайте повний шлях до файлу."
|
||
|
||
#: lazarusidestrconsts.listheideisstillbuilding
|
||
msgid "The IDE is still building."
|
||
msgstr "ІСР ще збирається."
|
||
|
||
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
||
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
||
msgstr "Ідентифікатор є модулем. Для його перейменування використайте функцію Файл - Зберегти як."
|
||
|
||
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
||
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
||
msgstr "Клавішу %s вже призначено для %s%s.%s%sВидалити старе призначення і призначити клавішу для нової функції %s?"
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
||
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
||
msgstr "Необхідний для виконання Пакет програм %s%sне існує або не є виконуваним файлом.%sВи хочете створити такий?%s%Для налаштування дивіться Проект -> Параметри проекту -> Застосунок."
|
||
|
||
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
||
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
||
msgstr "Виконуваний застосунок \"%s\"%sне існує або не є виконуваною.%sДивіться Виконання -> Параметри виконання -> Локальні"
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
||
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
||
msgstr "Тека Lazarus містить початкові коди ІСР і файли пакетів LCL і багато стандартних пакунків. Наприклад, вона містить файл \"ide%slazarus.lpi\". Файли перекладу також знаходяться там."
|
||
|
||
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
||
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
||
msgstr "Тека Lazarus \"%s\" виглядає неправильною:%s%s"
|
||
|
||
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
||
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
||
msgstr "LFM-файл (файл форми Lazarus) містить некоректні властивості. Це означає, наприклад, що він вміщує деякі властивості/класи, яких немає у поточній версії LCL. Як правило треба прибрати ці властивості з lfm і виправити код Pascal вручну."
|
||
|
||
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
||
msgid "The macro \"%s\" does not begin with \"%s\"."
|
||
msgstr "Макрос \"%s\" не починається з \"%s\"."
|
||
|
||
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
||
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
||
msgstr "Виконуваний файл \"make\" здебільшого має назву \"%s\". Він необхідний для збирання ІСР. Вкажіть повний шлях до файлу."
|
||
|
||
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
||
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
||
msgstr "Новий файл для включення відсутній у теках пошуку включень.%sДодати теку %s?"
|
||
|
||
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
||
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
||
msgstr "Новий модуль ще не в теках пошуку модулів.%sДодати теку %s?"
|
||
|
||
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
||
msgid "The old configuration will be upgraded."
|
||
msgstr "Стара конфігурація буде оновлена."
|
||
|
||
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
||
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
||
msgstr "\"Інші джерела\" містить каталог, який вже знаходиться в \"Інші файли модулів\".%s%s"
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
||
msgid "The output directory \"%s\" is missing."
|
||
msgstr "Кінцева тека \"%s\" відсутня."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
||
msgid "The output directory of %s is listed in the include search path of %s."
|
||
msgstr "Вихідна тека %s є в списку пошуку включених шляхів %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
||
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
||
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого включення %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
||
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
||
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого модуля %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
||
msgid "The output directory of %s is listed in the unit search path of %s."
|
||
msgstr "Вихідна тека %s є в списку пошуку шляху модуля %s."
|
||
|
||
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
||
msgid " The output directory should be a separate directory and not contain any source files."
|
||
msgstr " Вихідна тека повинна бути окремою текою і не містити файлів початкових кодів."
|
||
|
||
#: lazarusidestrconsts.listheownerclasshasthisname
|
||
msgid "The owner class has this name"
|
||
msgstr "Клас власника має цю назву"
|
||
|
||
#: lazarusidestrconsts.listheownerhasthisname
|
||
msgid "The owner has this name"
|
||
msgstr "Власник має цю назву"
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
||
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "Пакунок %s додає шлях \"%s\" до шляху включення ІСР.%sНапевне пакунок погано сконфігурований."
|
||
|
||
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
||
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
||
msgstr "Пакунок %s додає шлях \"%s\" до шляху модулів ІСР.%sНапевне пакунок погано сконфігурований."
|
||
|
||
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
||
msgid "The package already contains a unit with this name."
|
||
msgstr "Пакунок вже містить модуль з такою назвою."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
||
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
||
msgstr "Пакунок %s неможливо встановити, бо він вимагає пакунок \"%s\", який є пакунком лише часу виконання."
|
||
|
||
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
||
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
||
msgstr "Пакунок %s не можна деінсталювати, бо він потрібен для самого ІСР."
|
||
|
||
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
||
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
||
msgstr "Пакунок %s не має жодних процедур \"Реєстрації\", яка зазвичай означає, що він не надає аддон ІСР. Його встановлення швидше всього лише збільшить розмір ІСР і може навіть зробити його нестійким.%sПідказка: якщо ви хочете використати пакунок у проекті, використайте пункт меню \"Додати у проект\"."
|
||
|
||
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
||
msgid "The package %s is already in the list"
|
||
msgstr "Пакунок %s вже в списку"
|
||
|
||
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
||
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
||
msgstr "Пакунок %s не є пакунком часу розробки. Він не може бути встановлений в ІСР."
|
||
|
||
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
||
msgid "The path of \"make\" is not correct: \"%s\""
|
||
msgstr "Шлях \"make\" є неправильним: \"%s\""
|
||
|
||
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
||
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
||
msgstr "Програму \"make\" не знайдено.%sЦей засіб потрібен, щоб зібрати Lazarus."
|
||
|
||
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
||
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
||
msgstr "Опції компілятора проекту і директиви в основному коді відрізняються. Для нового модуля будуть використані наступні режим і тип рядка проекту:"
|
||
|
||
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
||
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
||
msgstr "Проект не використовує інтерфейси модулів LCL, які вимагає LCLBase.%sВи отримаєте дивні помилки компонувальника, якщо ви використаєте LCL без інтерфейсів."
|
||
|
||
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
||
msgid "The project has no main source file."
|
||
msgstr "Проект не має основного файлу з початковим кодом."
|
||
|
||
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
||
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
||
msgstr "Файл відомостей проекту \"%s\"%sзбігається з головним сирцевим файлом!"
|
||
|
||
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
||
msgid "The project information file \"%s\"%shas changed on disk."
|
||
msgstr "Інформаційний файл проекту \"%s\"%sзмінився на диску."
|
||
|
||
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
||
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
||
msgstr "Проект треба зберегти перед компіляцією%sЯкщо ви встановите тестову теку в параметрах ІСР,%sВи можете створювати проекти і будувати їх одразу.%sЗберегти проект?"
|
||
|
||
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
||
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
||
msgstr "Проект використовує цільову ОС=%s та ЦП=%s.%ssystem.ppu для цієї цілі не був знайдений у теках бінарників. %sПереконайтесь, що fpc для цієї цілі встановлений правильно і в fpc.cfg вказано правильні теки."
|
||
|
||
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
|
||
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
|
||
msgstr "Проект використовує нові ресурси FPC, які вимагають принаймні FPC 2.4"
|
||
|
||
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
||
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
||
msgstr "Проект записує зневаджувальні дані у зовнішній файл. \"%s\" підтримує лише зневаджувальні дані, розміщені безпосередньо у виконуваному файлі."
|
||
|
||
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
||
msgid "%sThere are additional notes for this message on%s"
|
||
msgstr "%sДо цього повідомлення є додаткові зауваження у%s"
|
||
|
||
#: lazarusidestrconsts.listherearenoconflictingkeys
|
||
msgid "There are no conflicting keys."
|
||
msgstr "Конфліктів клавіш немає."
|
||
|
||
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
||
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
||
msgstr "В теці є і інші файли з такою самою назвою,%s, що відрізняється тільки регістром:%s%s%sВидалити їх?"
|
||
|
||
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
||
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
||
msgstr "На диску є файл з такою самою назвою і схожим розширенням%sФайл: %s%sСхожий файл: %s%sВидалити схожий файл?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
||
msgid "There is already a build mode with this name."
|
||
msgstr "Режим збирання з такою назвою вже існує."
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
||
msgid "There is already a component class with the name %s."
|
||
msgstr "Клас компонента з назвою %s вже існує."
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
||
msgid "There is already a component with this name"
|
||
msgstr "Вже існує компонент з такою назвою"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyafilein
|
||
msgid "There is already a file%s%s%sin %s"
|
||
msgstr "Файл %s%s%sу %s вже існує"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
||
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
||
msgstr "Файл \"%s\" у %s вже існує%sСтарий: %s%sНовий: %s%s%sПродовжити?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
||
msgid "There is already a form with the name \"%s\""
|
||
msgstr "Вже існує форма з назвою \"%s\""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
||
msgid "There is already a macro with the name \"%s\"."
|
||
msgstr "Вже є макрос з назвою \"%s\"."
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
||
msgid "There is already an IDE macro with the name \"%s\""
|
||
msgstr "Вже існує макрос ІСР з назвою \"%s\""
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
||
msgid "There is already a package %s in the list"
|
||
msgstr "В списку вже є пакунок %s"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
||
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
||
msgstr "Модуль \"%s\" вже є в \"%s\"%sСтарий: %s%sНовий: %s%sПереконайтесь, що у теках пошуку модулів є лише один з них.%s%sПродовжити?"
|
||
|
||
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
||
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
||
msgstr "Вже існує модуль з назвою \"%s\". Ідентифікатори Pascal мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
||
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
||
msgstr "У проекті є модуль з назвою \"%s\".%sВиберіть іншу назву"
|
||
|
||
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
||
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
||
msgstr "У теці з %s немає fpc.exe. Зазвичай виконуваний файл make встановлюється разом з компілятором FPC."
|
||
|
||
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
||
msgid "There must be at least one build mode."
|
||
msgstr "Має бути хоча б один режим збирання."
|
||
|
||
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
||
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
||
msgstr "Клас ресурсу \"%s\" походить від \"%s\". Можливо, що це мало бути TForm."
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
||
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при запису вибраних компонентів %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
||
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
||
msgstr "Сталася помилка при перетворенні бінарного потоку вибраного компонента %s:%s:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
||
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
||
msgstr "Сталася помилка при копіюванні потоку компонента в буфер:%s%s"
|
||
|
||
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
||
msgid "The root component cannot be deleted."
|
||
msgstr "Компонент верхнього рівня не може бути видалено."
|
||
|
||
#: lazarusidestrconsts.listhesefileswillbedeleted
|
||
msgid "These files will be deleted"
|
||
msgstr "Ці файли будуть видалені"
|
||
|
||
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
||
msgid "These settings are stored with the project."
|
||
msgstr "Ці налаштування зберігаються з проектом."
|
||
|
||
#: lazarusidestrconsts.listheseunitswerenotfound
|
||
msgid "These units were not found:"
|
||
msgstr "Ці модулі не були знайдені:"
|
||
|
||
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
||
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
||
msgstr "Сирці пакунків Free Pascal необхідні для перегляду і завершення коду. Наприклад, вони мають файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.listhetargetisnotwritable
|
||
msgid "The target %s is not writable."
|
||
msgstr "Ціль %s не доступна для запису."
|
||
|
||
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
||
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
||
msgstr "Неможливо знайти тестову теку:%s\"%s\"%s(див. параметри ІСР)"
|
||
|
||
#: lazarusidestrconsts.listheunitalreadyexists
|
||
msgid "The unit \"%s\" already exists."
|
||
msgstr "Модуль \"%s\" вже існує."
|
||
|
||
#: lazarusidestrconsts.listheunitbelongstopackage
|
||
msgid "The unit belongs to package %s."
|
||
msgstr "Модуль належить пакунку %s."
|
||
|
||
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
||
msgid "The unit %s exists twice in the unit path of the %s:"
|
||
msgstr "Модуль %s існує двічі в шляху модулів %s:"
|
||
|
||
#: lazarusidestrconsts.listheunithasthisname
|
||
msgid "The unit has this name"
|
||
msgstr "Модуль має цю назву"
|
||
|
||
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
||
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
||
msgstr "Назва файлу модуля \"%s\" - не в нижньому регістрі.%sКомпілятор Free Pascal не шукає всі регістри. Рекомендовано користуватися нижнім регістром для назви.%sПерейменувати файл?"
|
||
|
||
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
||
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
||
msgstr "Модуль %s є частиною джерел FPC, але відповідний fpdoc xml файл не був знайдений.%sАбо ви ще не додали теку fpcdocs до пошукового шляху або модуль ще не документований.%sФайли fpdoc файли для джерел FPC можуть бути завантажені з: %s%sДодайте теку в опціях редактора fpdoc.%sЩоб створити новий файл, каталог має бути перезаписуваним."
|
||
|
||
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
||
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
||
msgstr "Модуль %s використовується іншими файлами.%sОновити залежності автоматично?"
|
||
|
||
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
||
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
||
msgstr "Модуль вже називається \"%s\". Ідентифікатори Pascal мають бути унікальними."
|
||
|
||
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
||
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
||
msgstr "Шлях пошуку модулів \"%s\" містить теку початкових кодів \"%s\" пакунка %s"
|
||
|
||
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
||
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
||
msgstr "Робоча тека \"%s\" не існує.%sПеревірте робочу теку у Меню > Виконати > Параметри виконання."
|
||
|
||
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
||
msgid "This component already contains a class with the name %s."
|
||
msgstr "Цей компонент вже містить клас з назвою %s."
|
||
|
||
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
||
msgid "This function needs an open .lfm file in the source editor."
|
||
msgstr "Ця функція потребує відкритий .lfm файл в редакторі коду."
|
||
|
||
#: lazarusidestrconsts.listhishelpmessage
|
||
msgid "this help message"
|
||
msgstr "це довідкове повідомлення"
|
||
|
||
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
||
msgid "This is a test project for a design time package, testing it outside the IDE."
|
||
msgstr "Тестовий проект для перевірки пакунка часу розробки поза ІСР."
|
||
|
||
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
||
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
||
msgstr "Це виглядає як файл Pascal.%sРекомендується використовувати назви файлів у нижньому регістрі, щоб уникнути різних проблем на деякиих операційних системах і різних компіляторах.%sЗмінити на нижній регістр?"
