lazarus/languages/lazaruside.es.po

msgid ""
msgstr ""
"Content-Type: text/plain; charset=UTF-8\n"
"Project-Id-Version: lazaruside\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2018-09-19 13:47-0500\n"
"Last-Translator: Alonso Cárdenas <acardenas@bsd-peru.org>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Transfer-Encoding: 8bit\n"
"Language: es\n"
"X-Generator: Poedit 2.1.1\n"

#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Seleccionar Grupos"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Seleccionar grupos para desactivar cuando salte punto de interrupción"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Seleccionar grupos para activar cuando salte punto de interrupción"

#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
#, object-pascal-format
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Algunos grupos en la lista Activar/Desactivar no existen.%0:s¿Crearlos?%0:s%0:s%1:s"

#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr "Dirección de punto de interrupción %s"

#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr "en $%s"

#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr "en $%s desde origen %s línea %d"

#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr "en $%s: %s línea %d"

#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr "Fuente de punto de interrupción %s"

#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr "Punto de interrupción desconocido %s"

#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr "Punto de observación %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr "Punto de observación desconocido fuera de alcance %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Punto de observación disparado %s. Valor anterior \"%s\", Nuevo valor \"%s\""

#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "Punto de observación \"%s\" fuera de alcance %s"

#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Punto de observación para \"%s\" fue disparado %s. Valor anterior \"%s\", Nuevo valor \"%s\""

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Usar combinación predefinida"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Restablecer todos los ajustes"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Restablecer todos los ajustes de la columna de marcas"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Restablecer todos los ajustes de texto"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Añadir punto al historial"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Menu Contextual"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Menu Contextual (debug)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Menu Contextual (tab)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Salta a la implementación"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Salta a la implementación/final bloque"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Retroceder en el historial"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Avanzar en el historial"

#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Alternar extra Caret"

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Nada/Predeterminado"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Pegar"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Continuar %0:s (Limitado a: %1:s)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr "Continuar %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Selecionar texto"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Seleccionar texto (líneas)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Seleccionar texto (elementos individuales)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Seleccionar texto (palabras)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Selecionar texto (modo columna)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Seleccionar texto (modo línea)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Establecer marcador (bookmark) libre"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Selecionar línea actual (completa)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Selecionar línea actual (texto)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Seleccionar párrafo actual"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Seleccionar palabra actual"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Resetear zoom"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Esta página no representa sus ajustes actuales. Vea la página de ajustes avanzados. Utilice esta página para restaurar cualquier cambio de ajustes avanzado"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "General"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Estandar. Todas las acciones (punto de interrupción, plegado) al hacer clic"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Extendido, Acciones (punto de interrupción, plegado) al soltar el ratón. Selección al hacer clic y mover"

#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Ampliado, Acciones, solo la mitad derecha del canal"

#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Usar numero de líneas para seleccionarlas"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Columna de marcas"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
#, fuzzy
#| msgid "Right mouse includes caret move"
msgid "Right button click includes caret move"
msgstr "Clic derecho también desplaza el cursor de texto"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Texto"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Rueda ratón"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Rueda de ratón Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Arrastrar selección (copiar/pegar)"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Botón Extra-1"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Botón Extra-2"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Doble Atl"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Doble Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Doble"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Doble Mayúsculas"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Cuádruple"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triple"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Botón Central"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Central"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Izquierda 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Izquierda 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Derecho"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Botón Derecho"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Mayus-Alt-Ctrl Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Mayus-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Mayus-Alt Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Mayus-Alt Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Mayus-Ctrl Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Mayus-Ctrl Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Mayusculas Botón"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Mayusculas Rueda de ratón"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Tienes cambios sin guardar. El uso de ésta página revertirá cualquier cambio hecho en la página avanzada"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Desplazamiento (Scroll) horizontal (Sistema velocidad)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Desplazamiento (Scroll) horizontal (Línea simple)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Desplazamiento (Scroll) horizontal (Página)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Desplazamiento (Scroll) horizontal (Media página)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Desplazamiento (Scroll) horizontal (Página, menos una línea)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Nada/Predeterminado"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Desplazamiento (Scroll), (Sistema velocidad)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Desplazamiento (Scroll), (Línea simple)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Desplazamiento (Scroll),  (Página)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Desplazamiento (Scroll), (Media página)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Desplazamiento (Scroll), (Página, menos una línea)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Zoom"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Ninguno >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Sólo-Lectura"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minúsculas, primera letra en mayúsculas"

#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "activo"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Añadir operador de asignación :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Resaltado de paréntesis"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Plegado del árbol de código"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Texto Predeterminado"

#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Texto predeterminado / Ventana"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Punto de interrupción desactivado"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Punto de interrupción activado"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Línea de error"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Punto de ejecución"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Marcador de plegado de código"

#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Doblez línea-inicio"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Global"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Columna de marcas"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Línea"

#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Colores de entorno"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edición Sincronizada"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Edición de Plantilla"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Texto"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Separador de la columna de marcas"

#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Ocultar línea-inicio"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Incremental, otros"

#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Resaltar prefijo"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Resaltar palabra actual"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Incremental, búsqueda"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Punto de Interrupción no válido"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Resaltado de línea actual"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Número de línea"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Línea modificada"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Enlace de Ratón"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "Nivel 10"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level  1"
msgstr "Nivel 1"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level  2"
msgstr "Nivel 2"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level  3"
msgstr "Nivel 3"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level  4"
msgstr "Nivel 4"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level  5"
msgstr "Nivel 5"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level  6"
msgstr "Nivel 6"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level  7"
msgstr "Nivel 7"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level  8"
msgstr "Nivel 8"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level  9"
msgstr "Nivel 9"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Área seleccionada"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Celda activa"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Otras celdas"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Celdas sincronizadas"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Celda activa"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Otras celdas"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Celdas sincronizadas"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Bloque de texto"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Punto de interrupción desconocido"

#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Borde de ventana"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Palabra Inicial-Final"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Visualizados Caracteres especiales"

#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Añadir nuevo modo"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Añadir punto y coma"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ajustar línea superior para mostrar el comentario anterior"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabéticamente"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
#, fuzzy
#| msgid "Always visible cursor"
msgid "Always keep caret in visible area of editor"
msgstr "Cursor siempre visible"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Acción de archivo ambigua:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Advertencia al compilar"

#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Se muestra un icono de error/advertencia/sugerencia enfrente de un mensaje. En cualquier caso se muestra el mismo icono en la columna de marcas del editor de código fuente."

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Configuraciones de la aplicación"

#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Incluir código de aserción"

#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format, fuzzy, badformat
#| msgid "Associated debug desktop"
msgid "Associated debug desktop for \"%s\""
msgstr "Escritorio de depuración asociado"

#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "Si seleccionas un escritorio, el escritorio de depuración asociado será seleccionado también"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Crear formularios automáticamente:"

#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "La unidad principal .lpr crea cada formulario con Application.CreateForm(). También los libera automáticamente."

#: lazarusidestrconsts.dlgautocreatenewforms
#, fuzzy
#| msgid "When creating new forms, add them to auto-created forms"
msgid "Auto-create new forms"
msgstr "Al crear formularios nuevos, añadirlos a formularios creados automáticamente"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Borrar archivo automáticamente"

#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Automostrar Prototipos de Función"

#: lazarusidestrconsts.dlgautohidecursor
#, fuzzy
#| msgid "Hide mouse when typing"
msgid "Hide mouse pointer when typing"
msgstr "Ocultar el cursor del ratón al escribir"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Sangrado automático"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Establecer sangrado inteligente)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Sangrado automático"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Eliminar métodos vacios automáticamente"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Renombrar automáticamente en minúsculas"

#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Grabar escritorio activo"

#: lazarusidestrconsts.dlgautosaveactivedesktophint
#, fuzzy
#| msgid ""
#| "Save active desktop on IDE close\n"
#| "Save debug desktop on IDE close and debug end\n"
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
"Guardar escritorio activo al cerrar el IDE\n"
"Guardar el escritorio de depuración al cerrar el IDE y al final de la depuración\n"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Formularios disponibles:"

#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Estos formularios se deben crear y liberar mediante código en el programa."