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
||
msgid "This project has no main source file"
|
||
msgstr "Проект не має основного файлу з поч. кодом"
|
||
|
||
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
||
msgid "This project has only the default build mode."
|
||
msgstr "Цей проект має лише типовий режим збирання."
|
||
|
||
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
||
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
||
msgstr "Цей набір параметрів для збирання Lazarus не підтримується встановленням.%sТека \"%s\" недоступна для запису.%sДивіться сайт Lazarus для інших способів встановлення."
|
||
|
||
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
||
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
||
msgstr "Цей вираз не може бути витягнутий.%sВиберіть будь-який код, щоб витягти нову процедуру/метод."
|
||
|
||
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
||
msgid "This will allow changing all build modes at once. Not implemented yet."
|
||
msgstr "Це дозволить за раз змінити всі режими збирання. Ще не реалізовано."
|
||
|
||
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
||
msgid "This will create a circular dependency."
|
||
msgstr "Це створить кругову залежність."
|
||
|
||
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
||
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
||
msgstr "До буфера обміну буде вміщено багато тексту (%s).%sПродовжити?"
|
||
|
||
#: lazarusidestrconsts.listhreads
|
||
msgctxt "lazarusidestrconsts.listhreads"
|
||
msgid "Threads"
|
||
msgstr "Нитки"
|
||
|
||
#: lazarusidestrconsts.listhreadscurrent
|
||
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
||
msgid "Current"
|
||
msgstr "Поточний"
|
||
|
||
#: lazarusidestrconsts.listhreadsfunc
|
||
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
||
msgid "Function"
|
||
msgstr "Функція"
|
||
|
||
#: lazarusidestrconsts.listhreadsgoto
|
||
msgid "Goto"
|
||
msgstr "ЙтиДо"
|
||
|
||
#: lazarusidestrconsts.listhreadsline
|
||
msgctxt "lazarusidestrconsts.listhreadsline"
|
||
msgid "Line"
|
||
msgstr "Рядок"
|
||
|
||
#: lazarusidestrconsts.listhreadsnotevaluated
|
||
msgid "Threads not evaluated"
|
||
msgstr "Нитки не визначені"
|
||
|
||
#: lazarusidestrconsts.listhreadssrc
|
||
msgctxt "lazarusidestrconsts.listhreadssrc"
|
||
msgid "Source"
|
||
msgstr "Джерело"
|
||
|
||
#: lazarusidestrconsts.listhreadsstate
|
||
msgctxt "lazarusidestrconsts.listhreadsstate"
|
||
msgid "State"
|
||
msgstr "Стан"
|
||
|
||
#: lazarusidestrconsts.listitle
|
||
msgid "&Title"
|
||
msgstr "&Заголовок"
|
||
|
||
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
||
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
||
msgstr "Назва на панелі завдань показує наприклад: project1.lpi - Lazarus"
|
||
|
||
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
||
msgid "Title (leave empty for default)"
|
||
msgstr "Назва (залишити порожнім для типової)"
|
||
|
||
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
||
msgid "Choose a component icon 24x24"
|
||
msgstr "Виберіть для компонента значок 24x24"
|
||
|
||
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
||
msgid "Function: append path delimiter"
|
||
msgstr "Функція: додати розподілювач шляхів"
|
||
|
||
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
||
msgid "Function: remove trailing path delimiter"
|
||
msgstr "Функція: прибрати кінцевий роздільник шляху"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfileextension
|
||
msgid "Function: extract file extension"
|
||
msgstr "Функція: витягнути розширення файлу"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
||
msgid "Function: extract file name+extension"
|
||
msgstr "Функція: витягнути назву файлу з розширенням"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
||
msgid "Function: extract file name only"
|
||
msgstr "Функція: витягнути тільки назву файлу"
|
||
|
||
#: lazarusidestrconsts.listmfunctionextractfilepath
|
||
msgid "Function: extract file path"
|
||
msgstr "Функція: витягнути шлях до файлу"
|
||
|
||
#: lazarusidestrconsts.listmunknownmacro
|
||
msgid "(unknown macro: %s)"
|
||
msgstr "(невідомий макрос: %s)"
|
||
|
||
#: lazarusidestrconsts.listofpcpath
|
||
msgid "Path:"
|
||
msgstr "Шлях:"
|
||
|
||
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
||
msgid "Toggle showing filenames with full path or with relative path"
|
||
msgstr "Перемкнути показ назв файлів з повним або відносним шляхом"
|
||
|
||
#: lazarusidestrconsts.listoolbarconfiguration
|
||
msgid "Toolbar Configuration"
|
||
msgstr "Конфігурація панелі інструментів"
|
||
|
||
#: lazarusidestrconsts.listoolbaroptions
|
||
msgid "Toolbar"
|
||
msgstr "Панель інструментів"
|
||
|
||
#: lazarusidestrconsts.listoolbaroptionshighlight
|
||
msgid "Highlight toolbars buttons"
|
||
msgstr "Підсвітити кнопки на панелях"
|
||
|
||
#: lazarusidestrconsts.listoolbaroptionsraise
|
||
msgid "Raise toolbars"
|
||
msgstr "Підняти інструментальні панелі"
|
||
|
||
#: lazarusidestrconsts.listoolhasnoexecutable
|
||
msgid "tool \"%s\" has no executable"
|
||
msgstr "засіб \"%s\" не має виконуваного файлу"
|
||
|
||
#: lazarusidestrconsts.listoolheaderfailed
|
||
msgid "Tool Header: Failed"
|
||
msgstr "Заголовок засобу: Невдача"
|
||
|
||
#: lazarusidestrconsts.listoolheaderrunning
|
||
msgid "Tool Header: Running"
|
||
msgstr "Заголовок засобу: Виконання"
|
||
|
||
#: lazarusidestrconsts.listoolheaderscrolledup
|
||
msgid "Tool Header: Scrolled up"
|
||
msgstr "Заголовок засобу: Прокрутка вгору"
|
||
|
||
#: lazarusidestrconsts.listoolheadersuccess
|
||
msgid "Tool Header: Success"
|
||
msgstr "Заголовок засобу: Успішно"
|
||
|
||
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
||
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
||
msgstr "засіб завершив роботу з кодом %s. Скористайтесь контекстним меню, щоб отримати більше інформації."
|
||
|
||
#: lazarusidestrconsts.listop
|
||
msgctxt "lazarusidestrconsts.listop"
|
||
msgid "Top"
|
||
msgstr "Вгорі"
|
||
|
||
#: lazarusidestrconsts.listopanchoring
|
||
msgid "Top anchoring"
|
||
msgstr "Фіксація по верху"
|
||
|
||
#: lazarusidestrconsts.listopborderspacespinedithint
|
||
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
||
msgstr "Верхній бордюр. Ця величина додається до базового бордюру і використовується для відступу над контролем."
|
||
|
||
#: lazarusidestrconsts.listopinfoview
|
||
msgid "Show Class/Proc Hint"
|
||
msgstr "Показувати підказку Клас/Проц"
|
||
|
||
#: lazarusidestrconsts.listops
|
||
msgid "Tops"
|
||
msgstr "Вершини"
|
||
|
||
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
||
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
||
msgstr "Це елемент керування одного рівня, за яким зафіксовано верхній край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
|
||
|
||
#: lazarusidestrconsts.listopspaceequally
|
||
msgid "Top space equally"
|
||
msgstr "Вирівняти по висоті"
|
||
|
||
#: lazarusidestrconsts.listotalpages
|
||
msgid "Total Pages: %s"
|
||
msgstr "Всього сторінок: %s"
|
||
|
||
#: lazarusidestrconsts.listranslatetheenglishmessages
|
||
msgid "Translate the English Messages"
|
||
msgstr "Перекласти англійські повідомлення"
|
||
|
||
#: lazarusidestrconsts.listreeneedsrefresh
|
||
msgid "Tree needs refresh"
|
||
msgstr "Дерево потребує оновлення"
|
||
|
||
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
||
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
||
msgstr "Два переміщувані файли мають однакові назви:%s%s%s%s%sу %s"
|
||
|
||
#: lazarusidestrconsts.listypes
|
||
msgid "Types (not removed if no replacement)"
|
||
msgstr "Типи (не видалені якщо немає заміни)"
|
||
|
||
#: lazarusidestrconsts.lisudadditionaldirectories
|
||
msgid "Additional directories:"
|
||
msgstr "Додаткові теки:"
|
||
|
||
#: lazarusidestrconsts.lisudallpackageunits
|
||
msgid "All package units"
|
||
msgstr "Всі модулі пакунків"
|
||
|
||
#: lazarusidestrconsts.lisudallsourceeditorunits
|
||
msgid "All source editor units"
|
||
msgstr "Всі модулі у редакторі коду"
|
||
|
||
#: lazarusidestrconsts.lisudallunits
|
||
msgid "All units"
|
||
msgstr "Всі модулі"
|
||
|
||
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
||
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
||
msgstr "Типово пошук виконується лише у модулях проекту, а також у модулях, відкритих у редакторі коду. Додайте тут список тек, відокремлюючи крапками з комою, щоб шукати ще й у них."
|
||
|
||
#: lazarusidestrconsts.lisudcollapseallnodes
|
||
msgid "Collapse all nodes"
|
||
msgstr "Згорнути всі вузли"
|
||
|
||
#: lazarusidestrconsts.lisudexpandallnodes
|
||
msgid "Expand all nodes"
|
||
msgstr "Розгорнути всі вузли"
|
||
|
||
#: lazarusidestrconsts.lisudfile
|
||
msgid "File: %s"
|
||
msgstr "Файл: %s"
|
||
|
||
#: lazarusidestrconsts.lisudfilter
|
||
msgid "(Filter)"
|
||
msgstr "(Фільтр)"
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses
|
||
msgid "Implementation Uses: %s"
|
||
msgstr "Uses з Implementation: %s"
|
||
|
||
#: lazarusidestrconsts.lisudimplementationuses2
|
||
msgid "implementation uses: %s"
|
||
msgstr "Uses з Implementation: %s"
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses
|
||
msgid "Interface Uses: %s"
|
||
msgstr "Uses з Interface: %s"
|
||
|
||
#: lazarusidestrconsts.lisudinterfaceuses2
|
||
msgid "interface uses: %s"
|
||
msgstr "Uses з Interface: %s"
|
||
|
||
#: lazarusidestrconsts.lisudprojectsandpackages
|
||
msgid "Projects and packages"
|
||
msgstr "Проекти і пакунки"
|
||
|
||
#: lazarusidestrconsts.lisudscanning
|
||
msgid "Scanning ..."
|
||
msgstr "Триває пошук ..."
|
||
|
||
#: lazarusidestrconsts.lisudscanningunits
|
||
msgid "Scanning: %s units ..."
|
||
msgstr "Триває пошук: %s модулів ..."
|
||
|
||
#: lazarusidestrconsts.lisudsearch
|
||
msgid "(Search)"
|
||
msgstr "(Пошук)"
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
||
msgid "Find next occurrence of this phrase"
|
||
msgstr "Знайти наступне входження цієї фрази"
|
||
|
||
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
||
msgid "Find next unit with this phrase"
|
||
msgstr "Знайти наступне модуль з цією фразою"
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
||
msgid "Find previous occurrence of this phrase"
|
||
msgstr "Знайти попереднє входження цієї фрази"
|
||
|
||
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
||
msgid "Find previous unit with this phrase"
|
||
msgstr "Знайти попередній модуль з цією фразою"
|
||
|
||
#: lazarusidestrconsts.lisudselectedunits
|
||
msgid "Selected units"
|
||
msgstr "Вибрані модулі"
|
||
|
||
#: lazarusidestrconsts.lisudshownodesfordirectories
|
||
msgid "Show nodes for directories"
|
||
msgstr "Показувати вузли для тек"
|
||
|
||
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
||
msgid "Show nodes for project and packages"
|
||
msgstr "Показувати вузли для проектів і пакунків"
|
||
|
||
#: lazarusidestrconsts.lisudunits
|
||
msgid "Units"
|
||
msgstr "Модулі"
|
||
|
||
#: lazarusidestrconsts.lisudunits2
|
||
msgid "Units: %s"
|
||
msgstr "Модулі: %s"
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations
|
||
msgid "Used by Implementations: %s"
|
||
msgstr "Використовується в Implementation: %s"
|
||
|
||
#: lazarusidestrconsts.lisudusedbyimplementations2
|
||
msgid "used by implementations: %s"
|
||
msgstr "використовується в Implementation: %s"
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces
|
||
msgid "Used by Interfaces: %s"
|
||
msgstr "Використовується в Interface: %s"
|
||
|
||
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
||
msgid "used by interfaces: %s"
|
||
msgstr "використовується в Interface: %s"
|
||
|
||
#: lazarusidestrconsts.lisuedonotsho
|
||
msgid "Do not show this message again."
|
||
msgstr "Не показувати це повідомлення знову."
|
||
|
||
#: lazarusidestrconsts.lisueerrorinregularexpression
|
||
msgid "Error in regular expression"
|
||
msgstr "Помилка в регулярному виразі"
|
||
|
||
#: lazarusidestrconsts.lisuefontwith
|
||
msgid "Font without UTF-8"
|
||
msgstr "Шрифт без UTF-8"
|
||
|
||
#: lazarusidestrconsts.lisuegotoline
|
||
msgid "Goto line:"
|
||
msgstr "Перейти до рядка:"
|
||
|
||
#: lazarusidestrconsts.lisuemodeseparator
|
||
msgid "/"
|
||
msgstr "/"
|
||
|
||
#: lazarusidestrconsts.lisuenotfound
|
||
msgid "Not found"
|
||
msgstr "Не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
||
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
||
msgstr "Замінити \"%s\"%s на \"%s\" у цьому місті?"
|
||
|
||
#: lazarusidestrconsts.lisuesearching
|
||
msgid "Searching: %s"
|
||
msgstr "Шукаю: %s"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
||
msgid "Continue search from the beginning?"
|
||
msgstr "Продовжити пошук з початку?"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
||
msgid "Continue search from the end?"
|
||
msgstr "Продовжити пошук з кінця?"
|
||
|
||
#: lazarusidestrconsts.lisuesearchstringnotfound
|
||
msgid "Search string '%s' not found!"
|
||
msgstr "Рядок пошуку '%s' не знайдено!"
|
||
|
||
#: lazarusidestrconsts.lisuethecurre
|
||
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
||
msgstr "Поточний шрифт редактора не підтримує UTF-8, але ваша система схоже ним користується.%sЦе означає, що не-ASCII символи, ймовірно, будуть показані неправильно.%sВи можете вибрати інший шрифт у параметрах редактора."
|
||
|
||
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
||
msgid "Clear include cache"
|
||
msgstr "Очистити кеш включень (includes)"
|
||
|
||
#: lazarusidestrconsts.lisuidbytes
|
||
msgid "%s bytes"
|
||
msgstr "%s байтів"
|
||
|
||
#: lazarusidestrconsts.lisuidincludedby
|
||
msgid "Included by:"
|
||
msgstr "Доданий:"
|
||
|
||
#: lazarusidestrconsts.lisuidinproject
|
||
msgid "In project:"
|
||
msgstr "У проекті:"
|
||
|
||
#: lazarusidestrconsts.lisuidlines
|
||
msgctxt "lazarusidestrconsts.lisuidlines"
|
||
msgid "Lines:"
|
||
msgstr "Рядків"
|
||
|
||
#: lazarusidestrconsts.lisuidname
|
||
msgctxt "lazarusidestrconsts.lisuidname"
|
||
msgid "Name:"
|
||
msgstr "Назва:"
|
||
|
||
#: lazarusidestrconsts.lisuidno
|
||
msgid "no"
|
||
msgstr "ні"
|
||
|
||
#: lazarusidestrconsts.lisuidsize
|
||
msgid "Size:"
|
||
msgstr "Розмір"
|
||
|
||
#: lazarusidestrconsts.lisuidtype
|
||
msgid "Type:"
|
||
msgstr "Тип:"
|
||
|
||
#: lazarusidestrconsts.lisuidyes
|
||
msgid "yes"
|
||
msgstr "так"
|
||
|
||
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
||
msgid "Show CodeTools Values"
|
||
msgstr "Значення CodeTools"
|
||
|
||
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
||
msgid "Unable convert binary stream to text"
|
||
msgstr "Неможливо перетворити бінарний потік на текст"
|
||
|
||
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
||
msgid "Unable copy components to clipboard"
|
||
msgstr "Неможливо скопіювати компоненти до буфера"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
||
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
||
msgstr "Неможливо додати коментар заголовка ресурсу до файлу ресурсу %s\"%s\".%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
||
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
||
msgstr "Неможливо додати ресурс T%s:FORMDATA до файлу ресурсів %s\"%s\".%sМожливо, помилка синтаксису."
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
||
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
||
msgstr "Не вдається додати залежність %s, бо пакунок %s уже має залежність %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
||
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
||
msgstr "Не вдається додати залежність %s, бо це створить кругову звлежність. Залежність %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
||
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
||
msgstr "Неможливо додати %s до проекту, тому що в проекті вже є модуль з такою самою назвою."
|
||
|
||
#: lazarusidestrconsts.lisunabletobackupfileto
|
||
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
||
msgstr "Неможливо зберегти резервний файл \"%s\" як \"%s\"!"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeclassofto
|
||
msgid "%s%sUnable to change class of %s to %s"
|
||
msgstr "%s%sНеможливо змінити клас %s на %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
||
msgid "Unable to change project scaled in source.%s%s"
|
||
msgstr "Неможливо змінити властивість Scaled проекту в сирцевому коді.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
||
msgid "Unable to change project title in source.%s%s"
|
||
msgstr "Неможливо змінити заголовок проекту у джерелі.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
||
msgid "Unable to clean up destination directory"
|
||
msgstr "Неможливо очистити теку призначення"
|
||
|
||
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
||
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
||
msgstr "Неможливо очистити \"%s\".%sПеревірте доступ."
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
||
msgid "Unable to convert component text into binary format:%s%s"
|
||
msgstr "Неможливо перетворити компонент з текстового на бінарний формат:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
||
msgid "Unable to convert file \"%s\"%sError: %s"
|
||
msgstr "Неможливо перетворити файл \"%s\"%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
||
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
||
msgstr "Неможливо перетворити текстові дані форми файлу %s\"%s\"%sна двійковий потік. (%s)"
|
||
|
||
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
||
msgid "Unable to convert to encoding \"%s\""
|
||
msgstr "Неможливо конвертувати у кодування \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfile
|
||
msgid "Unable to copy file"
|
||
msgstr "Неможливо скопіювати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletocopyfileto
|
||
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
||
msgstr "Неможливо скопіювати файл \"%s\"%sу \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
||
msgid "Unable to create backup directory \"%s\"."
|
||
msgstr "Неможливо створити резервну теку \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatedirectory
|
||
msgid "Unable to create directory \"%s\"."
|
||
msgstr "Неможливо створити теку \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile
|
||
msgid "Unable to create file"
|
||
msgstr "Неможливо створити файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile2
|
||
msgid "Unable to create file \"%s\""
|
||
msgstr "Неможливо створити файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatefile3
|
||
msgid "Unable to create file%s\"%s\""
|
||
msgstr "Неможливо створити файл%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
||
msgid "Unable to create link \"%s\" with target \"%s\""
|
||
msgstr "Неможливо створити посилання \"%s\" з ціллю \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
||
msgid "Unable to create new file, because there is already a directory with this name."
|
||
msgstr "Неможливо створити новий файл, бо вже існує тека з такою назвою."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
||
msgid "Unable to create new method."
|
||
msgstr "Неможливо створити новий метод."
|
||
|
||
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
||
msgid "Unable to create temporary lfm buffer."
|
||
msgstr "Неможливо створити тимчасовий lfm буфер"
|
||
|
||
#: lazarusidestrconsts.lisunabletodelete
|
||
msgid "Unable to delete"
|
||
msgstr "Неможливо видалити"
|
||
|
||
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
||
msgid "Unable to delete ambiguous file \"%s\""
|
||
msgstr "Неможливо видалити двозначний файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletoexecute
|
||
msgid "unable to execute: %s"
|
||
msgstr "неможливо виконати: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
||
msgid "Unable to find a ResourceString section in this or any of the used units."
|
||
msgstr "Неможливо знайти секцію ResourceString в цьому чи будь-якому з використовуваних модулів."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
||
msgid "Unable to find a valid classname in \"%s\""
|
||
msgstr "Неможливо знайти правильну назву класу в \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfile
|
||
msgid "Unable to find file \"%s\"."
|
||
msgstr "Неможливо знайти файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
||
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
||
msgstr "Неможливо знайти файл \"%s\".%sЯкщо він належить до вашого проекту, перевірте шлях пошуку в%sПроект -> Параметри компілятора -> Шляхи пошуку -> Інші файли модулів. Якщо файл належить пакунку, перевірте відповідні опції компілятора пакунків. Якщо цей файл відноситься до Lazarus, переконайтесь що компілюєте начисто. Якщо файл належить FPC тоді перевірте fpc.cfg. Якщо не впевнені, перевірте Проект -> Параметри компілятора -> Текст"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
||
msgid "Unable to find %s in LFM Stream."
|
||
msgstr "Неможливо знайти %s у потоці LFM"
|
||
|
||
#: lazarusidestrconsts.lisunabletofindmethod
|
||
msgid "Unable to find method."
|
||
msgstr "Неможливо знайти метод."
|
||
|
||
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
||
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
||
msgstr "Неможливо знайти модуль Pascal (.pas,.pp) для .lfm файлу%s\"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
||
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
||
msgstr "Неможливо знайти клас компонента \"%s\".%sВін не зареєстрований за допомогою RegisterClass, а відповідний файл LFM відсутній.%sПотрібен для модуля:%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
||
msgid "Unable to gather editor changes."
|
||
msgstr "Неможливо зібрати зміни редактора"
|
||
|
||
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
||
msgid "Unable to get source for designer."
|
||
msgstr "Неможливо знайти код для дизайнера"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadfile2
|
||
msgid "unable to load file %s: %s"
|
||
msgstr "не можу завантажити файл %s: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadpackage
|
||
msgid "Unable to load package \"%s\""
|
||
msgstr "Неможливо завантажити пакунок \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
||
msgid "Unable to load the component class \"%s\", because it depends on itself."
|
||
msgstr "Неможливо завантажити клас компонента \"%s\" через те, що він залежить сам від себе. "
|
||
|
||
#: lazarusidestrconsts.lisunabletoopen
|
||
msgid "Unable to open \"%s\""
|
||
msgstr "Неможливо відкрити \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
||
msgid "Unable to open ancestor component"
|
||
msgstr "Не вдалося відкрити компонент предок"
|
||
|
||
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
||
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
||
msgstr "Неможливо відкрити дизайнер.%sКлас %s не походить від придатного для розробки класу на кшталт TForm або TDataModule."
|
||
|
||
#: lazarusidestrconsts.lisunabletoread
|
||
msgid "Unable to read %s"
|
||
msgstr "Неможливо прочитати %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile
|
||
msgid "Unable to read file"
|
||
msgstr "Неможливо прочитати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfile2
|
||
msgid "Unable to read file \"%s\"."
|
||
msgstr "Неможливо прочитати файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadfileerror
|
||
msgid "Unable to read file \"%s\"%sError: %s"
|
||
msgstr "Неможливо прочитати файл \"%s\"%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadlpi
|
||
msgid "Unable to read lpi"
|
||
msgstr "Неможливо прочитати lpi"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
||
msgid "unable to read process ExitStatus"
|
||
msgstr "неможливо прочитати код завершення процесу"
|
||
|
||
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
||
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
|
||
msgid "Unable to read the project info file%s\"%s\"."
|
||
msgstr "Неможливо прочитати файл інформації проекту%s\"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
||
msgid "Unable to remove old backup file \"%s\"!"
|
||
msgstr "Неможливо стерти старий резервний файл \"%s\"!"
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
||
msgid "Unable to remove project scaled from source.%s%s"
|
||
msgstr "Неможливо змінити властивість Scaled проекту з сирцевого коду.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
||
msgid "Unable to remove project title from source.%s%s"
|
||
msgstr "Неможливо видалити заголовок проекту з джерела.%s%s"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
||
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
||
msgstr "Неможливо змінити назву двозначного файлу \"%s\"%sна \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefile
|
||
msgid "Unable to rename file"
|
||
msgstr "Неможливо змінити назву файла"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto
|
||
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
||
msgstr "Неможливо змінити назву файлу \"%s\" на \"%s\"!"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamefileto2
|
||
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
||
msgstr "Неможливо перейменувати файл \"%s\"%sна \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenameforminsource
|
||
msgid "Unable to rename form in source."
|
||
msgstr "Неможливо змінити назву форми в коді"
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
||
msgid "Unable to rename method. Please fix the error shown in the message window."
|
||
msgstr "Неможливо змінити назву метода. Виправте помилку. Див. вікно повідомлень."
|
||
|
||
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
||
msgid "Unable to rename variable in source."
|
||
msgstr "Неможливо змінити назву змінної в коді."
|
||
|
||
#: lazarusidestrconsts.lisunabletorun
|
||
msgid "Unable to run"
|
||
msgstr "Неможливо запустити"
|
||
|
||
#: lazarusidestrconsts.lisunabletorun2
|
||
msgid "Unable to run \"%s\""
|
||
msgstr "Неможливо запустити \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
||
msgid "Unable to set AnchorSide Control"
|
||
msgstr "Неможливо встановити AnchorSide Control"
|
||
|
||
#: lazarusidestrconsts.lisunabletoshowmethod
|
||
msgid "Unable to show method."
|
||
msgstr "Неможливо відобразити метод."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
||
msgid "Unable to stream selected components"
|
||
msgstr "Неможливо вивести вибрані компоненти у потік"
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
||
msgid "Unable to stream selected components."
|
||
msgstr "Неможливо вивести вибрані компоненти у потік."
|
||
|
||
#: lazarusidestrconsts.lisunabletostreamt
|
||
msgid "Unable to stream %s:T%s."
|
||
msgstr "Неможливо вивести у потік %s:T%s."
|
||
|
||
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
||
msgid "Unable to transform binary component stream of %s:T%s into text."
|
||
msgstr "Неможливо перетворити потік двійкових компонентів %s:T%s на текст."
|
||
|
||
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
||
msgid "Unable to update CreateForm statement in project source"
|
||
msgstr "Неможливо оновити вираз CreateForm в коді проекту"
|
||
|
||
#: lazarusidestrconsts.lisunabletowrite2
|
||
msgid "Unable to write \"%s\""
|
||
msgstr "Неможливо записати \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile
|
||
msgid "Unable to write file"
|
||
msgstr "Неможливо записати файл"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefile2
|
||
msgid "Unable to write file \"%s\"."
|
||
msgstr "Неможливо записати файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritefileerror
|
||
msgid "Unable to write file \"%s\"%sError: %s"
|
||
msgstr "Неможливо записати файл \"%s\"%sError: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
||
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
||
msgstr "Неможливо записати файл інформації проекту%s\"%s\".%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
||
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
||
msgstr "Неможливо записати файл сеансу проекту%s\"%s\".%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisunabletowritetofile2
|
||
msgid "Unable to write to file \"%s\"."
|
||
msgstr "Неможливо записати у файл \"%s\"."
|
||
|
||
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
||
msgid "Unable to write xml stream to %s%sError: %s"
|
||
msgstr "Неможливо записати xml-потік до %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisuncheckall
|
||
msgid "Uncheck All"
|
||
msgstr "Зняти мітки з усіх"
|
||
|
||
#: lazarusidestrconsts.lisundo
|
||
msgctxt "lazarusidestrconsts.lisundo"
|
||
msgid "Undo"
|
||
msgstr "Скасувати"
|
||
|
||
#: lazarusidestrconsts.lisuninstall
|
||
msgid "Uninstall %s"
|
||
msgstr "Деінсталювати %s"
|
||
|
||
#: lazarusidestrconsts.lisuninstallimpossible
|
||
msgid "Uninstall impossible"
|
||
msgstr "Деінсталювання неможливе"
|
||
|
||
#: lazarusidestrconsts.lisuninstallselection
|
||
msgid "Uninstall selection"
|
||
msgstr "Видалити вибране"
|
||
|
||
#: lazarusidestrconsts.lisunit
|
||
msgctxt "lazarusidestrconsts.lisunit"
|
||
msgid "Unit"
|
||
msgstr "Модуль"
|
||
|
||
#: lazarusidestrconsts.lisunithaschangedsave
|
||
msgid "Unit \"%s\" has changed. Save?"
|
||
msgstr "Модуль \"%s\" змінено. Зберегти?"
|
||
|
||
#: lazarusidestrconsts.lisunitidentifierexists
|
||
msgid "Unit identifier exists"
|
||
msgstr "Ідентифікатор модуля існує"
|
||
|
||
#: lazarusidestrconsts.lisunitinpackage
|
||
msgid "%s unit %s in package %s"
|
||
msgstr "%s модуль %s у пакунку %s"
|
||
|
||
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
||
msgid "Unitname already in project"
|
||
msgstr "Модуль з такою назвою вже є в проекті"
|
||
|
||
#: lazarusidestrconsts.lisunitnamebeginswith
|
||
msgid "Unit name begins with ..."
|
||
msgstr "Назва модуля починається з ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnamecontains
|
||
msgid "Unit name contains ..."
|
||
msgstr "Назва модуля включає ..."
|
||
|
||
#: lazarusidestrconsts.lisunitnotfound
|
||
msgid "unit %s not found"
|
||
msgstr "модуль %s не знайдено"
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
||
msgid "unit %s not found at new position \"%s\""
|
||
msgstr "модуль %s не знайдено у новому розташуванні \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisunitnotfoundinproject
|
||
msgid "A unit not found in project %s"
|
||
msgstr "Модуль не знайдено в проекті %s"
|
||
|
||
#: lazarusidestrconsts.lisunitoutputdirectory
|
||
msgid "Unit Output directory"
|
||
msgstr "Тека для генерації модулів"
|
||
|
||
#: lazarusidestrconsts.lisunitpath
|
||
msgid "unit path"
|
||
msgstr "шлях до модуля"
|
||
|
||
#: lazarusidestrconsts.lisunitpaths
|
||
msgid "Unit paths"
|
||
msgstr "Шляхи до модулів"
|
||
|
||
#: lazarusidestrconsts.lisunitrequirespackage
|
||
msgid "unit %s requires package %s"
|
||
msgstr "модуль %s потребує пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
||
msgid "Units not found in project %s"
|
||
msgstr "Модулі не знайдено в проекті %s"
|
||
|
||
#: lazarusidestrconsts.lisunsigned
|
||
msgid "Unsigned"
|
||
msgstr "Непідписаний"
|
||
|
||
#: lazarusidestrconsts.lisunusedunitsof
|
||
msgid "Unused units of %s"
|
||
msgstr "Невикористані модулі в %s"
|
||
|
||
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
||
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
||
msgstr "Незвичайна назва компілятора. Зазвичай вона починається на fpc, ppc чи ppcross."
|
||
|
||
#: lazarusidestrconsts.lisup
|
||
msgctxt "lazarusidestrconsts.lisup"
|
||
msgid "Up"
|
||
msgstr "Вверх"
|
||
|
||
#: lazarusidestrconsts.lisupdateinfo
|
||
msgid "Update info"
|
||
msgstr "Оновити дані"
|
||
|
||
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
||
msgid "Update other procedure signatures when only letter case has changed"
|
||
msgstr "Оновлювати решту сигнатур процедур навіть при зміненні регістру"
|
||
|
||
#: lazarusidestrconsts.lisupdatereferences
|
||
msgid "Update references?"
|
||
msgstr "Оновити залежності?"
|
||
|
||
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
||
msgid "Updating PO files failed for package %s"
|
||
msgstr "Не вдалось оновити файли PO для пакунка %s"
|
||
|
||
#: lazarusidestrconsts.lisupgrade
|
||
msgid "Upgrade"
|
||
msgstr "Модернізація"
|
||
|
||
#: lazarusidestrconsts.lisupgradeconfiguration
|
||
msgid "Upgrade configuration"
|
||
msgstr "Параметри модернізації"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestring
|
||
msgid "uppercase string"
|
||
msgstr "рядок в верхньому регістрі"
|
||
|
||
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
||
msgid "Uppercase string given as parameter."
|
||
msgstr "Рядок у верхньому регістрі, поданий як параметр"
|
||
|
||
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
||
msgid "URL on wiki (the base url is %s)"
|
||
msgstr "Адреса сторінки Wiki (базова - %s)"
|
||
|
||
#: lazarusidestrconsts.lisusagemessagehoption
|
||
msgid "Usage message (-h option)"
|
||
msgstr "Повідомлення використання (опція -h)"
|
||
|
||
#: lazarusidestrconsts.lisuse
|
||
msgid "Use"
|
||
msgstr "Використати"
|
||
|
||
#: lazarusidestrconsts.lisuseansistrings
|
||
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
||
msgid "Use Ansistrings"
|
||
msgstr "Використовувати рядки ansistring"
|
||
|
||
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
||
msgid "Use CheckBox for Boolean values"
|
||
msgstr "Використовувати прапорці для логічних значень"
|
||
|
||
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
||
msgid "Use comments in custom options"
|
||
msgstr "Використовувати коментарі у параметрах користувача"
|
||
|
||
#: lazarusidestrconsts.lisusedby
|
||
msgid " used by %s"
|
||
msgstr " використано %s"
|
||
|
||
#: lazarusidestrconsts.lisusedesigntimepackages
|
||
msgid "Use design time packages"
|
||
msgstr "Викор. пакунки часу розробки"
|
||
|
||
#: lazarusidestrconsts.lisusedforautocreatedforms
|
||
msgid "Used for auto-created forms."
|
||
msgstr "Використано для автоматично створених форм."