#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Evitar saltos innecesarios"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Fondo"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(no hay subdirectorio)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Mismo nombre (en subdirectorio)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Detrás de los métodos"

#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Selección"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Sangrado de bloque (espacios)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Sangrado de bloque"

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(editar llaves)"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Espacio/TAB como en la línea anterior"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Solamente posición"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Espacios"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Tabulaciones, quitar"

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Tabulaciones, después espacios"

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Sangrado de bloque (tabs)"

#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr "El espacio del borde se puede establecer en el editor de anclaje. Se muestra una línea roja si spacing > 0."

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Resaltado de paréntesis"

#: lazarusidestrconsts.dlgbracketmatchgroup
#, fuzzy
#| msgid "Matching bracket pairs"
msgid "Matching bracket and quote pairs"
msgstr "Coincidente con pares de paréntesis"

#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "No puedes usar el escritorio acoplado en entornos sin acoplamiento y viceversa."

#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Multi/2nd (NotXor)"
msgstr "Multi/2nd (NotXor)"

#: lazarusidestrconsts.dlgcaretcolor
#, fuzzy
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret"
msgstr "Cursor de texto"

#: lazarusidestrconsts.dlgcaretforecolor
msgid "Color (NotXor)"
msgstr "Color (NotXor)"

#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Circunflejo (Cursor de texto)"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&sensible a mayúsculas"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Comprobando opciones del compilador"

#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr "archivo huérfano encontrado: %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Resultados"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Probar"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Probando: Comprobando compilador ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Probando: Comprobando configuración del compilador ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Probando: Comprobando fecha del compilador ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Probando: Compilando un archivo vacío ..."

#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Probando: Comprobando unidades de RTL ..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Probando: Comprobando fuentes en las rutas de búsqueda ppu de fpc ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Probando: Compilando un archivo vacío"

#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr "utilizando el archivo de configuración %s"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Orden de la clase"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "En último lugar"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minúsculas"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Vista previa (máx. largo de línea = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefijo de lectura"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Sufijo almacenado"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAYÚSCULAS"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefijo de variable"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefijo de escritura"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Guardar como - autorenombrar archivos Pascal en minúsculas"

#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Chequear y Auto Guardar Ficheros"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Comprobar los paquetes al crear el formulario"

#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "El formulario puede requerir un paquete para funcionar. Instala dicho paquete automáticamente."

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Escoja archivo de plantilla de código (*.dci)"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Mostrar botón cerrar en las pestañas"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Combinación de colores"

#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Estilo de macros C (global)"

#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Utilizar Ansistrings"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Estilo de ensamblador"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Mensajes"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Chequea y asercia (asegura)"

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Comandos del compilador"

#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "estilo de operadores C (*=, +=, /= y -=)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Crear Makefile"

#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Depurando"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Adiciones a la ruta del depurador (ninguna):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Creación de Código"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Ambos"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Plegar"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Ocultar"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Invertir el orden de plegado en ventana emergente"

#: lazarusidestrconsts.dlgcogdb
#, fuzzy
#| msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Generar información de depuración para GDB (Retarda la compilación / incrementa tamaño del fichero .exe)"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Usar la unidad Heaptrc (comprobacion de perdidas de memoria(mem-leaks))"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Archivos de inclusión (-Fi):"

#: lazarusidestrconsts.dlgcoinfoforgdb
#, fuzzy
#| msgid "Info for GDB"
msgid "Debugger info"
msgstr "Información para GDB"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Librerias (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Enlazando"

#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Las opciones del compilador se pueden guardar en un fichero XML."

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Color"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Editar color)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Sin modificar"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Colores"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parámetros de la línea de comandos (sin el nombre de la aplicación)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
#, fuzzy
#| msgid "Make default indent for new line if comment opens at column:"
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Hacer por defecto sangrado para nueva línea si un comentario se abre en columna:"

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Límite de sangrado a"

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Prefijos de comentarios en salto de línea"

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Concide la línea actual"

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Concide el texto incluyendo \"*\" de muestra \"(*\""

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Coincidir toda la línea"

#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr "Coincidir texto después de muestra \"%s\""

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr "Coincide texto incluido muestra \"%s\""

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Prefijo nueva línea"

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Alinear Prefijo con el sangrado de la línea anterior"

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Alinear Prefijo a continuación de inicio de comentario en primera línea de comentario"

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "No sangrar el prefijo"

#: lazarusidestrconsts.dlgcommentindentgroupoptions
#, fuzzy
#| msgid "Comments"
msgid "Comments and Strings"
msgstr "Comentarios"

#: lazarusidestrconsts.dlgcommentshlashextendalways
#, fuzzy
#| msgid "Extend, if matched or not matched"
msgid "Extend if matched or not matched"
msgstr "Extender, si coincide o no coincide"

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
#, fuzzy
#| msgid "Extend, if matched or not matched (not at EOL)"
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Extender, si coincide o no coincide (no en EOL)"

#: lazarusidestrconsts.dlgcommentshlashextendmatch
#, fuzzy
#| msgid "Extend, if matched"
msgid "Extend if matched"
msgstr "Extender, si coincide"

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
#, fuzzy
#| msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Extender, si coincide y cursor en el medio de texto (no en EOL)"

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Compilación y Enlazando"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Mensajes del compilador"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Archivo de idioma de los mensajes del compilador (*.msg)"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opciones del Compilador"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completar Propiedades"

#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Se selecciona primero el componente bajo el cursor del ratón, después el menú emergente trabaja en él."

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Configuración y Objetivo"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Archivos de configuración"

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Otra información de depuración"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Desbordamiento"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Procesando"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Copiar/Pegar con información de plegado"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
#, fuzzy
#| msgid "Copy word on copy none"
msgid "Copy current word when no selection exists"
msgstr "Copiar palabra al Copiar Nada"

#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Rango"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Reubicable"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Establecer las opciones del compilador por defecto"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr "Mostrar errores"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "Mo&strar Opciones"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Enlazado Inteligente"

#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Otras fuentes (archivos .pp/.pas, usados solo por el IDE pero no por el compilador)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Pila(stack)"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Eliminar símbolos del ejecutable"

#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Tipo de información de depuración"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automático"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Dwarf con conjuntos"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Dwarf3 (beta)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Ensuciar variables"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Estilo de unidad"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Generar código para valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Verbosidad"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE Estilizado C++"

#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Crear un nuevos ajustes de Parámetros de ejecución"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Llaves { }"

#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Actualmente respetado por la ventana de mensajes, historial de saltos y resultados de búsqueda."

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor más allá de EOL"

#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipsselection
#, fuzzy
#| msgid "Cursor skips selection"
msgid "Caret skips selection"
msgstr "Cursor salta la selección"

#: lazarusidestrconsts.dlgcursorskipstab
#, fuzzy
#| msgid "Cursor skips tabs"
msgid "Caret skips tabs"
msgstr "Cursor salta tabulaciones"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Extensión definida por usuario (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "depurar"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Ruta del editor"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Tipo de depurador y ruta"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Fuente predeterminada del editor"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valor predeterminado"

#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Borrar modo"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Borrar"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr ""

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Borrar plantilla "

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Botones - "

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Descripciones"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menús - "

#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Nombre de escritorio"

#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "%d escritorio(s) exportados satisfactoriamente hacia \"%s\""

#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "%d escritorio(s) importados(s) satisfactoriamente desde \"%s\""

#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Diferentes valores de fondo"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Dirección"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Desactivar anti-aliasing"

#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "La distancia entre puntos de la rejilla es la de menor paso cuando se mueve un control."