|
||
|
||
#: lazarusidestrconsts.lisuseexcludefilter
|
||
msgid "Use exclude filter"
|
||
msgstr "Використовувати фільтр виключень"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifier
|
||
msgid "Use identifier"
|
||
msgstr "Використати ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.lisuseidentifierinat
|
||
msgid "Use identifier %s in %s at %s"
|
||
msgstr "Використати ідентифікатор %s в %s на %s"
|
||
|
||
#: lazarusidestrconsts.lisuseincludefilter
|
||
msgid "Use include filter"
|
||
msgstr "Використовувати фільтр включень"
|
||
|
||
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
||
msgid "Launching application"
|
||
msgstr "Запуск програми"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage
|
||
msgid "Use package %s in package %s"
|
||
msgstr "Використати пакунок %s в пакунку %s"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinpackage2
|
||
msgid "Use package in package"
|
||
msgstr "Використати пакунок у пакунку"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject
|
||
msgid "Use package %s in project"
|
||
msgstr "Використати пакунок %s в проекті"
|
||
|
||
#: lazarusidestrconsts.lisusepackageinproject2
|
||
msgid "Use package in project"
|
||
msgstr "Використати пакунок в проекті"
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
||
msgid "Add to list \"%s\""
|
||
msgstr "Додати до спсику \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
||
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
||
msgid "User defined text markup"
|
||
msgstr "Користувацька розмітка тексту"
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
||
msgid "Remove from list \"%s\""
|
||
msgstr "Вилучити зі списку \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
||
msgid "Toggle on list \"%s\""
|
||
msgstr "Перемкнути у списку \"%s\""
|
||
|
||
#: lazarusidestrconsts.lisusershomedirectory
|
||
msgid "User's home directory"
|
||
msgstr "Домашня тека користувача"
|
||
|
||
#: lazarusidestrconsts.lisuseunit
|
||
msgctxt "lazarusidestrconsts.lisuseunit"
|
||
msgid "Add Unit to Uses Section"
|
||
msgstr "Додати Unit до секції Uses"
|
||
|
||
#: lazarusidestrconsts.lisuseunitinunit
|
||
msgid "Use unit %s in unit %s"
|
||
msgstr "Викор. модуль %s в модулі %s"
|
||
|
||
#: lazarusidestrconsts.lisutf8withbom
|
||
msgid "UTF-8 with BOM"
|
||
msgstr "UTF-8 з BOM"
|
||
|
||
#: lazarusidestrconsts.lisvalue
|
||
msgctxt "lazarusidestrconsts.lisvalue"
|
||
msgid "Value"
|
||
msgstr "Змінна"
|
||
|
||
#: lazarusidestrconsts.lisvalue2
|
||
msgid "Value%s"
|
||
msgstr "Змінна%s"
|
||
|
||
#: lazarusidestrconsts.lisvalue3
|
||
msgid "Value: "
|
||
msgstr "Змінна: "
|
||
|
||
#: lazarusidestrconsts.lisvalues
|
||
msgid "Values"
|
||
msgstr "Змінні"
|
||
|
||
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
||
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
||
msgstr "Значення властивостей, відмінні від типових, зберігаються у файлі .lfm і виділяються в інспекторі об'єктів"
|
||
|
||
#: lazarusidestrconsts.lisvariable
|
||
msgctxt "lazarusidestrconsts.lisvariable"
|
||
msgid "Variable"
|
||
msgstr "Змінна"
|
||
|
||
#: lazarusidestrconsts.lisverbose
|
||
msgctxt "lazarusidestrconsts.lisverbose"
|
||
msgid "Verbose"
|
||
msgstr "Детально"
|
||
|
||
#: lazarusidestrconsts.lisverifymethodcalls
|
||
msgid "Verify method calls"
|
||
msgstr "Виклики перевірки методу"
|
||
|
||
#: lazarusidestrconsts.lisversion
|
||
msgid "Version"
|
||
msgstr "Версія"
|
||
|
||
#: lazarusidestrconsts.lisversionmismatch
|
||
msgid "Version mismatch"
|
||
msgstr "Помилкова версія"
|
||
|
||
#: lazarusidestrconsts.lisvertical
|
||
msgid "Vertical"
|
||
msgstr "Вертикально"
|
||
|
||
#: lazarusidestrconsts.lisvertoclipboard
|
||
msgid "Copy version information to clipboard"
|
||
msgstr "Копіювати дані про версію в буфер"
|
||
|
||
#: lazarusidestrconsts.lisveryverbose
|
||
msgid "Very Verbose"
|
||
msgstr "Дуже детально"
|
||
|
||
#: lazarusidestrconsts.lisviewbreakpointproperties
|
||
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
||
msgid "Breakpoint Properties ..."
|
||
msgstr "Властивості Точки Зупинки ..."
|
||
|
||
#: lazarusidestrconsts.lisviewsource
|
||
msgid "View Source"
|
||
msgstr "Дивитись джерело"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcedisass
|
||
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
||
msgid "View Assembler"
|
||
msgstr "Перемкнути вигляд Асемблер"
|
||
|
||
#: lazarusidestrconsts.lisviewsourcelfm
|
||
msgid "View Source (.lfm)"
|
||
msgstr "Переглянути код (.lfm)"
|
||
|
||
#: lazarusidestrconsts.liswarning
|
||
msgid "Warning: "
|
||
msgstr "Попередження: "
|
||
|
||
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
||
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
|
||
msgstr "Попередження: знайдено двозначний файл \"%s\". Сирцевий файл: \"%s\""
|
||
|
||
#: lazarusidestrconsts.liswarnings
|
||
msgid ", Warnings: %s"
|
||
msgstr ", попереджень: %s"
|
||
|
||
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
||
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
||
msgstr "%sУвага: Це основний модуль. Новий основний модуль буде %s.pas."
|
||
|
||
#: lazarusidestrconsts.liswatch
|
||
msgid "&Watch"
|
||
msgstr "&Спостерігати"
|
||
|
||
#: lazarusidestrconsts.liswatchdata
|
||
msgid "Watch:"
|
||
msgstr "Огляд:"
|
||
|
||
#: lazarusidestrconsts.liswatchkind
|
||
msgid "Watch action"
|
||
msgstr "Дія огляду"
|
||
|
||
#: lazarusidestrconsts.liswatchkindread
|
||
msgid "Read"
|
||
msgstr "Читання"
|
||
|
||
#: lazarusidestrconsts.liswatchkindreadwrite
|
||
msgid "Read/Write"
|
||
msgstr "Читання/Запис"
|
||
|
||
#: lazarusidestrconsts.liswatchkindwrite
|
||
msgid "Write"
|
||
msgstr "Запис"
|
||
|
||
#: lazarusidestrconsts.liswatchpoint
|
||
msgid "&Data/Watch Breakpoint ..."
|
||
msgstr "Точка зупинки &даних/огляду ..."
|
||
|
||
#: lazarusidestrconsts.liswatchpointbreakpoint
|
||
msgid "&Data/watch Breakpoint ..."
|
||
msgstr "Точка зупинки &даних/огляду ..."
|
||
|
||
#: lazarusidestrconsts.liswatchpropert
|
||
msgid "Watch Properties"
|
||
msgstr "Властивості Спостерігання"
|
||
|
||
#: lazarusidestrconsts.liswatchscope
|
||
msgid "Watch scope"
|
||
msgstr "Межі огляду"
|
||
|
||
#: lazarusidestrconsts.liswatchscopeglobal
|
||
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
||
msgid "Global"
|
||
msgstr "Глобально"
|
||
|
||
#: lazarusidestrconsts.liswatchscopelocal
|
||
msgid "Declaration"
|
||
msgstr "Оголошення"
|
||
|
||
#: lazarusidestrconsts.liswatchtowatchpoint
|
||
msgid "Create &Data/Watch Breakpoint ..."
|
||
msgstr "Створити точку зупинки &даних/огляду ..."
|
||
|
||
#: lazarusidestrconsts.liswelcometolazaruside
|
||
msgid "Welcome to Lazarus IDE %s"
|
||
msgstr "Вітаємо в ІСР Lazarus %s"
|
||
|
||
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
||
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
||
msgstr "Вітаємо у Lazarus %s%sВже існує конфігурація з версії %s у%s%s"
|
||
|
||
#: lazarusidestrconsts.liswhatneedsbuilding
|
||
msgid "What needs building"
|
||
msgstr "Що потребує збирання"
|
||
|
||
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
||
msgid "When a unit is renamed, update references"
|
||
msgstr "Коли модуль перейменований оновити залежності"
|
||
|
||
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
||
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
||
msgstr "Якщо ввімкнено поточні налаштування зберігаються в шаблон, який використовується при створенні нових проектів"
|
||
|
||
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
||
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
||
msgstr "Якщо є лише один варіант завершення, застосовувати його негайно, не показуючи вікна автозавершенняЯкщо є лише один варіант завершення, застосовувати його негайно, не показуючи вікна автозавершення"
|
||
|
||
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
||
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
||
msgstr "Коли рухається курсор редактора коду, показати поточний вузол в оглядачі коду"
|
||
|
||
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
||
msgid "Window menu shows designed form's name instead of caption"
|
||
msgstr "Меню вікна показує назву форми замість заголовка"
|
||
|
||
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
||
msgid "Useful especially if the caption is left empty."
|
||
msgstr "Корисно, якщо заголовок залишено порожнім."
|
||
|
||
#: lazarusidestrconsts.liswindowstaysontop
|
||
msgid "Window stays on top"
|
||
msgstr "Вікно залишається попереду всіх"
|
||
|
||
#: lazarusidestrconsts.liswithincludes2
|
||
msgid ", with includes "
|
||
msgstr ", з включеннями "
|
||
|
||
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
||
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
||
msgstr "Без належного компілятора перегляд і компілювання коду буде невтішним."
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
||
msgid "Without a proper debugger, debugging will be disappointing."
|
||
msgstr "Без правильного зневаджувача зневадження не матиме успіху."
|
||
|
||
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
||
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
||
msgstr "Без правильної теки Lazarus ви отримаєте багато попереджень."
|
||
|
||
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
||
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
||
msgstr "Збирання ІСР неможливе без вказання коректного виконуваного файлу \"make\"."
|
||
|
||
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
||
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
||
msgstr "Без належного початковогокоду FPC перегляд і завершення буде дуже обмеженим."
|
||
|
||
#: lazarusidestrconsts.liswithrequiredpackages
|
||
msgid "With required packages"
|
||
msgstr "З необхідними пакунками"
|
||
|
||
#: lazarusidestrconsts.liswldeleteall
|
||
msgid "De&lete All"
|
||
msgstr "Ви&далити Всі"
|
||
|
||
#: lazarusidestrconsts.liswldisableall
|
||
msgid "D&isable All"
|
||
msgstr "Н&едоступні Всі"
|
||
|
||
#: lazarusidestrconsts.liswlenableall
|
||
msgid "E&nable All"
|
||
msgstr "В&вімкнути Все"
|
||
|
||
#: lazarusidestrconsts.liswlexpression
|
||
msgid "Expression"
|
||
msgstr "Вираз"
|
||
|
||
#: lazarusidestrconsts.liswlinspectpane
|
||
msgid "Inspect pane"
|
||
msgstr "Панель перегляду"
|
||
|
||
#: lazarusidestrconsts.liswlproperties
|
||
msgid "&Properties"
|
||
msgstr "&Властивості"
|
||
|
||
#: lazarusidestrconsts.liswlwatchlist
|
||
msgid "Watch List"
|
||
msgstr "Список Спостережень"
|
||
|
||
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
||
msgid "Word at cursor in current editor"
|
||
msgstr "Слово під курсором в цьому редакторі"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
||
msgid "Working directory for building"
|
||
msgstr "Робоча тека для збирання"
|
||
|
||
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
||
msgid "Working directory for run"
|
||
msgstr "Робоча тека для виконання"
|
||
|
||
#: lazarusidestrconsts.liswriteerror
|
||
msgid "Write Error"
|
||
msgstr "Помилка запису"
|
||
|
||
#: lazarusidestrconsts.liswriteerrorfile
|
||
msgid "Write error: %s%sFile: %s%s%s"
|
||
msgstr "Помилка запису: %s%sФайл: %s%s%s"
|
||
|
||
#: lazarusidestrconsts.liswrongversionin
|
||
msgid "wrong version in %s: %s"
|
||
msgstr "неправильна версія в %s: %s"
|
||
|
||
#: lazarusidestrconsts.lisxmlerror
|
||
msgid "XML Error"
|
||
msgstr "Помилка XML"
|
||
|
||
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
||
msgid "XML parser error in file %s%sError: %s"
|
||
msgstr "Помилка розбору XML в файлі %s%sПомилка: %s"
|
||
|
||
#: lazarusidestrconsts.lisyes
|
||
msgid "Yes"
|
||
msgstr "Так"
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
||
msgid "You can disable this for individual forms via the package editor"
|
||
msgstr "Ви можете вимкнути це для окремих форм у редакторі пакунків"
|
||
|
||
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
||
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
||
msgstr "Ви можете вимкнути це для окремих форм в спливаючому меню в інспекторі проектів"
|
||
|
||
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
||
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
||
msgstr "FPC і його сирці можна звантажити з http://sourceforge.net/projects/lazarus/?source=directory"
|
||
|
||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||
msgid "You cannot build Lazarus while debugging or compiling."
|
||
msgstr "Ви не можете перебудувати Lazarus при зневаджуванні або компіляції."
|
||
|
||
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
||
msgid "You can select items by simply pressing underscored letters"
|
||
msgstr "Елементи можна вибрати, просто натискаючи підкреслені літери"
|
||
|
||
#: lazarusidestrconsts.lis_all_
|
||
msgctxt "lazarusidestrconsts.lis_all_"
|
||
msgid "<All>"
|
||
msgstr "<Всі>"
|
||
|
||
#: lazarusidestrconsts.locwndsrceditor
|
||
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
||
msgid "Source Editor"
|
||
msgstr "Редактор тексту"
|
||
|
||
#: lazarusidestrconsts.lrsplddeleteselected
|
||
msgid "Delete selected"
|
||
msgstr "Видалити вибране"
|
||
|
||
#: lazarusidestrconsts.lrspldinvalid
|
||
msgid "invalid"
|
||
msgstr "неправильний"
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
||
msgid "lpk file invalid (%s)"
|
||
msgstr "неправильний файл LPK (%s)"
|
||
|
||
#: lazarusidestrconsts.lrspldlpkfilevalid
|
||
msgid "lpk file valid (%s)"
|
||
msgstr "правильний файл LPK (%s)"
|
||
|
||
#: lazarusidestrconsts.lrspldunabletodeletefile
|
||
msgid "Unable to delete file \"%s\""
|
||
msgstr "Неможливо видалити файл \"%s\""
|
||
|
||
#: lazarusidestrconsts.lrspldvalid
|
||
msgid "valid"
|
||
msgstr "правильний"
|
||
|
||
#: lazarusidestrconsts.lrsrescanlplfiles
|
||
msgid "Rescan lpl files"
|
||
msgstr "Переглянути файли LPL"
|
||
|
||
#: lazarusidestrconsts.podaddpackageunittousessection
|
||
msgid "Add package unit to uses section"
|
||
msgstr "Додати модуль пакунка у секцію uses"
|
||
|
||
#: lazarusidestrconsts.regdlgbinary
|
||
msgctxt "lazarusidestrconsts.regdlgbinary"
|
||
msgid "Binary"
|
||
msgstr "Двійковий"
|
||
|
||
#: lazarusidestrconsts.regdlgdecimal
|
||
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
||
msgid "Decimal"
|
||
msgstr "Десятковий"
|
||
|
||
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
||
msgid "Display type for selected Registers"
|
||
msgstr "Показувати тип вибраних регістрів"
|
||
|
||
#: lazarusidestrconsts.regdlgformat
|
||
msgid "Format"
|
||
msgstr "Формат"
|
||
|
||
#: lazarusidestrconsts.regdlghex
|
||
msgid "Hex"
|
||
msgstr "Шістнадцятковий"
|
||
|
||
#: lazarusidestrconsts.regdlgoctal
|
||
msgid "Octal"
|
||
msgstr "Вісімковий"
|
||
|
||
#: lazarusidestrconsts.regdlgraw
|
||
msgid "Raw"
|
||
msgstr "Сирі дані"
|
||
|
||
#: lazarusidestrconsts.rsaddinverse
|
||
msgid "Add Inverse"
|
||
msgstr "Додати зворотне"
|
||
|
||
#: lazarusidestrconsts.rsattachto
|
||
msgid "Attach to"
|
||
msgstr "Приєднати до"
|
||
|
||
#: lazarusidestrconsts.rsattributes
|
||
msgid "Attributes"
|
||
msgstr "Атрибути"
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
||
msgid "Automatically increase build number"
|
||
msgstr "Автоматично збільшувати номер збірки"
|
||
|
||
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
||
msgid "Increased every time the project is compiled."
|
||
msgstr "Збільшується при кожному компілюванні проекту."
|
||
|
||
#: lazarusidestrconsts.rsbuild
|
||
msgid "&Build:"
|
||
msgstr "Зі&брати:"
|
||
|
||
#: lazarusidestrconsts.rscharacterset
|
||
msgid "Character set:"
|
||
msgstr "Набір символів:"
|
||
|
||
#: lazarusidestrconsts.rsclosecurrentpage
|
||
msgid "Close current page"
|
||
msgstr "Закрити поточну сторінку"
|
||
|
||
#: lazarusidestrconsts.rsconditionaldefines
|
||
msgid "Conditional defines"
|
||
msgstr "Умовні визначення"
|
||
|
||
#: lazarusidestrconsts.rscreatenewdefine
|
||
msgid "Create new define"
|
||
msgstr "Створити нове визначення"
|
||
|
||
#: lazarusidestrconsts.rsenablei18n
|
||
msgid "Enable i18n"
|
||
msgstr "Ввімкнути i18n"
|
||
|
||
#: lazarusidestrconsts.rsenterpid
|
||
msgid "Enter PID"
|
||
msgstr "Введіть ідентифікатор процесу"
|
||
|
||
#: lazarusidestrconsts.rsfilterthelistwithstring
|
||
msgid "Filter the lines in list with a string"
|
||
msgstr "Фільрувати рядки в списку з текстом"
|
||
|
||
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
||
msgid "Found, but not listed here: "
|
||
msgstr "Знайдено, але тут не вказано: "
|
||
|
||
#: lazarusidestrconsts.rsi18nexcluded
|
||
msgid "Excluded"
|
||
msgstr "Виключені"
|
||
|
||
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
|
||
msgid "Force update PO files on next compile"
|
||
msgstr "Примусово оновити файли PO при наступній компіляції"
|
||
|
||
#: lazarusidestrconsts.rsi18nidentifiers
|
||
msgid "Identifiers:"
|
||
msgstr "Ідентифікатори:"
|
||
|
||
#: lazarusidestrconsts.rsi18noptions
|
||
msgid "i18n Options"
|
||
msgstr "Параметри i18n"
|
||
|
||
#: lazarusidestrconsts.rsi18noriginals
|
||
msgid "Originals:"
|
||
msgstr "Початкові рядки:"
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfohint
|
||
msgid "Version info is stored if the executable format supports it."
|
||
msgstr "Дані про версію зберігаються лише за умови, що їх підтримує формат виконуваного файлу."
|
||
|
||
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
||
msgid "Include version info in executable"
|
||
msgstr "Включити версію в виконуваний файл"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
||
msgid "Column Names"
|
||
msgstr "Назви стовпців"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
||
msgid "Strategy for saving Columns"
|
||
msgstr "Стратегія збереження стовпців"
|
||
|
||
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
||
msgid "Column Width"
|
||
msgstr "Ширина стовпців"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomgeometry
|
||
msgid "Custom geometry"
|
||
msgstr "Користувацька геометрія"
|
||
|
||
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
||
msgid "User can define window's position and size"
|
||
msgstr "Користувач може задати положення і розмір вікна"
|
||
|
||
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
||
msgid "Fixed default geometry"
|
||
msgstr "Фіксована типова геометрія"
|
||
|
||
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
||
msgid "Always the same fixed position and size"
|
||
msgstr "Завжди однакові фіксовані положення і розмір"
|
||
|
||
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
||
msgid "Let windowmanager decide"
|
||
msgstr "На розсуд віконного менеджера"
|
||
|
||
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
||
msgid "System windowmanagers have different strategies for positioning windows"
|
||
msgstr "Системні віконні менеджери мають різні стратегії розташування вікон"
|
||
|
||
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
||
msgid "Windows that have been open. They may be closed now."
|
||
msgstr "Вікна, що відкривались. Зараз їх можна закрити."
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
||
msgid "Restore window geometry"
|
||
msgstr "Відновити геометрію вікна"
|
||
|
||
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
||
msgid "Use previous position and size"
|
||
msgstr "Використати попередні положення і розмір"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
||
msgid "Custom Size"
|
||
msgstr "Власний розмір"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterdefault
|
||
msgid "Default Size"
|
||
msgstr "Типовий розмір"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
||
msgid "Restore with window"
|
||
msgstr "Відновити з вікном"
|
||
|
||
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
||
msgid "Restore Size"
|
||
msgstr "Відновити розмір"
|
||
|
||
#: lazarusidestrconsts.rslanguageafrikaans
|
||
msgid "Afrikaans"
|
||
msgstr "Африкаанс"
|
||
|
||
#: lazarusidestrconsts.rslanguagearabic
|
||
msgid "Arabic"
|
||
msgstr "Арабська"
|
||
|
||
#: lazarusidestrconsts.rslanguageautomatic
|
||
msgid "Automatic (or English)"
|
||
msgstr "Автоматично (або англійською)"
|
||
|
||
#: lazarusidestrconsts.rslanguagecatalan
|
||
msgid "Catalan"
|
||
msgstr "Каталонська"
|
||
|
||
#: lazarusidestrconsts.rslanguagechinese
|
||
msgid "Chinese"
|
||
msgstr "Китайська"
|
||
|
||
#: lazarusidestrconsts.rslanguageczech
|
||
msgid "Czech"
|
||
msgstr "Чеська"
|
||
|
||
#: lazarusidestrconsts.rslanguagedutch
|
||
msgid "Dutch"
|
||
msgstr "Голландська"
|
||
|
||
#: lazarusidestrconsts.rslanguageenglish
|
||
msgid "English"
|
||
msgstr "Англійська"
|
||
|
||
#: lazarusidestrconsts.rslanguagefinnish
|
||
msgid "Finnish"
|
||
msgstr "Фінська"
|
||
|
||
#: lazarusidestrconsts.rslanguagefrench
|
||
msgid "French"
|
||
msgstr "Французька"
|
||
|
||
#: lazarusidestrconsts.rslanguagegerman
|
||
msgid "German"
|
||
msgstr "Німецька"
|
||
|
||
#: lazarusidestrconsts.rslanguagehebrew
|
||
msgid "Hebrew"
|
||
msgstr "Іврит"
|
||
|
||
#: lazarusidestrconsts.rslanguagehungarian
|
||
msgid "Hungarian"
|
||
msgstr "Угорська"
|
||
|
||
#: lazarusidestrconsts.rslanguageindonesian
|
||
msgid "Indonesian"
|
||
msgstr "Індонезійська"
|
||
|
||
#: lazarusidestrconsts.rslanguageitalian
|
||
msgid "Italian"
|
||
msgstr "Італійська"
|
||
|
||
#: lazarusidestrconsts.rslanguagejapanese
|
||
msgid "Japanese"
|
||
msgstr "Японська"
|
||
|
||
#: lazarusidestrconsts.rslanguagelithuanian
|
||
msgid "Lithuanian"
|
||
msgstr "Литовська"
|
||
|
||
#: lazarusidestrconsts.rslanguageoptions
|
||
msgid "Language options"
|
||
msgstr "Мовні параметри"
|
||
|
||
#: lazarusidestrconsts.rslanguagepolish
|
||
msgid "Polish"
|
||
msgstr "Польська"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguese
|
||
msgid "Portuguese"
|
||
msgstr "Португальська"
|
||
|
||
#: lazarusidestrconsts.rslanguageportuguesebr
|
||
msgid "Brazilian Portuguese"
|
||
msgstr "Бразильська португальська"
|
||
|
||
#: lazarusidestrconsts.rslanguagerussian
|
||
msgid "Russian"
|
||
msgstr "Російська"
|
||
|
||
#: lazarusidestrconsts.rslanguageselection
|
||
msgid "Language selection:"
|
||
msgstr "Вибір мови:"
|
||
|
||
#: lazarusidestrconsts.rslanguageslovak
|
||
msgid "Slovak"
|
||
msgstr "Словацька"
|
||
|
||
#: lazarusidestrconsts.rslanguagespanish
|
||
msgid "Spanish"
|
||
msgstr "Іспанська"
|
||
|
||
#: lazarusidestrconsts.rslanguageturkish
|
||
msgid "Turkish"
|
||
msgstr "Турецька"
|
||
|
||
#: lazarusidestrconsts.rslanguageukrainian
|
||
msgid "Ukrainian"
|
||
msgstr "Українська"
|
||
|
||
#: lazarusidestrconsts.rsmajorversion
|
||
msgid "&Major version:"
|
||
msgstr "&Основна версія:"
|
||
|
||
#: lazarusidestrconsts.rsminorversion
|
||
msgid "Mi&nor version:"
|
||
msgstr "&Другорядна версія:"
|
||
|
||
#: lazarusidestrconsts.rsotherinfo
|
||
msgid "Other info"
|
||
msgstr "Інша Інформація"
|
||
|
||
#: lazarusidestrconsts.rspooutputdirectory
|
||
msgid "PO Output Directory:"
|
||
msgstr "Результуюча тека PO:"
|
||
|
||
#: lazarusidestrconsts.rsresource
|
||
msgid "Resource"
|
||
msgstr "Ресурс"
|
||
|
||
#: lazarusidestrconsts.rsresourceclear
|
||
msgid "Delete all resources?"
|
||
msgstr "Вилучити всі ресурси?"
|
||
|
||
#: lazarusidestrconsts.rsresourcefilename
|
||
msgid "File name"
|
||
msgstr "Назва файлу"
|
||
|
||
#: lazarusidestrconsts.rsresourcetype
|
||
msgctxt "lazarusidestrconsts.rsresourcetype"
|
||
msgid "Type"
|
||
msgstr "Тип"
|
||
|
||
#: lazarusidestrconsts.rsrevision
|
||
msgid "&Revision:"
|
||
msgstr "&Ревізія:"
|
||
|
||
#: lazarusidestrconsts.rsselectaninheritedentry
|
||
msgid "Select an inherited entry"
|
||
msgstr "Виберіть успадкований елемент"
|
||
|
||
#: lazarusidestrconsts.rsstartanewsearch
|
||
msgid "Start a new search"
|
||
msgstr "Почати новий пошук"
|
||
|
||
#: lazarusidestrconsts.rsversionnumbering
|
||
msgid "Version numbering"
|
||
msgstr "Нумерація версій"
|
||
|
||
#: lazarusidestrconsts.srkmcarhelpmenu
|
||
msgid "Help menu commands"
|
||
msgstr "Команди меню Довідка"
|
||
|
||
#: lazarusidestrconsts.srkmcatcmdcmd
|
||
msgid "Command commands"
|
||
msgstr "Команда команди"
|
||
|
||
#: lazarusidestrconsts.srkmcatcodetools
|
||
msgid "CodeTools commands"
|
||
msgstr "Команди інструментів коду"
|
||
|
||
#: lazarusidestrconsts.srkmcatcolselection
|
||
msgid "Text column selection commands"
|
||
msgstr "Команди вибирання стовпців тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatcursormoving
|
||
msgid "Cursor moving commands"
|
||
msgstr "Команди переміщення курсора"
|
||
|
||
#: lazarusidestrconsts.srkmcatediting
|
||
msgid "Text editing commands"
|
||
msgstr "Команди редагування тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatfilemenu
|
||
msgid "File menu commands"
|
||
msgstr "Команди файлового меню"
|
||
|
||
#: lazarusidestrconsts.srkmcatfold
|
||
msgid "Text folding commands"
|
||
msgstr "Команди згортання тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatmacrorecording
|
||
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
||
msgid "Macros"
|
||
msgstr "Макроси"
|
||
|
||
#: lazarusidestrconsts.srkmcatmarker
|
||
msgid "Text bookmark commands"
|
||
msgstr "Команди закладок"
|
||
|
||
#: lazarusidestrconsts.srkmcatmulticaret
|
||
msgid "Multi caret commands"
|
||
msgstr "Команд для декількох курсорів"
|
||
|
||
#: lazarusidestrconsts.srkmcatpackagemenu
|
||
msgid "Package menu commands"
|
||
msgstr "Команди меню Пакунок"
|
||
|
||
#: lazarusidestrconsts.srkmcatprojectmenu
|
||
msgid "Project menu commands"
|
||
msgstr "Команди меню Проект"
|
||
|
||
#: lazarusidestrconsts.srkmcatrunmenu
|
||
msgid "Run menu commands"
|
||
msgstr "Команди меню Виконати"
|
||
|
||
#: lazarusidestrconsts.srkmcatsearchreplace
|
||
msgid "Text search and replace commands"
|
||
msgstr "Команди пошуку і заміни тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatselection
|
||
msgid "Text selection commands"
|
||
msgstr "Команди вибирання тексту"
|
||
|
||
#: lazarusidestrconsts.srkmcatsrcnotebook
|
||
msgid "Source Notebook commands"
|
||
msgstr "Команди блокноту зауважень до тексту програми"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroedit
|
||
msgid "Syncron Editing"
|
||
msgstr "Синхронне редагування"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
||
msgid "Syncron Editing (not in Cell)"
|
||
msgstr "Синхронне редагування (не в комірці)"
|
||
|
||
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
||
msgid "Syncron Editing (while selecting)"
|
||
msgstr "Синхронне редагування (при виділенні)"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateedit
|
||
msgid "Template Editing"
|
||
msgstr "Редагування шаблонів"
|
||
|
||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||
msgid "Template Editing (not in Cell)"
|
||
msgstr "Редагування шаблонів (не в комірці)"
|
||
|
||
#: lazarusidestrconsts.srkmcattoolmenu
|
||
msgid "Tools menu commands"
|
||
msgstr "Команди меню Інструменти"
|
||
|
||
#: lazarusidestrconsts.srkmcatviewmenu
|
||
msgid "View menu commands"
|
||
msgstr "Команди меню Перегляд"
|
||
|
||
#: lazarusidestrconsts.srkmcommand
|
||
msgctxt "lazarusidestrconsts.srkmcommand"
|
||
msgid "Command:"
|
||
msgstr "Команда:"
|
||
|
||
#: lazarusidestrconsts.srkmconflic
|
||
msgid "Conflict "
|
||
msgstr "Конфлікт "
|
||
|
||
#: lazarusidestrconsts.srkmecabortbuild
|
||
msgid "abort build"
|
||
msgstr "перервати збирання"
|
||
|
||
#: lazarusidestrconsts.srkmecabstractmethods
|
||
msgid "Abstract Methods ..."
|
||
msgstr "Абстрактні методи ..."