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Usar el mismo color que el margen derecho"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Dibujar nivel divisor"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Color de líneas anidadas"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Color de Línea"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedimiento/Función"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (local)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Secciones de la Unidad"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Clausula Uses"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"

#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Dibujar debajo del componente su nombre."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Atrás"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Negrita"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Subdirectorio"

#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Plantillas de Código"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Añadir sentencia de finalización en bloques Pascal"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Extensión definida por usuario"

#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr "(%s seg. de retardo)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Visualizar"

#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Archivos del Editor"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Completado de identificador"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Invertir"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorar Bloqueos, usar el editor menos usado"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorar Bloqueos, si el editor es el actual"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorar Bloqueos, si el editor está en la ventana actual"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Bloqueado, si el texto está a la vista"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Desbloqueado"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Desbloqueado, si el texto está a la vista y centrado"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Pestaña nueva, existente o en ventana nueva"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Pestaña nueva en ventana nueva"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Pestaña nueva en ventana existente"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Esta opción usará el editor menos usado para un archivo, incluso si esta bloqueado y/o necesita desplazamiento. La decisión de cuál es el editor menos usado no será determinada por el orden en el que las ventanas fueron enfocadas, incluso si está establecido por la configuración \"Orden para el mismo criterio\". Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Esta opción comprobará si el editor actualmente activo tiene el archivo de destino y si es así, será usado, incluso si está bloqueado y/o necesita desplazamiento"

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Esta opción comprobará si hay un editor para el archivo de destino en la ventana actual y si es así, este editor será usado, incluso si está bloqueado y/o necesita desplazamiento"

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
#, fuzzy
#| msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Esta opción usará un editor bloqueado (y únicamente uno bloqueado), el cuál no necesite desplazamiento para mostrar el punto de destino del salto (ya estará en el area visible de la pantalla)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Esta opción usará cualquier editor sin bloquear"

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
#, fuzzy
#| msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Esta opción usará un editor sin bloquear, el cuál no necesite desplazamiento para para mostrar el punto de destino del salto (ya estará en el area visible de la pantalla, excluyendo 2-5 líneas en la parte superior/inferior)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
#, fuzzy
#| msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Esta opción abrirá una pestaña nueva en una ventana existente o nueva, si no se encuentra ninguna pestaña bloqueada. Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Si no se encuentra ninguna pestaña bloqueada, entonces esta opción abrirá una pestaña nueva en una ventana nueva (incluso si otras ventanas existentes pudieran ser usadas para la pestaña nueva). Esta opción siempre será exitosa, las demás opciones no serán comprobadas nunca."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#, fuzzy
#| msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Si no se encuentra ninguna pestaña bloqueada esta opción abrirá una pestaña nueva en una ventana existente (y únicamente en una existente). La pestaña solo será abierta si una ventana existe y que aún no tenga un editor para el archivo de destino"

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Cursiva"

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Tamaño fuente del editor"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opciones del editor"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Combinaciones globales"

#: lazarusidestrconsts.dlgedmisc
#, fuzzy
#| msgid "Misc"
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Miscelánea"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "No Usar"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Usar"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tabulación y Sangrado"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Subrayado"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Atributos del Elemento"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Saltar al end más cercano con la tecla END"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Preguntar"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Nota: Todos los archivos del proyecto se encuentran en el directorio de proyecto."

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Copia de seguridad"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Archivos"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Rejilla"

#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr ""

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Idioma"

#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr "Lenguaje de todas las cadenas del IDE. Para mejores resultados, reinicie el IDE después de cambiarlo"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Líneas guía"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Miscelánea"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Nada"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Otros Archivos"

#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Pestañas de Proyecto"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipo"

#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Enfocar los mensajes en compilación"

#: lazarusidestrconsts.dlgextracharspacing
#, fuzzy
#| msgid "Extra char spacing"
msgid "Extra character spacing"
msgstr "Espaciado extra entre letras"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Espaciando línea extra"

#: lazarusidestrconsts.dlgextsymb
#, fuzzy
#| msgid "Use external gdb debug symbols file"
msgid "Use external debug symbols file"
msgstr "Usar archivo externo de símbolos de depuración para gdb"

#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr ""

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Extensiones de archivo"

#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr "%s archivos"

#: lazarusidestrconsts.dlgfilterall
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Todos los archivos"

#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "Fichero plantilla de CodeTools"

#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "Archivo DCI"

#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Formulario Delphi"

#: lazarusidestrconsts.dlgfilterdelphipackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Paquete Delphi"

#: lazarusidestrconsts.dlgfilterdelphiproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Proyecto Delphi"

#: lazarusidestrconsts.dlgfilterdelphiunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Unidad Delphi"

#: lazarusidestrconsts.dlgfilterexecutable
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Ejecutable"

#: lazarusidestrconsts.dlgfilterfpcmessagefile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "Archivo mensaje FPC"

#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "Archivos HTML"

#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Imágenes Bitmap"

#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Imágenes Pixmap"

#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "Imágenes PNG"

#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Opciones de Escritorio de Lazarus"

#: lazarusidestrconsts.dlgfilterlazaruseditorfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Tipos de archivo del editor"

#: lazarusidestrconsts.dlgfilterlazarusfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Fichero de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusform
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Formulario de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusinclude
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Fichero include de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusotherfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Lazarus otro archivo"

#: lazarusidestrconsts.dlgfilterlazaruspackage
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Paquete de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusproject
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Proyecto de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusprojectsource
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Fuente de proyecto de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Sesión de Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusunit
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Unidad de Lazarus"

#: lazarusidestrconsts.dlgfilterpascalfile
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Archivo Pascal"

#: lazarusidestrconsts.dlgfilterprograms
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programas"

#: lazarusidestrconsts.dlgfilterxml
#, fuzzy
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Archivos XML"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Buscar texto desde el cursor"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Fragmento"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Sección de Fragmento"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Comentario"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nodo"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Elemento"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Lista <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objecto (heredado, en línea)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Comentario (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (anidados)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Comentario { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Comentarios anidados"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedure)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedimiento"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programa"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Comentario //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unidad"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Sección Unit"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"

#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"

#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Comentario"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nodo"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Procesando Instrucción"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "Fuerza el escalado DPI en tiempo de diseño"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Cuando esta marcado, los ajustes de scalado del proyecto serán ignorados - solo se tendrán en cuenta las propiedades de escalado de formularios/frame/datamodule."

#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "La instancia de Lazarus en ejecución no puede aceptar ningún archivo."

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Color de texto"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Cambiar el contenido del Inspector de Objetos al hacer click en la barra de título del formulario"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Mostrar las propiedades del formulario en el Inspector de Objetos al hacer click en su barra de título."

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Política de inserción de Procedimientos"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Mantener el orden de los procedimientos"

#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Ejecutable del compilador (e.g. %s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Directorio de las fuentes de FPC"

#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr ""

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Marco de Texto"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor de Formulario"

#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Desde el principio"

#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From cursor"
msgid "From c&ursor"
msgstr "&Desde el cursor"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Generar código para gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Coger color"

#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Escritorios en gris son para entornos con acoplamiento"

#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Escritorios en gris son para entornos sin acoplamiento."

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Color de rejilla"

#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "La rejilla consiste en pequeños puntos que ayudan a alinear los controles."

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Tamaño X de rejilla"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Tamaño de paso de la rejilla Horizontal"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Tamaño Y de rejilla"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Tamaño de paso vertical de la rejilla"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Depurador"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Entorno"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Deshacer en grupo"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Mostrar líneas guía"

#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Cuando se alinea un control horizontal o verticalmente se muestra una línea azul de guía."

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Columna de marcas"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Colapsado"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Color de la columna de marcas"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Color del borde de la columna de marcas"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Indice del separador de la columna de marcas"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Desplazar media página"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Tamaños del montón (Heap) y pila (stack)"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Tamaño del montón (Heap)"

#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Altura de una propiedad en la rejilla."

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Altura:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Esconder ventanas del IDE al ejecutar"

#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "No mostrar el IDE mientras el programa está en ejecución."

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Esconder pestaña en ventanas con una sola página"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Color de Realce"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Color Resaltado de fuente"

#: lazarusidestrconsts.dlghighlightleftofcursor
#, fuzzy
#| msgid "Left Of Cursor"
msgid "Left Of Caret"
msgstr "A la izquierda del cursor"

#: lazarusidestrconsts.dlghighlightrightofcursor
#, fuzzy
#| msgid "Right Of Cursor"
msgid "Right Of Caret"
msgstr "A la derecha del cursor"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Mostrar sugerencias por parámetro \"Sender\" no usado"

#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Mostrar sugerencias de unidades no usadas en la principal (main)"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "La tecla inicio va al comienzo más cercano"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Aplicación anfitriona"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Completado de identificador"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Política de Identificadores"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Opciones del IDE"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Código $IFDEF activo"

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Código $IFDEF inactivo"

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Inclusión de código de estado $IFDEF mixto"

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Nodo $IFDEF activo"

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Nodo $IFDEF inactivo"

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Inclusión de nodo de estado $IFDEF mixto"

#: lazarusidestrconsts.dlgimportdesktopexists
#, fuzzy
#| msgid ""
#| "A desktop with the same name already exists.\n"
#| "Please confirm the desktop name:\n"
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
"Existe un escritorio con el mismo nombre.\n"
"Por favor, confirme el nombre del escritorio:\n"

#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr ""

#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Incluir identificadores que contengan el prefijo"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Incluir variables del sistema"

#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Incluir palabras"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "no incluir"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "desde todas las unidades"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "desde la unidad actual"

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Sangrado"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Tabulaciónes"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Delante de los métodos"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "El nombre del constructor debe de ser 'init' (el del destructor debe ser 'done')"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Insertar partes de clase"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementación"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interfaz"

#: lazarusidestrconsts.dlginsertmethods
#, fuzzy
#| msgid "Insert methods"
msgid "Insert method implementations"
msgstr "Insertar métodos"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Insertar en la sección Uses"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Insertar espacio después de"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Insertar espacio delante de"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervalo en segundos"

#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Posición vertical para un salto de bloque de código en % (0=parte superior, 100=parte inferior)"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Saltar (por ejemplo, Saltar a método)"

#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Posición vertical para un solo salto de línea en % (0=parte superior, 100=parte inferior)"

#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Saltar directamente hacia un método del cuerpo"

#: lazarusidestrconsts.dlgkeepcursorx
#, fuzzy
#| msgid "Keep cursor X position"
msgid "Keep caret X position when navigating up/down"
msgstr "Mantener posición X del cursor"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Editar Llave)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Atajos de teclado"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Errores de acceso rápido"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Política de Palabras Claves"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Permitir LABEL y GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Lenguaje"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "El último (es decir, al final del código)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Directorio de Lazarus (predeterminado para todos los proyectos)"

#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr ""

#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Líneas guía Izquierda,Arriba"

#: lazarusidestrconsts.dlglevel1opt
#, fuzzy
#| msgid "1 (quick, debugger friendly)"
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "1 (rápido y amigable con el depurador)"

#: lazarusidestrconsts.dlglevel2opt
#, fuzzy
#| msgid "2 (quick optimizations)"
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (optimizaciones rápidas)"

#: lazarusidestrconsts.dlglevel3opt
#, fuzzy
#| msgid "3 (slow optimizations)"
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (optimizaciones lentas)"

#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (optimizaciones agresivas, tener cuidado)"

#: lazarusidestrconsts.dlglevelnoneopt
#, fuzzy
#| msgid "0 (no optimization)"
msgid "0 (no optimization, for debugging)"
msgstr "0 (sin optimización)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "División de líneas"

#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Enlazado inteligente"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Visualizar números de líneas en los errores de tiempo de ejecución en trazados inversos"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menú Principal"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Ver Formularios del Proyecto"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Mostrar frames del proyecto"

#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Ver Unidades del Proyecto"

#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "\"Make\" ejecutable"

#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Administrar escritorios"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margen y columna de marcas"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Color de marca"

#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Marca-vertical"

#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Highlight of Word under Caret"
msgid "Highlight all occurrences of Word under Caret"
msgstr "Resaltado de la palabra bajo el Cursor de Texto"

#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Contorno (global)"

#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Marcado definido por el usuario"

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Borrar"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr "¿Borrar lista \"%s\"?"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr "Añadir palabra o término"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr "Eliminar palabra o término"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr "Cambiar palabra o término"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Término duplicado"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "El término %s ya existe. Los duplicados se quitarán cuando se guarde la lista."

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Añadir/Quitar en todos los editores"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Borrar lista"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nombre"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Añadir lista"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Sensible a mayúsculas y minúsculas"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Establecer límite al finalizar el término"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Establecer límite al comenzar el término"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Ignorar los límites de terminos más largos"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "selección"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "palabra actual"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Configuración de términos añadidas por clave"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Selecion inteligente de coincidencias para establecer límites"

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Nueva lista"

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "No hay listas"

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Seleccione ..."

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr "Configuración de teclas"

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Configuración principal"

#: lazarusidestrconsts.dlgmarkupwordbracket
#, fuzzy
#| msgid "Word Brackets on caret (global)"
msgid "Keyword brackets on caret (global)"
msgstr "Soporte de palabras en signos de intercalación (global)"

#: lazarusidestrconsts.dlgmarkupwordfulllen
#, fuzzy
#| msgid "Match word boundaries for words up to this length:"
msgid "Match whole words, if length is less or equal to:"
msgstr "Coincidir límites de palabra para palabras de hasta esta longitud:"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Ignorar palabras clave"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr "Desactivar temporizador para señalización de palabra actual"

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Recortar espacios (cuando se realce la selección actual)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Contador máximo"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Longitud máxima de línea:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Nº Máximo de archivos recientes"

#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "Valor 0 significa sin limites"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Nº Máximo de archivos de proyecto recientes"

#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr ""

#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr ""

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mezclar métodos y propiedades"

#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Modo"

#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Acción de ratón"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Simple"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Doble"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triple"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Cuádruple"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Cualquiera"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Izquierdo"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Medio"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Convertir en último recurso"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Derecho"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Rueda de ratón abajo"

#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Rueda de ratón arriba"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Capturar"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Mover cursor de texto (extra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Actuar al soltar el botón del ratón"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Acción"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Clic"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Editar Ratón"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Entrada Duplicada"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Esta entrada está en conflicto con una entrada ya existente"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Botón"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Cursor de texto"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contexto"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Clic"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Acción"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Arriba/Abajo"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Opción"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Ordenar"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Prioridad"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Ratón"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avanzado"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Comando-IDE"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "s"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "S"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Todo"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Columna de marcas"

#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Cambios de linea"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Plegado de Código"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Colapsado [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Expandido [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Información general"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Información general de marca"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Números de Línea"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Texto"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Selección"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opt"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Otras acciones que usan el mismo botón"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Estos se pueden ejecutar dependiendo de las teclas modificadoras, Ajustes Predeterminados, Simple/Doble, Arriba/Abajo ..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtrar Teclas-Modificadoras"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Prioridad"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Mensajes"

#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Depurar"

#: lazarusidestrconsts.dlgmsgwincolorurgenterror
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Error"

#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Fatal"

#: lazarusidestrconsts.dlgmsgwincolorurgenthint
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Indicación"

#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Importante"

#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Normal"

#: lazarusidestrconsts.dlgmsgwincolorurgentnote
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Nota"

#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Pánico"

#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Tiempo y estadísticas"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Explicativo"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Explicativo 1"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Explicativo 2"

#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
#, fuzzy
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Advertencia"

#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "Teclas de desplazamiento mueve todos los símbolos de intercalación (columna seleccionada)"

#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "Saltar la tecla borrar al final de línea (no juntar líneas)"

#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Multi-símbolo de intercalación"

#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "Teclas de navegación mueven todos los simbolos de intercalación"

#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Habilitar múltiple-símbolo de intercalación para la selección de columna"

#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "siempre iniciar una nueva instancia"

#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "no permitir multiple instancias"

#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "abrir archivos en una instancia en ejecución"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Multiselección"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find Editor for Jump Targets"
msgid "Jump target priority between multiple editors"
msgstr "Encontrar editor para los objetivos de un salto"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Orden de uso de editores que coincidan con el mismo criterio"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Editor enfocado más recientemente para este archivo"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (para el archivo) en la ventana enfocada más recientemente"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Lista de prioridades de los criterios para elegir un editor:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Páginas y Ventanas"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Pestañas del Editor"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nombrar"

#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Nuevo escritorio ..."