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpaddress
|
||
msgid "add address breakpoint"
|
||
msgstr "додати точку зупинки за адресою"
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpsource
|
||
msgid "add source breakpoint"
|
||
msgstr "додати точку зупинки в початковому коді"
|
||
|
||
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
||
msgid "add data/watchpoint"
|
||
msgstr "додати дані/точку огляду"
|
||
|
||
#: lazarusidestrconsts.srkmecaddjumppoint
|
||
msgid "Add Jump Point"
|
||
msgstr "Додати точку переходу"
|
||
|
||
#: lazarusidestrconsts.srkmecaddwatch
|
||
msgid "add watch"
|
||
msgstr "додати спостереження"
|
||
|
||
#: lazarusidestrconsts.srkmecattach
|
||
msgid "Attach to program"
|
||
msgstr "Приєднати до програми"
|
||
|
||
#: lazarusidestrconsts.srkmecautocompletion
|
||
msgid "Code template completion"
|
||
msgstr "Завершення шаблонів коду"
|
||
|
||
#: lazarusidestrconsts.srkmecblockcopy
|
||
msgid "Copy Block"
|
||
msgstr "Копіювати блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblockdelete
|
||
msgid "Delete Block"
|
||
msgstr "Видалити блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotobegin
|
||
msgid "Goto Block begin"
|
||
msgstr "Перейти до початку блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecblockgotoend
|
||
msgid "Goto Block end"
|
||
msgstr "Перейти до кінця блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecblockhide
|
||
msgid "Hide Block"
|
||
msgstr "Сховати блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblockindent
|
||
msgid "Indent block"
|
||
msgstr "Зсунути блок вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecblockmove
|
||
msgid "Move Block"
|
||
msgstr "Перемістити блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetbegin
|
||
msgid "Set block begin"
|
||
msgstr "Вказати початок блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecblocksetend
|
||
msgid "Set block end"
|
||
msgstr "Вказати кінець блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecblockshow
|
||
msgid "Show Block"
|
||
msgstr "Показати блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblocktogglehide
|
||
msgid "Toggle block"
|
||
msgstr "Перемкнути блок"
|
||
|
||
#: lazarusidestrconsts.srkmecblockunindent
|
||
msgid "Unindent block"
|
||
msgstr "Відмінити зсув блоку вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecbuild
|
||
msgid "build program/project"
|
||
msgstr "зібрати програму/проект"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildfile
|
||
msgid "build file"
|
||
msgstr "зібрати файл"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildlazarus
|
||
msgid "Build Lazarus"
|
||
msgstr "Зібрати Lazarus"
|
||
|
||
#: lazarusidestrconsts.srkmecbuildmanymodes
|
||
msgid "build many modes"
|
||
msgstr "зібрати у багатьох режимах"
|
||
|
||
#: lazarusidestrconsts.srkmecchar
|
||
msgid "Char"
|
||
msgstr "Символ"
|
||
|
||
#: lazarusidestrconsts.srkmeccleanupandbuild
|
||
msgid "clean up and build"
|
||
msgstr "очистити і зібрати"
|
||
|
||
#: lazarusidestrconsts.srkmecclearall
|
||
msgid "Delete whole text"
|
||
msgstr "Видалити весь текст"
|
||
|
||
#: lazarusidestrconsts.srkmecclearallbookmark
|
||
msgid "Clear all Bookmarks"
|
||
msgstr "Очистити всі закладки"
|
||
|
||
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
||
msgid "Clear Bookmarks for current file"
|
||
msgstr "Очистити закладки для поточного файлу"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseldown
|
||
msgid "Column Select Down"
|
||
msgstr "Вибір стовпців вниз"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
||
msgid "Column Select to absolute end"
|
||
msgstr "Вибір стовпців до самого кінця"
|
||
|
||
#: lazarusidestrconsts.srkmeccolseleditortop
|
||
msgid "Column Select to absolute beginning"
|
||
msgstr "Вибір стовпців до самого початку"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselleft
|
||
msgid "Column Select Left"
|
||
msgstr "Вибір стовпців зліва"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellineend
|
||
msgid "Column Select Line End"
|
||
msgstr "Вибір стовпців до кінця рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinestart
|
||
msgid "Column Select Line Start"
|
||
msgstr "Вибір стовпців до початку рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
||
msgid "Column Select to text start in line"
|
||
msgstr "Вибір стовпців до початку тексту в рядку"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagebottom
|
||
msgid "Column Select Page Bottom"
|
||
msgstr "Вибрати стовпців до низу сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagedown
|
||
msgid "Column Select Page Down"
|
||
msgstr "Вибрати стовпців сторінку внизу"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpagetop
|
||
msgid "Column Select Page Top"
|
||
msgstr "Вибрати стовпців до верху сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselpageup
|
||
msgid "Column Select Page Up"
|
||
msgstr "Вибрати стовпців сторінку зверху"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselright
|
||
msgid "Column Select Right"
|
||
msgstr "Вибір стовпців праворуч"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselup
|
||
msgid "Column Select Up"
|
||
msgstr "Вибір стовпців вгору"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordleft
|
||
msgid "Column Select Word Left"
|
||
msgstr "Додати до вибору стовпців слово зліва"
|
||
|
||
#: lazarusidestrconsts.srkmeccolselwordright
|
||
msgid "Column Select Word Right"
|
||
msgstr "Додати до вибору стовпців слово справа"
|
||
|
||
#: lazarusidestrconsts.srkmeccolumnselect
|
||
msgid "Column selection mode"
|
||
msgstr "Режим вибору стовпців"
|
||
|
||
#: lazarusidestrconsts.srkmeccompile
|
||
msgid "compile program/project"
|
||
msgstr "компілювати програму/проект"
|
||
|
||
#: lazarusidestrconsts.srkmecconfigbuildfile
|
||
msgid "config build file"
|
||
msgstr "файл налаштувань збірки"
|
||
|
||
#: lazarusidestrconsts.srkmeccopy
|
||
#, fuzzy
|
||
#| msgid "Copy selection to clipboard"
|
||
msgctxt "lazarusidestrconsts.srkmeccopy"
|
||
msgid "Copy"
|
||
msgstr "Копіювати вибране у буфер обміну"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
||
msgid "Copy editor to new window"
|
||
msgstr "Копіювати редактор в нове вікно"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
||
msgid "Copy editor to next free window"
|
||
msgstr "Копіювати редактор в наступне вільне вікно"
|
||
|
||
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
||
msgid "Copy editor to prior free window"
|
||
msgstr "Копіювати редактор в попереднє вільне вікно"
|
||
|
||
#: lazarusidestrconsts.srkmeccut
|
||
#, fuzzy
|
||
#| msgid "Cut selection to clipboard"
|
||
msgctxt "lazarusidestrconsts.srkmeccut"
|
||
msgid "Cut"
|
||
msgstr "Вирізати вибране в буфер обміну"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletebol
|
||
msgid "Delete to beginning of line"
|
||
msgstr "Видалити до початку рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletechar
|
||
msgid "Delete char at cursor"
|
||
msgstr "Видалити символ біля курсора"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteeol
|
||
msgid "Delete to end of line"
|
||
msgstr "Видалити до кінця рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastchar
|
||
msgid "Delete Last Char"
|
||
msgstr "Видалити останній символ"
|
||
|
||
#: lazarusidestrconsts.srkmecdeletelastword
|
||
msgid "Delete to start of word"
|
||
msgstr "Видалити до початку слова"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteline
|
||
msgid "Delete current line"
|
||
msgstr "Видалити поточний рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecdeleteword
|
||
msgid "Delete to end of word"
|
||
msgstr "Видалити до кінця слова"
|
||
|
||
#: lazarusidestrconsts.srkmecdetach
|
||
msgid "Detach from program"
|
||
msgstr "Від'єднати від програми"
|
||
|
||
#: lazarusidestrconsts.srkmecdiff
|
||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||
msgid "Diff"
|
||
msgstr "Порівнянти"
|
||
|
||
#: lazarusidestrconsts.srkmecdown
|
||
msgid "Move cursor down"
|
||
msgstr "Змістити курсор вниз"
|
||
|
||
#: lazarusidestrconsts.srkmeceditorbottom
|
||
msgid "Move cursor to absolute end"
|
||
msgstr "Пересунути курсор на абсолютний кінець"
|
||
|
||
#: lazarusidestrconsts.srkmeceditortop
|
||
msgid "Move cursor to absolute beginning"
|
||
msgstr "Пересунути курсор на абсолютний початок"
|
||
|
||
#: lazarusidestrconsts.srkmecemptymethods
|
||
msgid "Empty Methods ..."
|
||
msgstr "Порожні методи ..."
|
||
|
||
#: lazarusidestrconsts.srkmecenvironmentoptions
|
||
msgid "IDE options"
|
||
msgstr "Параметри ІСР"
|
||
|
||
#: lazarusidestrconsts.srkmecevaluate
|
||
msgid "evaluate/modify"
|
||
msgstr "розрахувати/змінити"
|
||
|
||
#: lazarusidestrconsts.srkmecextractproc
|
||
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
||
msgid "Extract Procedure"
|
||
msgstr "Видобути процедуру"
|
||
|
||
#: lazarusidestrconsts.srkmecexttool
|
||
msgid "External tool %d"
|
||
msgstr "Зовнішній інструмент %d"
|
||
|
||
#: lazarusidestrconsts.srkmecexttoolsettings
|
||
msgid "External tools settings"
|
||
msgstr "Налаштування зовнішнього інструменту"
|
||
|
||
#: lazarusidestrconsts.srkmecfind
|
||
msgid "Find Text"
|
||
msgstr "Пошук тексту"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockotherend
|
||
msgid "Find block other end"
|
||
msgstr "Знайти інший кінець блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecfindblockstart
|
||
msgid "Find block start"
|
||
msgstr "Знайти початок блоку"
|
||
|
||
#: lazarusidestrconsts.srkmecfinddeclaration
|
||
msgid "Find Declaration"
|
||
msgstr "Знайти опис"
|
||
|
||
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
||
msgid "Find Identifier References"
|
||
msgstr "Знайти посилання на ідентифікатор"
|
||
|
||
#: lazarusidestrconsts.srkmecfindinfiles
|
||
msgid "Find in Files"
|
||
msgstr "Знайти у файлах"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnext
|
||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||
msgid "Find Next"
|
||
msgstr "Знайти далі"
|
||
|
||
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
||
msgid "Find Next Word Occurrence"
|
||
msgstr "Знайти наступне входження слова"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloads
|
||
msgid "Find Overloads"
|
||
msgstr "Знайти перевантаження"
|
||
|
||
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
||
msgid "Find Overloads ..."
|
||
msgstr "Знайти перевантаження ..."
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevious
|
||
msgid "Find Previous"
|
||
msgstr "Знайти попередній"
|
||
|
||
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
||
msgid "Find Previous Word Occurrence"
|
||
msgstr "Знайти попереднє входження слова"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
||
msgid "Find Procedure Definiton"
|
||
msgstr "Знайти опис процедури"
|
||
|
||
#: lazarusidestrconsts.srkmecfindproceduremethod
|
||
msgid "Find Procedure Method"
|
||
msgstr "Знайти метод процедури"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldcurrent
|
||
msgid "Fold at Cursor"
|
||
msgstr "Згорнути під курсором"
|
||
|
||
#: lazarusidestrconsts.srkmecfoldlevel
|
||
msgid "Fold to Level %d"
|
||
msgstr "Згорнути до Рівня %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoeditor
|
||
msgid "Go to editor %d"
|
||
msgstr "Перейти до редактора %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoincludedirective
|
||
msgid "Go to include directive of current include file"
|
||
msgstr "Перейти до директиви include поточного включеного файлу"
|
||
|
||
#: lazarusidestrconsts.srkmecgotolinenumber
|
||
msgid "Go to Line Number"
|
||
msgstr "Перейти до номера рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecgotomarker
|
||
msgid "Go to bookmark %d"
|
||
msgstr "Перейти до закладки %d"
|
||
|
||
#: lazarusidestrconsts.srkmecgotoxy
|
||
msgid "Goto XY"
|
||
msgstr "Перейти за координатою XY"
|
||
|
||
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
||
msgid "Guess Misplaced $IFDEF"
|
||
msgstr "Передбачити зміщене $IFDEF"
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordleft
|
||
msgid "Move cursor part-word left (e.g. CamelCase)"
|
||
msgstr "Пересунути курсор вліво на частину слова (напр., ЗмішанийРегістр)"
|
||
|
||
#: lazarusidestrconsts.srkmechalfwordright
|
||
msgid "Move cursor part-word right (e.g. CamelCase)"
|
||
msgstr "Пересунути курсор вправо на частину слова (напр., ЗмішанийРегістр)"
|
||
|
||
#: lazarusidestrconsts.srkmecimestr
|
||
msgid "Ime Str"
|
||
msgstr "Ime Str"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
||
msgid "Insert ChangeLog entry"
|
||
msgstr "Вставити елемент журналу змін"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcharacter
|
||
msgid "Insert from Charactermap"
|
||
msgstr "Вставити з таблиці символів"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
||
msgid "Insert CVS keyword Author"
|
||
msgstr "Вставити ключове слово CVS Author"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsdate
|
||
msgid "Insert CVS keyword Date"
|
||
msgstr "Вставити ключове слово CVS Date"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsheader
|
||
msgid "Insert CVS keyword Header"
|
||
msgstr "Вставити ключове слово CVS Header"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsid
|
||
msgid "Insert CVS keyword ID"
|
||
msgstr "Вставити ключове слово CVS ID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvslog
|
||
msgid "Insert CVS keyword Log"
|
||
msgstr "Вставити ключове слово CVS Log"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsname
|
||
msgid "Insert CVS keyword Name"
|
||
msgstr "Вставити ключове слово CVS Name"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
||
msgid "Insert CVS keyword Revision"
|
||
msgstr "Вставити ключове слово CVS Revision"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertcvssource
|
||
msgid "Insert CVS keyword Source"
|
||
msgstr "Вставити ключове слово CVS Source"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertdatetime
|
||
msgid "Insert current date and time"
|
||
msgstr "Вставити поточні дату і час"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertfilename
|
||
msgid "Insert Full Filename"
|
||
msgstr "Вставити повний шлях до файлу"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnotice
|
||
msgid "Insert GPL notice"
|
||
msgstr "Вставити примітку про GPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
||
msgid "Insert GPL notice (translated)"
|
||
msgstr "Вставити зауваження GPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertguid
|
||
msgid "Insert a GUID"
|
||
msgstr "Вставити GUID"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
||
msgid "Insert LGPL notice"
|
||
msgstr "Вставити примітку про LGPL"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
||
msgid "Insert LGPL notice (translated)"
|
||
msgstr "Вставити зауваження LGPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertline
|
||
msgid "Break line, leave cursor"
|
||
msgstr "Розірвати рядок, залишити курсор"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmitnotice
|
||
msgid "Insert MIT notice"
|
||
msgstr "Вставити зауваження MIT"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
||
msgid "Insert MIT notice (translated)"
|
||
msgstr "Вставити зауваження MIT (перекладено)"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmode
|
||
msgid "Insert Mode"
|
||
msgstr "Режим вставки"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
||
msgid "Insert modified LGPL notice"
|
||
msgstr "Вставити змінений LGPL допис"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
||
msgid "Insert modified LGPL notice (translated)"
|
||
msgstr "Вставити зауваження зміненої LGPL (перекладено)"
|
||
|
||
#: lazarusidestrconsts.srkmecinsertusername
|
||
msgid "Insert current username"
|
||
msgstr "Вставити поточне ім'я користувача"
|
||
|
||
#: lazarusidestrconsts.srkmecinspect
|
||
msgid "inspect"
|
||
msgstr "перевірити"
|
||
|
||
#: lazarusidestrconsts.srkmecinvertassignment
|
||
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts.srkmeckeymapleft
|
||
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
||
msgid "Left"
|
||
msgstr "Ліворуч"
|
||
|
||
#: lazarusidestrconsts.srkmeckeymapright
|
||
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
||
msgid "Right"
|
||
msgstr "Праворуч"
|
||
|
||
#: lazarusidestrconsts.srkmecleft
|
||
msgid "Move cursor left"
|
||
msgstr "Змістити курсор вліво"
|
||
|
||
#: lazarusidestrconsts.srkmeclinebreak
|
||
msgid "Break line and move cursor"
|
||
msgstr "Розірвати рядок і зсунути курсор"
|
||
|
||
#: lazarusidestrconsts.srkmeclineend
|
||
msgid "Move cursor to line end"
|
||
msgstr "Пересунути курсор в кінець рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclineselect
|
||
msgid "Line selection mode"
|
||
msgstr "Метод вибору рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclinestart
|
||
msgid "Move cursor to line start"
|
||
msgstr "Пересунути курсор на початок рядка"
|
||
|
||
#: lazarusidestrconsts.srkmeclinetextstart
|
||
msgid "Move cursor to text start in line"
|
||
msgstr "Змістити курсор до початку тексту в рядку"
|
||
|
||
#: lazarusidestrconsts.srkmeclockeditor
|
||
msgid "Lock Editor"
|
||
msgstr "Заблокувати редактор"
|
||
|
||
#: lazarusidestrconsts.srkmecmakeresourcestring
|
||
msgid "Make Resource String"
|
||
msgstr "Створити рядок ресурсу"
|
||
|
||
#: lazarusidestrconsts.srkmecmatchbracket
|
||
msgid "Go to matching bracket"
|
||
msgstr "Перейти до відпов. дужки"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleft
|
||
msgid "Move editor left"
|
||
msgstr "Пересунути редактор вліво"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
||
msgid "Move editor leftmost"
|
||
msgstr "Перемістити редактор вліво в кінець"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
||
msgid "Move editor to new window"
|
||
msgstr "Перемістити редактор в нове вікно"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
||
msgid "Move editor to next free window"
|
||
msgstr "Перемістити редактор в наступне вільне вікно"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
||
msgid "Move editor to prior free window"
|
||
msgstr "Перемістити редактор в попереднє вільне вікно"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorright
|
||
msgid "Move editor right"
|
||
msgstr "Пересунути редактор вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
||
msgid "Move editor rightmost"
|
||
msgstr "Перемістити редактор вправо в кінець"
|
||
|
||
#: lazarusidestrconsts.srkmecmultipaste
|
||
#, fuzzy
|
||
#| msgid "MultiPaste clipboard to current position"
|
||
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
||
msgid "MultiPaste"
|
||
msgstr "Мультиставляння з буфера в поточну позицію"
|
||
|
||
#: lazarusidestrconsts.srkmecnextbookmark
|
||
msgid "Next Bookmark"
|
||
msgstr "Наступна закладка"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditor
|
||
msgid "Go to next editor"
|
||
msgstr "Перейти до наступного редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
||
msgid "Go to next editor in history"
|
||
msgstr "Перейти до наступного редактора в історії"
|
||
|
||
#: lazarusidestrconsts.srkmecnextsharededitor
|
||
msgid "Go to next editor with same Source"
|
||
msgstr "Йти до наступного редактора з тим самим джерелом"
|
||
|
||
#: lazarusidestrconsts.srkmecnextwindow
|
||
msgid "Go to next window"
|
||
msgstr "Йти до наступного вікна"
|
||
|
||
#: lazarusidestrconsts.srkmecnormalselect
|
||
msgid "Normal selection mode"
|
||
msgstr "Нормальний режим вибрання"
|
||
|
||
#: lazarusidestrconsts.srkmecopenfileatcursor
|
||
msgid "Open File at Cursor"
|
||
msgstr "Відкрити файл під курсором"
|
||
|
||
#: lazarusidestrconsts.srkmecoverwritemode
|
||
msgid "Overwrite Mode"
|
||
msgstr "Режим перезапису"
|
||
|
||
#: lazarusidestrconsts.srkmecpagebottom
|
||
msgid "Move cursor to bottom of page"
|
||
msgstr "Пересунути курсор до низу сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecpagedown
|
||
msgid "Move cursor down one page"
|
||
msgstr "Пересунути курсор вниз на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpageleft
|
||
msgid "Move cursor left one page"
|
||
msgstr "Пересунути курсор вліво на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpageright
|
||
msgid "Move cursor right one page"
|
||
msgstr "Пересунути курсор вправо на одну сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpagetop
|
||
msgid "Move cursor to top of page"
|
||
msgstr "Пересунути курсор на початок сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecpageup
|
||
msgid "Move cursor up one page"
|
||
msgstr "Пересунути курсор на попередню сторінку"
|
||
|
||
#: lazarusidestrconsts.srkmecpaste
|
||
#, fuzzy
|
||
#| msgid "Paste clipboard to current position"
|
||
msgctxt "lazarusidestrconsts.srkmecpaste"
|
||
msgid "Paste"
|
||
msgstr "Вставити з буфера в поточну позицію"
|
||
|
||
#: lazarusidestrconsts.srkmecpause
|
||
msgid "pause program"
|
||
msgstr "призупинити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
||
msgid "Clear all extra carets"
|
||
msgstr "Очистити всі додаткові курсори"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
||
msgid "Cursor keys clear all extra carets"
|
||
msgstr "Клавіші курсора вилучають всі додаткові курсори"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
||
msgid "Cursor keys move all extra carets"
|
||
msgstr "Клавіші курсора керують всіма додатковими курсорами"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
||
msgid "Add extra caret"
|
||
msgstr "Встановити додатковий курсор"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
||
msgid "Toggle extra caret"
|
||
msgstr "Перемкнути додатковий курсор"
|
||
|
||
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
||
msgid "Remove extra caret"
|
||
msgstr "Вилучити додатковий курсор"
|
||
|
||
#: lazarusidestrconsts.srkmecprevbookmark
|
||
msgid "Previous Bookmark"
|
||
msgstr "Попередня закладка"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditor
|
||
msgid "Go to prior editor"
|
||
msgstr "Перейти до попереднього редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
||
msgid "Go to previous editor in history"
|
||
msgstr "Перейти до попереднього редактора в історії"
|
||
|
||
#: lazarusidestrconsts.srkmecprevsharededitor
|
||
msgid "Go to prior editor with same Source"
|
||
msgstr "Йти до попереднього редактора з тим самим джерелом"
|
||
|
||
#: lazarusidestrconsts.srkmecprevwindow
|
||
msgid "Go to prior window"
|
||
msgstr "Йти до попереднього вікна"
|
||
|
||
#: lazarusidestrconsts.srkmecquickcompile
|
||
msgid "quick compile, no linking"
|
||
msgstr "швидке компілювання, без компонування"
|
||
|
||
#: lazarusidestrconsts.srkmecremovebreakpoint
|
||
msgid "remove breakpoint"
|
||
msgstr "видалити точку зупинки"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveemptymethods
|
||
msgid "Remove Empty Methods"
|
||
msgstr "Видалити порожні методи"
|
||
|
||
#: lazarusidestrconsts.srkmecremoveunusedunits
|
||
msgid "Remove Unused Units"
|
||
msgstr "Видалити невикористані модулі"
|
||
|
||
#: lazarusidestrconsts.srkmecrenameidentifier
|
||
msgid "Rename Identifier"
|
||
msgstr "Перейменувати ID"
|
||
|
||
#: lazarusidestrconsts.srkmecreplace
|
||
msgid "Replace Text"
|
||
msgstr "Замінити текст"
|
||
|
||
#: lazarusidestrconsts.srkmecreportingbug
|
||
msgctxt "lazarusidestrconsts.srkmecreportingbug"
|
||
msgid "Reporting a bug"
|
||
msgstr "Повідомити про баг"
|
||
|
||
#: lazarusidestrconsts.srkmecresetdebugger
|
||
msgid "reset debugger"
|
||
msgstr "скидання зневаджувача"
|
||
|
||
#: lazarusidestrconsts.srkmecright
|
||
msgid "Move cursor right"
|
||
msgstr "Змістити курсор вправо"
|
||
|
||
#: lazarusidestrconsts.srkmecrun
|
||
msgid "run program"
|
||
msgstr "запустити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecrunfile
|
||
msgid "run file"
|
||
msgstr "запуск файлу"
|
||
|
||
#: lazarusidestrconsts.srkmecrunparameters
|
||
msgid "run parameters"
|
||
msgstr "параметри запуску"
|
||
|
||
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
||
msgid "run without debugging"
|
||
msgstr "запустити без зневадження"
|
||
|
||
#: lazarusidestrconsts.srkmecscrolldown
|
||
msgid "Scroll down one line"
|
||
msgstr "Прокрутити вниз один рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollleft
|
||
msgid "Scroll left one char"
|
||
msgstr "Прокрутити вліво один символ"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollright
|
||
msgid "Scroll right one char"
|
||
msgstr "Прокрутити вправо на один символ"
|
||
|
||
#: lazarusidestrconsts.srkmecscrollup
|
||
msgid "Scroll up one line"
|
||
msgstr "Прокрутити вверх на один рядок"
|
||
|
||
#: lazarusidestrconsts.srkmecseldown
|
||
msgid "Select Down"
|
||
msgstr "Виділити вниз"
|
||
|
||
#: lazarusidestrconsts.srkmecselectall
|
||
msgctxt "lazarusidestrconsts.srkmecselectall"
|
||
msgid "Select All"
|
||
msgstr "Виділити всі"
|
||
|
||
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
||
msgid "Convert tabs to spaces in selection"
|
||
msgstr "Перетворити табуляцію в пробіли в виділеному"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditorbottom
|
||
msgid "Select to absolute end"
|
||
msgstr "Виділити до самого кінця"
|
||
|
||
#: lazarusidestrconsts.srkmecseleditortop
|
||
msgid "Select to absolute beginning"
|
||
msgstr "Виділити до самого початку"
|
||
|
||
#: lazarusidestrconsts.srkmecselgotoxy
|
||
msgid "Select Goto XY"
|
||
msgstr "Виділити перехід за коорд."
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordleft
|
||
msgid "Select part-word left (e.g. CamelCase)"
|
||
msgstr "Вибрати частину слова ліворуч (напр., ЗмішанийРегістр)"
|
||
|
||
#: lazarusidestrconsts.srkmecselhalfwordright
|
||
msgid "Select part-word right (e.g. CamelCase)"
|
||
msgstr "Вибрати частину слова праворуч (напр., ЗмішанийРегістр)"
|
||
|
||
#: lazarusidestrconsts.srkmecselleft
|
||
msgid "Select Left"
|
||
msgstr "Вибрати зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecsellineend
|
||
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
||
msgid "Select Line End"
|
||
msgstr "Виділити кінць рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinestart
|
||
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
||
msgid "Select Line Start"
|
||
msgstr "Виділити початок рядка"
|
||
|
||
#: lazarusidestrconsts.srkmecsellinetextstart
|
||
msgid "Select to text start in line"
|
||
msgstr "Виділити до початку тексту в рядку"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagebottom
|
||
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
||
msgid "Select Page Bottom"
|
||
msgstr "Виділити низ сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagedown
|
||
msgid "Select Page Down"
|
||
msgstr "Виділити сторінку знизу"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageleft
|
||
msgid "Select Page Left"
|
||
msgstr "Виділити сторінку зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageright
|
||
msgid "Select Page Right"
|
||
msgstr "Виділити сторінку справа"
|
||
|
||
#: lazarusidestrconsts.srkmecselpagetop
|
||
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
||
msgid "Select Page Top"
|
||
msgstr "Виділити верх сторінки"
|
||
|
||
#: lazarusidestrconsts.srkmecselpageup
|
||
msgid "Select Page Up"
|
||
msgstr "Виділити сторінку зверху"
|
||
|
||
#: lazarusidestrconsts.srkmecselright
|
||
msgid "Select Right"
|
||
msgstr "Вибрати справа"
|
||
|
||
#: lazarusidestrconsts.srkmecselsticky
|
||
msgid "Start sticky selecting"
|
||
msgstr "Почати вибір з прив'язкою"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickycol
|
||
msgid "Start sticky selecting (Columns)"
|
||
msgstr "Почати вибір з прив'язкою (стовпці)"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickyline
|
||
msgid "Start sticky selecting (Line)"
|
||
msgstr "Почати вибір з прив'язкою (рядки)"
|
||
|
||
#: lazarusidestrconsts.srkmecselstickystop
|
||
msgid "Stop sticky selecting"
|
||
msgstr "Закінчити вибір з прив'язкою"
|
||
|
||
#: lazarusidestrconsts.srkmecselup
|
||
msgid "Select Up"
|
||
msgstr "Виділити вверх"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendleft
|
||
msgid "Select word-end left"
|
||
msgstr "Вибрати кінець слова зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordendright
|
||
msgid "Select word-end right"
|
||
msgstr "Вибрати кінець слова справа"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordleft
|
||
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
||
msgid "Select Word Left"
|
||
msgstr "Виділити слово зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecselwordright
|
||
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
||
msgid "Select Word Right"
|
||
msgstr "Виділити слово справа"
|
||
|
||
#: lazarusidestrconsts.srkmecsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
|
||
msgid "Set a free Bookmark"
|
||
msgstr "Задати вільну закладку"
|
||
|
||
#: lazarusidestrconsts.srkmecsetmarker
|
||
msgid "Set bookmark %d"
|
||
msgstr "Встановити закладку %d"
|
||
|
||
#: lazarusidestrconsts.srkmecshifttab
|
||
msgid "Shift Tab"
|
||
msgstr "Shift Tab"
|
||
|
||
#: lazarusidestrconsts.srkmecshowabstractmethods
|
||
msgid "Show Abstract Methods"
|
||
msgstr "Показати абстрактні методи"
|
||
|
||
#: lazarusidestrconsts.srkmecshowcodecontext
|
||
msgid "Show Code Context"
|
||
msgstr "Показати контекст коду"
|
||
|
||
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
||
msgid "show execution point"
|
||
msgstr "показати точку виконання"
|
||
|
||
#: lazarusidestrconsts.srkmecstopprogram
|
||
msgid "stop program"
|
||
msgstr "зупинити програму"
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacroplay
|
||
msgid "Play Macro"
|
||
msgstr "Виконати макрос"
|
||
|
||
#: lazarusidestrconsts.srkmecsynmacrorecord
|
||
msgid "Record Macro"
|
||
msgstr "Записати макрос"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Йти до ост. позиції у комірці"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Йти до перш. позиції в комірці"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
||
msgid "Select Cell"
|
||
msgstr "Вибрати комірку"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
||
msgid "Escape"
|
||
msgstr "Вийти"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Наступна комірка"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Наступна комірка (всі вибрані)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr "Наступна комірка (лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr "Наступна комірка (всі вибрані / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Попередня комірка"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Попередня комірка (всі вибрані)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr "Попередня комірка (лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr "Попередня комірка (всі вибрані / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
||
msgid "Start Syncro edit"
|
||
msgstr "Почати синхронне редагування"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
||
msgid "Goto last pos in cell"
|
||
msgstr "Йти до ост. позиції у комірці"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
||
msgid "Goto first pos in cell"
|
||
msgstr "Йти до перш. позиції у комірці"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
||
msgid "Select cell"
|
||
msgstr "Вибрати комірку"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledescape
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
||
msgid "Escape"
|
||
msgstr "Вийти"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
||
msgid "Finish"
|
||
msgstr "Фініш"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
||
msgid "Next Cell"
|
||
msgstr "Наступна комірка"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
||
msgid "Next Cell (rotate)"
|
||
msgstr "Наступна комірка (обертати)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
||
msgid "Next Cell (all selected)"
|
||
msgstr "Наступна комірка (всі вибрані)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
||
msgid "Next Cell (rotate / all selected)"
|
||
msgstr "Наступна комірка (обертати / всі вибрані)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
||
msgid "Next Cell (firsts only)"
|
||
msgstr "Наступна комірка (лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
||
msgid "Next Cell (rotate / firsts only)"
|
||
msgstr "Наступна комірка (по колу / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
||
msgid "Next Cell (all selected / firsts only)"
|
||
msgstr "Наступна комірка (всі вибрані / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
||
msgid "Next Cell (rotate / all selected / firsts only)"
|
||
msgstr "Наступна комірка (по колу / всі вибрані / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
||
msgid "Previous Cell"
|
||
msgstr "Попередня комірка"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
||
msgid "Previous Cell (all selected)"
|
||
msgstr "Попередня комірка (всі вибрані)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
||
msgid "Previous Cell (firsts only)"
|
||
msgstr "Попередня комірка (лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
||
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
||
msgid "Previous Cell (all selected / firsts only)"
|
||
msgstr "Попередня комірка (всі вибрані / лише перші)"
|
||
|
||
#: lazarusidestrconsts.srkmecsyntaxcheck
|
||
msgid "Syntax Check"
|
||
msgstr "Перевірка синтаксису"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleassembler
|
||
msgid "View assembler"
|
||
msgstr "Переглянути асемблер"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoint
|
||
msgid "toggle breakpoint"
|
||
msgstr "перемкнути точку зупинки"
|
||
|
||
#: lazarusidestrconsts.srkmectogglebreakpoints
|
||
msgid "View breakpoints"
|
||
msgstr "Переглядання точок зупинки"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecallstack
|
||
msgid "View call stack"
|
||
msgstr "Переглядання стеку викликів"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodebrowser
|
||
msgid "View code browser"
|
||
msgstr "Браузер коду програми"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecodeexpl
|
||
msgid "View Code Explorer"
|
||
msgstr "Показувати оглядач коду"
|
||
|
||
#: lazarusidestrconsts.srkmectogglecomppalette
|
||
msgid "View component palette"
|
||
msgstr "Переглянути палітру компонетів"
|
||
|
||
#: lazarusidestrconsts.srkmectoggledebuggerout
|
||
msgid "View debugger output"
|
||
msgstr "Показати вивід зневаджувача"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleformunit
|
||
msgid "Switch between form and unit"
|
||
msgstr "Перемкнути модуль/форму"
|
||
|
||
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
||
msgid "View Documentation Editor"
|
||
msgstr "Показати Редактор документації"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
||
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
|
||
msgid "View IDE speed buttons"
|
||
msgstr "Переглянути швидкі клавіші графічної оболонки"
|
||
|
||
#: lazarusidestrconsts.srkmectogglelocals
|
||
msgid "View local variables"
|
||
msgstr "Переглядання локальних змінних"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarker
|
||
msgid "Toggle bookmark %d"
|
||
msgstr "Перемкнути закладку %d"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemarkupword
|
||
msgid "Toggle Current-Word highlight"
|
||
msgstr "Перемкнути підсвічення поточного слова "
|
||
|
||
#: lazarusidestrconsts.srkmectogglemessages
|
||
msgid "View messages"
|
||
msgstr "Переглядання повідомлень"
|
||
|
||
#: lazarusidestrconsts.srkmectogglemode
|
||
msgid "Toggle Mode"
|
||
msgstr "Перемкнути режим"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
||
msgid "View Object Inspector"
|
||
msgstr "Показувати інспектор об'єктів"
|
||
|
||
#: lazarusidestrconsts.srkmectoggleregisters
|
||
msgid "View registers"
|
||
msgstr "Переглянути регістри"
|
||
|
||
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
||
msgid "View restriction browser"
|
||
msgstr "Дивитись браузер обмежень"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesearchresults
|
||
msgid "View Search Results"
|
||
msgstr "Показувати результати пошуку"
|
||
|
||
#: lazarusidestrconsts.srkmectogglesourceeditor
|
||
msgid "View Source Editor"
|
||
msgstr "Показувати редактор тексту"
|
||
|
||
#: lazarusidestrconsts.srkmectogglewatches
|
||
msgid "View watches"
|
||
msgstr "Показувати спостереження"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldall
|
||
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr "Розгорунти все"
|
||
|
||
#: lazarusidestrconsts.srkmecunfoldcurrent
|
||
msgid "Unfold at Cursor"
|
||
msgstr "Розгортати під курсором"
|
||
|
||
#: lazarusidestrconsts.srkmecunknown
|
||
msgid "unknown editor command"
|
||
msgstr "невідома команда редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecunusedunits
|
||
msgid "Unused Units ..."