#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr ""

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "No renombrar automáticamente"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "No hay unidades disponible a añadir."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Sin Realce"

#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background color (e. g. TDataModule)"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Posición de las pestañas en el editor"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "No dividir la línea después de"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "No dividir la línea delante de"

#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr ""

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspector de Objetos"

#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "Altura de elemento"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Miscelánea"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "configuración rápida"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Usar Ajustes pretederminados de Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Usar ajustes predeterminados de Lazarus"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Niveles de optimización"

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Otras optimizaciones"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Otros archivos de unidad (-Fu):"

#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr ""

#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr ""

#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr ""

#: lazarusidestrconsts.dlgoverviewgutterpagecolor
#, fuzzy
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr "Página"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Sobreescribir bloque"

#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format, fuzzy
#| msgid ""
#| "Desktop with the name \"%s\" was found.\n"
#| "Should the old desktop be overwritten?\n"
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
"Escritorio con el nombre \"%s\" fue encontrado.\n"
"¿Debería el antiguo escritorio ser sobre-escrito?\n"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Descripciones para la paleta de componentes"

#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Extensión Pascal predeterminada"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Resaltar sentencias de control como palabras clave"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Opciones de palabras clave en extended Pascal"

#: lazarusidestrconsts.dlgpaskeywordsmarkup
#, fuzzy
msgid "Markup (on caret)"
msgstr "Margen (en caret)"

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Palabras clave coincidentes"

#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Contorno"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Pasar opciones al enlazador con \"-k\", el delimitador es un espacio"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Resaltar palabra(s) clave  \"String\""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Predeterminada"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Nada"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Solo \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Bloque persistente"

#: lazarusidestrconsts.dlgpersistentcursor
#, fuzzy
#| msgid "Persistent cursor"
msgid "Visible caret in unfocused editor"
msgstr "Cursor Persistente"

#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Simbolo de intercalación en editor sin foco no parpadea"

#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr ""

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplicación"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "como invocador (asInvoker)"

#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "Quitar I&cono"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Crear envoltorio de la aplicación"

#: lazarusidestrconsts.dlgpodebugger
#, fuzzy
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Depurador"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Cargar Pre&determinado"

#: lazarusidestrconsts.dlgpodpiawareness
#, fuzzy
msgid "DPI awareness"
msgstr "DPI awareness"

#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "apagado"

#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: apagado, 8.1+:por monitor"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: encendido, 8.1+:por monitor"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8: encendido, 8.1/10+:por monitor/V2"

#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "encendido"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Nivel de ejecución"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formulario"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "el mas alto disponible (highestAvailable)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "Internacionalización (i18n)"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Icono:"

#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(tamaño: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(ninguno)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "Cargar Icono"

#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness"
msgstr ""

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Miscelánea"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "requiere administrador (requireAdministrator)"

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Recursos"

#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "Guardar Icono"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sesión"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Título:"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Acceso UI (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Use el envoltorio de la aplicación para ejecución y depuración"

#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Usar el escalado LCL (Hi-DPI)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "Usar el archivo de manifiesto para activar temas"

#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Preferido doble-clic frente a simple-clic"

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Prioridades"

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Proyecto"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opciones del Proyecto"

#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Opciones para el Proyecto: %s"

#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr ""

#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Archivos del proyecto"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "&Preguntar al reemplazar"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Completado de propiedades"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nombre de la propiedad"

#: lazarusidestrconsts.dlgqopenlastprj
#, fuzzy
#| msgid "Open last project at start"
msgid "Open last project and packages at start"
msgstr "Abrir último proyecto al iniciar"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Mostrar espaciado del borde"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Mostrar rejilla"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Ajustar a rejilla"

#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr "¿Borrar realmente el escritorio \"%s\"?"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referencia"

#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "Expresiones &regulares"

#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Renombrar escritorio"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Renombrar"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr ""

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Reemplazar &todo"

#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace with"
msgid "Replace wit&h"
msgstr "&Reemplazar con"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Informe"

#: lazarusidestrconsts.dlgreset
#, fuzzy
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr "Resetear"

#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr ""

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Líneas guía Derecha,Abajo"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Click derecho selecciona"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margen derecho"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Directorio de trabajo"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Seleccionar nietos"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Creación de goma elástica"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Selección de goma elástica"

#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format, fuzzy
#| msgid ""
#| "The running Lazarus instance cannot accept any files.\n"
#| "Do you want to open them in a new IDE instance?\n"
#| "\n"
#| "%s\n"
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
"La instancia en ejecución de Lazarus no puede abrir ningún archivo.\n"
"¿Desea abrirlo en una nueva instancia del IDE?\n"
"\n"
"%s\n"

#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "La instancia de Lazarus está ejecutándose pero no responde."

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Display (no para win32, e.j. 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Entorno"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Local"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variables del sistema"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Usar pantalla"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Usar reemplazos"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Parámetros de ejecución"

#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr ""

#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Guardar el actual escritorio como"

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr ""

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr ""

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Línea guardada"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Guardar información del editor para archivos cerrados"

#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Los ficheros están disponibles en el listado de historial \"Open Recent\""

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Guardar información del Editor sólo para archivos del proyecto"

#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Solamente ficheros que pertenecen a este proyecto."

#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Guardar en"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Desplazar una menos"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Desplazamiento"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Mostrar descripción de desplazamiento"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Desplazar después de fin de archivo"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Caret past end of line"
msgid "Allow caret to move past end of line"
msgstr "Cursor sobrepasa fin de línea"

#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr "Directorio de búsqueda \"%s\" no encontrado."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Búsqueda terminada por el usuario"

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Buscando ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Rutas"

#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Alcance de la búsqueda"

#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Selecciona todos los controles hijos junto con su padre."

#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr ""

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "Texto &Seleccionado"

#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr "Establecer activo"

#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
#, fuzzy
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr "Establecer activo"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Asignar predeterminado en todos los elementos"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Asignar predeterminado al elemento"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Fijar propiedad Variable"

#: lazarusidestrconsts.dlgsetpropertyvariablehint
#, fuzzy
msgid "The parameter name for the default setter procedure."
msgstr "Nombre de parámetro para el procedimiento por defecto de asignación."

#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "es prefijo"

#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "Si es marcado, \"Establecer la propiedad de la variable\" es una prefijo. De otro modo es una nombre fijo."

#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "Usar const"

#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
#, fuzzy
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "Si es marcado, el parámetro establecido es marcado como \"const\"."

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Mostrar todas las unidades"

#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
#, fuzzy
#| msgid "Show captions of non-visual components"
msgid "Show captions of nonvisual components"
msgstr "Mostrar texto de componentes no visuales"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Mostrar procedimentos compilados"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Mostrar números de línea"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Mostrar condicionales"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Mostrar información de depuración"

#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Mostrar sugerencias de diseño"

#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "Sugerencia muestra la posición de los controles o el tamaño mientras se mueve o redimensiona"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Mostrar todo"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Mostrar información del ejecutable (Sólo Win32)"

#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Mostrar el nombre del archivo en el título"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Mostrar información general"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Mostrar sugerencias en la columna de marcas"

#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Mostrar sugerencias"

#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Mostrando ventanas"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Mostrar números de línea"

#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Mostrar iconos de mensajes"

#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Mostrar notas"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Mostrar resumen"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Mostrar archivos probados"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Mostrar archivos usados"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Mostrar advertencias"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Mostrar un único boton en la barra de tareas"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Omitir declaraciones de clase forward"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Barra oblicua //"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tabuladores inteligentes"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Símbolo atrás (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Contador (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Símbolo delante (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Ajustar a líneas guía"

#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Cuando el control está a punto de alinearse con otro control, se ajusta a la posición de alineación."

#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Tabulación multilínea"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Espacio"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Descripciones en los botones principales (abrir, guardar, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor de código"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origen"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Tamaño pila (stack)"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr "Palabra clave estática en los Objetos"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Parar después de número de errores:"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Anexar texto para cerrar la cadena"

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Cadena de prefijo en nueva línea"

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Cadena ''"

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Extender cadenas en rupturas de línea"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "SubPropiedades"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opciones de sintaxis"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulador sangra bloques"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Mostrar números en las pestañas del editor"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabuladores a espacios"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Ancho del Tabulador"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Familia CPU objetivo"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "SO objetivo"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Plataforma objetivo"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Procesador objetivo"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Opciones de objetivo específicas"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Directorio para construir proyectos de prueba"

#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Estilo-Texto"

#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Texto a buscar"

#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr ""

#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
#, fuzzy
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr "Cambiar como escritorio de depuración"

#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
#, fuzzy
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr "Cambiar como escritorio de depuración"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Pista del actual clase/Procedimiento"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Estilo de recorte de espacios"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Cursor de Texto o Editor"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Línea Editada"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Abandonar línea"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Solamente posición"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Quitar espacios sobrantes"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Deshacer después de guardar"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Deshacer / Rehacer"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Límite para deshacer"

#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Dependencias de Unidad"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Refrescar"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Directorio de salida de la unidad (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Línea sin guardar"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Plegando código"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Usar archivo adicional de configuración de compilador"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Dibujado de Divisor"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Usar el archivo estandar de configuración del compilador (fpc.cfg)"

#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr ""

#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Iconos en el cuadro de finalización de código"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Usar al lanzar aplicación"

#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "IME manejados por el Sistema"

#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr "Falló al cargar el archivo de combinaciones del usuario %s"

#: lazarusidestrconsts.dlguseschemedefaults
#, fuzzy
#| msgid "Use (and edit) global scheme settings"
msgid "- Scheme globals -"
msgstr "Usar (y editar) ajustes de combinación global"

#: lazarusidestrconsts.dlguseschemelocal
#, fuzzy
#| msgid "Use local scheme settings"
msgid "selected language"
msgstr "Usar ajustes de combinación local"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Usar resaltado de sintaxis"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Usar historial cuando cierre pestañas"

#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Añadir unidad a la sección uses"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valor"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Detalles durante la compilación:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Columna de marcas visible"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Ver margen derecho"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "Sólo &Palabras Completas"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Anchura:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplicación gráfica Win32"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Ventana"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Excepciones"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Palabras"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Vista previa"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Escribir logo FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Los componentes multiseleccionados deben ser de un único formulario."

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Alinear ..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Borrar Selección"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Reflejar Horizontal"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Reflejar Vertical"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Retroceder Uno"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Avanzar Uno"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Mover al Fondo"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Mover al Frente"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Resetear ..."

#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Guardar formulario como XML"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Escala ..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Escala"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Seleccionar Todo"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Tamaño ..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Tamaño"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opción: Ajustar a rejilla"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opción: Ajustar a líneas guía"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Orden-Z"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "En ambos Lados"

#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Limpiar todas las instantáneas"

#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Alternar vista instantánea o actual"

#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Tomar instantánea"

#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Interruptor de encendido/apagado instantáneas automáticas"

#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Eliminar la entrada seleccionada"

#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Ver historial"

#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Ver Instantaneas"

#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr "Ubicación"

#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Tiempo"

#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Historial"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = no, 1 = dibujar líneas divisorias solo para el nivel superior, 2 = dibujar líneas para los dos primeros niveles, ..."

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Añadir Archivos"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipo del ancestro ambiguo"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nombre de Clase Ambiguo"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nombre de Unidad ambiguo"

#: lazarusidestrconsts.lisa2pancestortype
#, fuzzy
#| msgid "Ancestor Type"
msgid "Ancestor type"
msgstr "Tipo del ancestro"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Una unidad Pascal debe tener la extensión .pp o .pas"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dependencias rotas"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Ya existe ese nombre de Clase"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Crear Nuevo Componente"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr "Crear Nuevo Archivo"

#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Crear Nuevo Requisito"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dependencia"

#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr ""

#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr "Archivo existente: \"%s\""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Ya existe el archivo"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr "El archivo \"%s\" ya existe en el paquete."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "El archivo está usado."

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Nombre de archivo/URL"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "El archivo no es una unidad"

#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr ""

#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr ""

#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipo del Ancestro no válido"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Dependencia circular invalida"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nombre de Clase no válido"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Archivo no válido"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nombre de archivo no válido"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nombre de Unidad no válido"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" no es un nombre válido de unidad."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nuevo nombre de clase:"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nuevo archivo"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "No se ha encontrado un paquete para la dependencia \"%s\".%sPor favor seleccione un paquete existente."

#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Paquete/Proyecto"

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nombre de página demasiado largo"

#: lazarusidestrconsts.lisa2ppalettepage
#, fuzzy
#| msgid "Palette Page:"
msgid "Palette page:"
msgstr "Página de paleta:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Las unidades de Pascal deben tener la extensión .pp or .pas"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Recortar o expandir nombre de archivo"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Mostar todo"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "El tipo ancestro \"%s\" tiene el mismo nombre que %s la unidad \"%s\""

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "El tipo ancestro \"%s\" no es un identificador de pascal válido."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "El nombre de clase \"%s\" y su tipo ancestro \"%s\" son el mismo."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "El nombre de clase \"%s\" ya existe en%sPaquete %s%sArchivo: \"%s\""

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "El nombre de clase \"%s\" tiene el mismo nombre que%s la unidad \"%s\"."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "El nombre de clase \"%s\" no es un identificador de pascal válido."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "El archivo \"%s\" es parte del proyecto actual.%sEs una mala idea compartir archivos entre proyectos y paquetes."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format, fuzzy
#| msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "El nombre de archivo \"%s\" es ambiguo porque el paquete no tiene todavía un directorio predeterminado.%sPor favor, especifique un nombre de archivo con una ruta completa."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "El número máximo de versión \"%s\" no es válido.%sPor Por favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "El número máximo de versión es menor que la versión mínima."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "El número de versión mínimo \"%s\" no es válido.%sPor favor, use el formato mayor.menor.release.build%sPor ejemplo: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format
msgid "The package already has a dependency on the package \"%s\"."
msgstr "El paquete ya tiene una dependencia para el paquete \"%s\"."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "El nombre de página \"%s\" es demasiado largo (max 100 caracteres)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "El nombre de unidad \"%s\" ya existe en el paquete:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in this package."
msgstr "El nombre de unidad \"%s\" ya existe en este paquete."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "El nombre de unidad \"%s\"%sy el nombre de fichero \"%s\" son diferentes."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "El nombre de unidad \"%s\" es el mismo que el de un componente registrado.%sUsar este puede causar mensajes de error extraños."

#: lazarusidestrconsts.lisa2punitname
#, fuzzy
#| msgid "Unit Name:"
msgid "Unit name:"
msgstr "Nombre de Unidad:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Ya existe el nombre de unidad"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "¿Abandonar cambios?"