|
||
msgstr "Невикористовувані модулі ..."
|
||
|
||
#: lazarusidestrconsts.srkmecup
|
||
msgid "Move cursor up"
|
||
msgstr "Змістити курсор вгору"
|
||
|
||
#: lazarusidestrconsts.srkmecviewanchoreditor
|
||
msgid "View anchor editor"
|
||
msgstr "Показувати редактор прив'язок"
|
||
|
||
#: lazarusidestrconsts.srkmecviewcomponents
|
||
msgid "View components"
|
||
msgstr "Переглянути компоненти"
|
||
|
||
#: lazarusidestrconsts.srkmecvieweditormacros
|
||
msgid "View editor macros"
|
||
msgstr "Показати макроси редактора"
|
||
|
||
#: lazarusidestrconsts.srkmecviewforms
|
||
msgid "View forms"
|
||
msgstr "Показувати форми"
|
||
|
||
#: lazarusidestrconsts.srkmecviewhistory
|
||
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
||
msgid "View History"
|
||
msgstr "Переглянути історію"
|
||
|
||
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
||
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
||
msgid "View Terminal Output"
|
||
msgstr "Дивитись вивід терміналу"
|
||
|
||
#: lazarusidestrconsts.srkmecviewtaborder
|
||
msgid "View Tab Order"
|
||
msgstr "Переглянути Таб-порядок"
|
||
|
||
#: lazarusidestrconsts.srkmecviewthreads
|
||
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
||
msgid "View Threads"
|
||
msgstr "Переглянути нитки"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitdependencies
|
||
msgid "View unit dependencies"
|
||
msgstr "Показувати залежності модулів"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunitinfo
|
||
msgid "View unit information"
|
||
msgstr "Показувати відомості про модулі"
|
||
|
||
#: lazarusidestrconsts.srkmecviewunits
|
||
msgid "View units"
|
||
msgstr "Показувати модулі"
|
||
|
||
#: lazarusidestrconsts.srkmecwordcompletion
|
||
msgid "Word Completion"
|
||
msgstr "Завершення слів"
|
||
|
||
#: lazarusidestrconsts.srkmecwordendleft
|
||
msgid "Move cursor word-end left"
|
||
msgstr "Змістити крусор на кінець слова зліва"
|
||
|
||
#: lazarusidestrconsts.srkmecwordendright
|
||
msgid "Move cursor word-end right"
|
||
msgstr "Змістити крусор на кінець слова справа"
|
||
|
||
#: lazarusidestrconsts.srkmecwordleft
|
||
msgid "Move cursor word left"
|
||
msgstr "Пересунути курсор на слово вліво"
|
||
|
||
#: lazarusidestrconsts.srkmecwordright
|
||
msgid "Move cursor word right"
|
||
msgstr "Пересунути курсор на слово вправо"
|
||
|
||
#: lazarusidestrconsts.srkmeczoomin
|
||
msgid "Zoom in"
|
||
msgstr "Збільшити"
|
||
|
||
#: lazarusidestrconsts.srkmeczoomout
|
||
msgid "Zoom out"
|
||
msgstr "Зменшити"
|
||
|
||
#: lazarusidestrconsts.srkmeditforcmd
|
||
msgid "Edit keys of command"
|
||
msgstr "Змінити кнопки команди"
|
||
|
||
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
||
msgid "Continue with next mouse up action"
|
||
msgstr "Продовжити з наступним відпусканням кнопки миші"
|
||
|
||
#: lazarusidestrconsts.synffoldcomments
|
||
msgid "Fold comments"
|
||
msgstr "Згорнути коментарі"
|
||
|
||
#: lazarusidestrconsts.synffoldcommentsinselection
|
||
msgid "Fold comments in selection"
|
||
msgstr "Згорнути коментарі в виділенні"
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdef
|
||
msgid "Fold inactive Ifdef"
|
||
msgstr "Згорнути неактивний блок IFDEF"
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
||
msgid "Fold inactive Ifdef (exclude mixed state)"
|
||
msgstr "Згорнути неактивний блок IFDEF (крім умовно активних)"
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
||
msgid "Fold inactive Ifdef in selection"
|
||
msgstr "Згорнути неактивний блок IFDEF у вибраному"
|
||
|
||
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
||
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
||
msgstr "Згорнути неактивний блок IFDEF у вибраному (крім умовно активних)"
|
||
|
||
#: lazarusidestrconsts.synfhidecomments
|
||
msgid "Hide comments"
|
||
msgstr "Приховати коментарі"
|
||
|
||
#: lazarusidestrconsts.synfhidecommentsinselection
|
||
msgid "Hide comments in selection"
|
||
msgstr "Сховати коментарі в виділенні"
|
||
|
||
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
||
msgid "Match action button of mouse down"
|
||
msgstr "Враховувати кнопку миші при її натисканні"
|
||
|
||
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
||
msgid "Match action line of mouse down"
|
||
msgstr "Враховувати рядок при натисканні кнопки миші"
|
||
|
||
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
||
msgid "Match action modifiers of mouse down"
|
||
msgstr "Враховувати модифікатори при натисканні кнопки миші"
|
||
|
||
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
||
msgid "Match action pos of mouse down"
|
||
msgstr "Враховувати положення при натисканні кнопки миші"
|
||
|
||
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
||
msgid "Search all action of mouse down"
|
||
msgstr "Шукати всі дії при натисканні кнопки миші"
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdef
|
||
msgid "Unfold active Ifdef"
|
||
msgstr "Розгорнути активний блок IFDEF"
|
||
|
||
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
||
msgid "Unfold active Ifdef in selection"
|
||
msgstr "Розгорнути активний блок IFDEF у вибраному"
|
||
|
||
#: lazarusidestrconsts.synfunfoldall
|
||
msgctxt "lazarusidestrconsts.synfunfoldall"
|
||
msgid "Unfold all"
|
||
msgstr "Розгорунти все"
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdef
|
||
msgid "Unfold all Ifdef"
|
||
msgstr "Розгорнути всі блоки IFDEF"
|
||
|
||
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
||
msgid "Unfold all Ifdef in selection"
|
||
msgstr "Розгорнути всі блоки IFDEF у вибраному"
|
||
|
||
#: lazarusidestrconsts.synfunfoldallinselection
|
||
msgid "Unfold all in selection"
|
||
msgstr "Розгорнути все в виділенні"
|
||
|
||
#: lazarusidestrconsts.synfunfoldcomments
|
||
msgid "Unfold comments"
|
||
msgstr "Розгорнути коментарі"
|
||
|
||
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
||
msgid "Unfold comments in selection"
|
||
msgstr "Розгорнути коментарі в виділенні"
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
||
msgid "Unfold inactive Ifdef"
|
||
msgstr "Розгорнути неактивний блок IFDEF"
|
||
|
||
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
||
msgid "Unfold inactive Ifdef in selection"
|
||
msgstr "Розгорнути неактивний блок IFDEF у вибраному"
|
||
|
||
#: lazarusidestrconsts.uefilerocap
|
||
msgid "File is readonly"
|
||
msgstr "Файл тільки для читання"
|
||
|
||
#: lazarusidestrconsts.uefilerotext1
|
||
msgid "The file \""
|
||
msgstr "Файл \""
|
||
|
||
#: lazarusidestrconsts.uefilerotext2
|
||
msgid "\" is not writable."
|
||
msgstr "\" не для запису."
|
||
|
||
#: lazarusidestrconsts.uelocked
|
||
msgid "Locked"
|
||
msgstr "Заблоковано"
|
||
|
||
#: lazarusidestrconsts.uemacrorecording
|
||
msgid "Recording"
|
||
msgstr "Запис"
|
||
|
||
#: lazarusidestrconsts.uemacrorecordingpaused
|
||
msgid "Rec-pause"
|
||
msgstr "Зап-пауза"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchatcursor
|
||
msgid "Add &Watch At Cursor"
|
||
msgstr "Додати спостереження біля курсора"
|
||
|
||
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
||
msgid "Add Watch&Point At Cursor"
|
||
msgstr "Додати точку&огляду біля курсора"
|
||
|
||
#: lazarusidestrconsts.uembookmarkn
|
||
msgid "Bookmark"
|
||
msgstr "Закладка"
|
||
|
||
#: lazarusidestrconsts.uemcloseotherpages
|
||
msgid "Close All &Other Pages"
|
||
msgstr "Закрити всі &інші сторінки"
|
||
|
||
#: lazarusidestrconsts.uemclosepage
|
||
msgid "&Close Page"
|
||
msgstr "&Закрити сторінку"
|
||
|
||
#: lazarusidestrconsts.uemcopyfilename
|
||
msgid "Copy Filename"
|
||
msgstr "Копіювати назву файлу"
|
||
|
||
#: lazarusidestrconsts.uemcopytonewwindow
|
||
msgid "Clone to New Window"
|
||
msgstr "Клонувати у нове вікно"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindow
|
||
msgid "Clone to Other Window"
|
||
msgstr "Клонувати в інше вікно"
|
||
|
||
#: lazarusidestrconsts.uemcopytootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Нове вікно"
|
||
|
||
#: lazarusidestrconsts.uemdebugword
|
||
msgctxt "lazarusidestrconsts.uemdebugword"
|
||
msgid "Debug"
|
||
msgstr "Зневадження"
|
||
|
||
#: lazarusidestrconsts.uemencoding
|
||
msgid "Encoding"
|
||
msgstr "Кодування"
|
||
|
||
#: lazarusidestrconsts.uemevaluatemodify
|
||
msgid "&Evaluate/Modify ..."
|
||
msgstr "&Оцінити/Змінити ..."
|
||
|
||
#: lazarusidestrconsts.uemfinddeclaration
|
||
msgid "&Find Declaration"
|
||
msgstr "&Знайти опис"
|
||
|
||
#: lazarusidestrconsts.uemfindinotherwindow
|
||
msgid "Find in other Window"
|
||
msgstr "Знайти в іншому вікні"
|
||
|
||
#: lazarusidestrconsts.uemgotobookmark
|
||
msgid "&Goto Bookmark"
|
||
msgstr "&Перехід на закладку"
|
||
|
||
#: lazarusidestrconsts.uemhighlighter
|
||
msgid "Highlighter"
|
||
msgstr "Маркер"
|
||
|
||
#: lazarusidestrconsts.ueminspect
|
||
msgctxt "lazarusidestrconsts.ueminspect"
|
||
msgid "&Inspect ..."
|
||
msgstr "Слідкувати за ..."
|
||
|
||
#: lazarusidestrconsts.ueminvertassignment
|
||
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
||
msgid "Invert Assignment"
|
||
msgstr "Інвертувати присвоєння"
|
||
|
||
#: lazarusidestrconsts.uemlineending
|
||
msgid "Line Ending"
|
||
msgstr "Кінець рядка"
|
||
|
||
#: lazarusidestrconsts.uemlockpage
|
||
msgid "&Lock Page"
|
||
msgstr "&Закріпити сторінку"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleft
|
||
msgid "Move Page Left"
|
||
msgstr "Перемістити сторінку вліво"
|
||
|
||
#: lazarusidestrconsts.uemmovepageleftmost
|
||
msgid "Move Page Leftmost"
|
||
msgstr "Помістити сторінку в кінці зліва"
|
||
|
||
#: lazarusidestrconsts.uemmovepageright
|
||
msgid "Move Page Right"
|
||
msgstr "Перемістити сторінку вправо"
|
||
|
||
#: lazarusidestrconsts.uemmovepagerightmost
|
||
msgid "Move Page Rightmost"
|
||
msgstr "Помістити сторінку в кінці справа"
|
||
|
||
#: lazarusidestrconsts.uemmovetonewwindow
|
||
msgid "Move to New Window"
|
||
msgstr "Перемістити у нове вікно"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindow
|
||
msgid "Move to Other Window"
|
||
msgstr "Перемістити в інше вікно"
|
||
|
||
#: lazarusidestrconsts.uemmovetootherwindownew
|
||
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
||
msgid "New Window"
|
||
msgstr "Нове вікно"
|
||
|
||
#: lazarusidestrconsts.uemnextbookmark
|
||
msgid "Goto Next Bookmark"
|
||
msgstr "Перейти до наступної закладки"
|
||
|
||
#: lazarusidestrconsts.uemodified
|
||
msgid "Modified"
|
||
msgstr "Змінено"
|
||
|
||
#: lazarusidestrconsts.uemopenfileatcursor
|
||
msgid "&Open File at Cursor"
|
||
msgstr "&Відкрити файл біля курсора"
|
||
|
||
#: lazarusidestrconsts.uemprevbookmark
|
||
msgid "Goto Previous Bookmark"
|
||
msgstr "Перейти до попер. закладки"
|
||
|
||
#: lazarusidestrconsts.uemprocedurejump
|
||
msgid "Procedure Jump"
|
||
msgstr "Процедурний перехід"
|
||
|
||
#: lazarusidestrconsts.uemreadonly
|
||
msgctxt "lazarusidestrconsts.uemreadonly"
|
||
msgid "Read Only"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts.uemrefactor
|
||
msgid "Refactoring"
|
||
msgstr "Переробка коду"
|
||
|
||
#: lazarusidestrconsts.uemruntocursor
|
||
msgid "&Run to Cursor"
|
||
msgstr "&Виконувати до курсора"
|
||
|
||
#: lazarusidestrconsts.uemsetfreebookmark
|
||
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
||
msgid "Set a Free Bookmark"
|
||
msgstr "Встановити вільну закладку"
|
||
|
||
#: lazarusidestrconsts.uemshowlinenumbers
|
||
msgid "Show Line Numbers"
|
||
msgstr "Показувати нумерацію рядків"
|
||
|
||
#: lazarusidestrconsts.uemsource
|
||
msgctxt "lazarusidestrconsts.uemsource"
|
||
msgid "Source"
|
||
msgstr "Джерело"
|
||
|
||
#: lazarusidestrconsts.uemtogglebookmark
|
||
msgid "&Toggle Bookmark"
|
||
msgstr "&Перемкнути закладку"
|
||
|
||
#: lazarusidestrconsts.uemtogglebreakpoint
|
||
msgid "Toggle &Breakpoint"
|
||
msgstr "Перемкнути &точку зупинки"
|
||
|
||
#: lazarusidestrconsts.uemviewcallstack
|
||
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
||
msgid "View Call Stack"
|
||
msgstr "Показувати стек викликів"
|
||
|
||
#: lazarusidestrconsts.uenotimplcap
|
||
msgid "Not implemented yet"
|
||
msgstr "Ще не реалізовано"
|
||
|
||
#: lazarusidestrconsts.uepins
|
||
msgid "INS"
|
||
msgstr "ВСТ"
|
||
|
||
#: lazarusidestrconsts.uepovr
|
||
msgid "OVR"
|
||
msgstr "ЗАМ"
|
||
|
||
#: lazarusidestrconsts.uepreadonly
|
||
msgid "Readonly"
|
||
msgstr "Тільки для читання"
|
||
|
||
#: lazarusidestrconsts.versioninfotitle
|
||
msgid "Version Info"
|
||
msgstr "Інформація про версію"
|
||
|