#: lazarusidestrconsts.lisabort
#, fuzzy
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "Abortar"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Abortar todo"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Abortar toda la carga"

#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Abortado"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Abortar la carga del proyecto"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Abortar toda la carga"

#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Acerca de"

#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "Acerca de %s"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentación:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Acerca del IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Acerca de Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format, fuzzy
#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Licencia: GPL/LGPL. Vea las fuentes de Lazarus y Free Pascal para detalles sobre la licencia.%sLazarus es un IDE para crear aplicaciones gráficas y de consola con Free Pascal. Free Pascal es un compilador Pascal y Object Pascal que corre en Windows, Linux, Mac OS X, FreeBSD y otros.%sLazarus es la parte del puzzle que faltaba para permitirle desarrollar programas para todas las plataformas anteriores en un entorno parecido a Delphi. El IDE es una herramienta RAD que incluye un diseñador de formularios.%sComo Lazarus está creciendo, necesitamos más desarrolladores."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "No puedo encontrar la lista de Colaboradores."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficial:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format, fuzzy
#| msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "Un %s no puede contener TControls.%sSólo puede colocar componentes no visuales en él."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Reconocimientos"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Acción:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Acciones:"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Activar"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Activa sintaxis de expresión regular para texto y reemplazo (parecido a perl)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Activar Selecionado"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Activo"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtro activo:"

#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Añadir"

#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Añadir un nuevo separador encima del elemento seleccionado"

#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Añadir un nuevo separador debajo del elemento seleccionado"

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Añades defines simulando Delphi7"

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Útil cuando el código tiene chequeos para versiones de compilador soportadas"

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr "Añadido objeto perdido \"%s\" a la fuente de Pascal."

#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr "Añadida propiedad \"%s\" para %s."

#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Añadir -FcUTF8"

#: lazarusidestrconsts.lisaddfcutf8hint
#, fuzzy
msgid "May be needed if source files have non-ansistring literals."
msgstr "Podría ser necesario si los archivos de origen tienen non-ansistring literales."

#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Añadir filtro ..."

#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "La adición no encaja el mensaje actual"

#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "La adición encaja el mensaje actual"

#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Adiciones"

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Añadir palabra clave \"do\""

#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Añadir modificador \"overload\""

#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Añadir modificador \"override\""

#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Añadir modificador \"reintroduce\""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Añadir un modo nuevo de construcción, copiando los ajustes de \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Añadir una macro nueva"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Añadir conjunto nuevo"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "¿Añadir el requerimiento del paquete?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "agregar paquete(s) a la lista de los paquetes instalados (combinar con --build-ide para reconstruir IDE)."

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Añadir paquete al proyecto"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Añadir los parentesis del parámetro"

#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Dirección:"

#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "Direcciones de Punto de Interrupción ..."

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "¿Añadir para trayecto de búsqueda de include?"

#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "¿Añadir %s al proyecto?"

#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "¿Añadir hacia los componentes de inicio?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "¿Añadir para trayecto de búsqueda de unidad?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Añadir la interfaz de la unidad"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Añadir unidad (no recomendado)"

#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr "Añadir valor a macro %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Añadir Archivo a un Paquete"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Paquete destino"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Tipo de Archivo"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Paquete no válido"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "ID del paquete no válido: \"%s\""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "El paquete es de sólo-lectura"

#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "No se ha encontrado el paquete \"%s\"."

#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Mostrar Todo"

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "El paquete %s es de sólo-lectura."

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
#, object-pascal-format
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "Ya existe el archivo \"%s\".%s¿Reemplazarlo?"

#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr "Ya existe un filtro con el nombre  \"%s\"."

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Después de la limpieza (limpiar todo o limpiar los archivos comunes), cambie a limpiar automáticamente"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Alineación"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Todos los bloques parecen correctos."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Todos los modos de construcción>"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Todas la opciones heredadas"

#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr "Todas las opciones"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Permitir Llamadas de Función"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Permitir búsqueda para múltiples líneas"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Todos los parámetros de esta función ya están establecidas en esta llamada. Nada que añadir."

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Todas sus modificaciones a \"%s\"%sse perderan y el archivo será re abierto."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alfa"

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Tecla alternativa"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Tecla alternativa (o secuencía de 2 teclas)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Siempre"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Siempre convertir el nombre sugerido por defecto a minúsculas"

#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Siempre dibujar los elementos seleccionados enfocados"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Siempre ignorar"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Una macro con ese nombre ya existe."

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Encontrado archivo ambiguo"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Encontrado archivo ambiguo: \"%s\"%sEste archivo puede confundirse con \"%s\"%s¿Borrar el archivo ambiguo?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Encontrados archivos ambiguos"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous unit found"
msgstr "Se encontró Unidad Ambigua"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Anclaje parte inferior a la parte inferior de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Anclaje parte inferior a la parte superior de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor de anclaje - ningún control seleccionado"

#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr "Activado = Incluir %s en Anclaje"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Anclaje de lado izquierdo a lado izquierdo de hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Anclaje del lado izquierdo al lado derecho del hermano. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Anclaje lado derecho al lado izquierdo de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Anclaje lado derecho al lado derecho de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."

#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr "Anclajes de %s"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Anclajes de los controles seleccionados"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Anclaje parte superior a la parte inferior de los hermanos. La distancia se define mantenido por ambas propiedades BorderSpacing de este y el hermano."

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Anclaje parte superior al lado de la parte superior de los hermanos. Utilice BorderSpacing para establecer la distancia. BorderSpacing de hermano se ignora."

#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "¡Ocurrió un error en el último inicio mientras se cargaba %s!%s¿Cargar este proyecto otra vez?"

#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Apariencia"

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nombre de clase de la &aplicación"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Una aplicación gráfica Free Pascal utilizando la biblioteca multiplataforma LCL para su GUI."

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Aplicar"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Aplicar también las opciones de Construcción (-B) a las dependencias"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Aplicar convenciones"

#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Ajustar nombre, extensión y mayúsculas-minúsculas para plataformas y tipo de ficheros."

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "La unidad del proyecto no puede usarse en otros paquetes/proyectos"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Espacio de borde alrededor del control. Los otros cuatro espacios se añaden a este valor."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Preguntar antes de reemplazar cada coincidencia"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Preguntar antes del salvado de la sesión del proyecto"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Preguntar por el nombre del componente despues de ponerlo en el diseñador de formularios."

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Preguntar por el nombre de archivo al crear uno nuevo"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Preguntar nombre al crear"

#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr "Una opción útil en sistemas Windows es la siguiente: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"

#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Ajustar automáticamente el alto de la ventana principal del IDE"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Mostrar la paleta de componentes completa"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Si la paleta de componentes abarca más líneas, mostrar todas y no solo una."

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Completar Automáticamente: desactivado"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Completar Automáticamente: activado"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Continuación Automática despues de:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Marcas y Coincidencias"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automático"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automáticamente"

#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Convertir automáticamente los ficheros .lfm (lazarus forms) a ficheros de recursos lazarus .lrs (lazarus resources)"

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "selección no completa"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Invocar automáticamente después del punto"

#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "salto de línea"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "espacio"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tab"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "fin de palabra"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "No agregar carácter"

#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Usar automáticamente un único identificador posible"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Completado y Descripciones"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Mostrar Automáticamente"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Disponible para instalación"

#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Modos de Construccion del proyecto disponibles:"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Hacer una copia de seguridad de los archivos modificados"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Fallo al realizar la copia de seguridad del archivo"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Hacer una copia de seguridad del directorio bajo el directorio del proyecto"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Cambiar el nombre del paquete o la versión rompe las dependencias. ¿Se cambian también las dependencias?%sEscoge Si para cambiar todas las dependencias listadas.%sEscoge Ignorar para romper las dependencias y continuar."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "empieza"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Detrás de los relacionados"

#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr "ser menos verboso (menos explicativo), se pueden dar múltiples elementos"

#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr "ser más verboso (más explicativo), se pueden dar múltiples elementos"

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Se ve mejor con la instalación de un control HTML como turbopoweriprodsgn"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Siempre construir antes de ejecutar"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Comando de construcción"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Al construir el proyecto ejecutar en su lugar el comando de construcción del archivo"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Al correr el proyecto, ejecutar el comando Correr Archivo en su lugar"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Ejecutar comando"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Cuando este archivo está activo en el editor de código"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Directorio de trabajo (deje en blanco para usar la ruta de archivo)"

#: lazarusidestrconsts.lisbinary
#, fuzzy
msgctxt "lazarusidestrconsts.lisbinary"
msgid "Binary"
msgstr "Binario"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Poner en negritas valores no predeterminados"

#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Espacio de borde"

#: lazarusidestrconsts.lisbottom
#, fuzzy
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Abajo"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Espacio de borde inferior. Este valor se añade al valor base de espacio de borde y es usado para el espacio bajo el control."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Anclaje inferior"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Inferiores"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Este es el control hermano al cual el lado inferior está anclado. Déjelo vacío para que sea el padre."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Igualar espaciado inferior"

#: lazarusidestrconsts.lisbpsdisabled
#, fuzzy
msgctxt "lazarusidestrconsts.lisbpsdisabled"
msgid "Disabled"
msgstr "Desactivado"

#: lazarusidestrconsts.lisbpsenabled
#, fuzzy
msgctxt "lazarusidestrconsts.lisbpsenabled"
msgid "Enabled"
msgstr "Activo"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Interrumpir"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Propiedades del punto de interrupción"

#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Explore y seleccione un compilador (ejemplo ppcx64"

#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Añadir"

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Cerrar"

#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Borrar"

#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr "&Añadir ..."

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Reemplazar..."

#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Activado"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Buscar"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Salir"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Eliminar"

#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "R&enombrar"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Reemplazar"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Construir"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "Construir todos los archivos del proyecto/paquete/IDE"

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Construir"

#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Construir IDE"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "Construir IDE con paquetes"

#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Construyendo"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Ha fallado la construcción de Lazarus"

#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr "Modo de construcción: %s"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Diferencias entre modos de construcción"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Diferencias de otros modos de construcción"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modo:"

#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr "El título en la barra de tareas muestra por ejemplo: project1.lpi - Release - Lazarus "

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Modos de construcción"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Construir nuevo proyecto"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Número de construcción"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Construir"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Ocupado"

#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr "%s byte"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
#, object-pascal-format
msgid "Calling %s to create Makefile from %s failed."
msgstr "Llamada a %s para crear Makefile desde %s falló."

#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Pila (stack) no evaluada"

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Cancelar"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Cancelar carga de este componente"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Cancelar carga de la unidad"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Cancelar renombrado"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "No se puede compilar el proyecto"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "No puedo copiar un componente de nivel superior."

#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "No se puede crear el archivo \"%s\""

#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "No se puede borrar el último modo"

#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr "no puedo ejecutar \"%s\""

#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr "no puedo encontrar %s"

#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr "no puedo encontrar el ejecutable \"%s\""

#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "No puedo encontrar el iniciador de Lazarus:%s%s"

#: lazarusidestrconsts.liscannotfindunit
#, object-pascal-format
msgid "Cannot find unit %s"
msgstr "no puedo encontrar la unidad %s"

#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr "no se puede abrir el formulario \"%s\""

#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr "no se puede grabar el formulario \"%s\""

#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr "no se puede sustituir el macro \"%s\""

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "No puede probar el compilador mientras esta en depuración o compilación."

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Sólo se puede cambiar la clase de TComponents."

#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr "No se puede encontrar un %s.ppu válido"

#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "comparar ficheros (no para crear parches)"

#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (%s archivos)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr "¿Realmente desea borrar archivos %s de código fuente%s%s"

#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "Cambiar Clase de %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "no clase"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilador ambiguo"

#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Por favor, compruebe el directorio de pruebas en %sHerramientas -> Opciones -> Archivos -> Directorio para construir proyectos de prueba"

#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "El compilador \"%s\" no es un archivo ejecutable.%sDetalles: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contiene "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copiar salida al portapapeles"

#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Las fechas de los archivos .ppu de FPC difieren en más de una hora.%sEsto puede significar que son de dos instalaciones diferentes.%sArchivo1: %s%sArchivo2: %s"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Error"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERROR: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "La ruta de unidad de FPC contienen un fuente: "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "símbolos de línea nuevos"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "SUGERENCIA: "

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilador no válido"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Ruta de búsqueda no válida"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Directorio de pruebas no válido"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unidad desaparecida"

#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr "Unidad RTL no encontrada: %s"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "múltiples configuraciones del compilador encontradas: "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "no se encontró fpc.cfg"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "no ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "ppu existe dos veces: %s, %s"

#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Hay un archivo .ppu más antiguo que el compilador mismo:%s%s"

#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "La unidad RTL %s no fue encontrada.%sEsto normalmente significa que su %s tiene rutas de unidades incorrectas. O su instalación está rota."

#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Hay varios compiladores Free Pascal en su path.%s%s%sQuizas ¿Ha olvidado borrar un compilador anterior?"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Saltar"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caracteres especiales"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Todos los test correctos."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "No se puede crear el Archivo de texto"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "No se puede crear el archivo de texto Pascal \"%s\"."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caracteres no usuales"

#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Advertencia"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ADVERTENCIA: "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "delimitador de ruta incorrecto"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Categorías"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complejidad"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Constantes"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Bloques Vacios"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Secciones vacias en clases"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Elementos Vacios"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procedimientos Vacios"

#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(filtro)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Seguir al cursor"

#: lazarusidestrconsts.liscein
#, object-pascal-format
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s en %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Es un control principal"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "Recuento de los parámetros considerado como \"muchos\""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procedimientos grandes"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Total de líneas para ser contadas como \"grande\""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Muchos procedimientos anidados"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Muchos parametros"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Mostrar categorías"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Mostrar Nodos Fuente"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "Total de procedimientos anidados contados como \"muchos\""

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centrar una Ventana Perdida"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrar el control horizontalmente relativo al hermano dado. BorderSpacing es ignorado."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrar el control verticalmente relativo al hermano dado. BorderSpacing es ignorado."

#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Centrar Formulario"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centrar en ventana"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centros"

#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Modo preferido de exposición"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Categoría"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Fuente"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nunca, solo manualmente"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Usado sólo en modo categoría"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Cuando esté inactivo"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Refrescar automáticamente"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Otros"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Actualizar"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Al cambiar de archivo en el editor de código"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedimientos"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Propiedades"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Propiedades publicadas sin calificador default"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Mostrar observaciones acerca de"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Estilo"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Circundante"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Lista por hacer"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tipos"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "constantes sin nombre"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Miembros no ordenados"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilidad desordenada"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variables"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Sangrado erróneo"

#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Se produjo una excepción durante la eliminación de%s\"%s:%s\"%s%s"

#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Cancelar la carga de este recurso"

#: lazarusidestrconsts.liscfeclassnotfound
#, object-pascal-format
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sClase \"%s\" no encontrada."

#: lazarusidestrconsts.liscfecomponent
#, object-pascal-format
msgid "%s%sComponent: %s:%s"
msgstr "%s%sComponente: %s:%s"

#: lazarusidestrconsts.liscfecomponentclass
#, object-pascal-format
msgid "%s%sComponent Class: %s"
msgstr "%s%sComponente de Clase: %s"

#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Continuar carga"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "No se sabe cómo copiar esta selección de edición del formulario"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "No se sabe cómo cortar esta selección de edición del formulario"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "No se sabe cómo borrar esta selección de edición del formulario"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Error al crear el componente"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr "Error al crear el componente: %s%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Error al destruir el componente"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Error al destruir el componente de tipo %s de la unidad %s:%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Error al destruir el mediador"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Error al destruir el mediador %s de la unidad %s:%s%s"

#: lazarusidestrconsts.liscfeerrorreading
#, object-pascal-format
msgid "Error reading %s"
msgstr "Error al leer %s"

#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr "En archivo %s"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Propietario del componente no válido"

#: lazarusidestrconsts.liscferoot
#, object-pascal-format
msgid "%sRoot=%s:%s"
msgstr "%sRaíz=%s:%s"

#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Detener todas las cargas"

#: lazarusidestrconsts.liscfestream
#, object-pascal-format
msgid "%sStream=%s"
msgstr "%sStream=%s"

#: lazarusidestrconsts.liscfestreamposition
#, object-pascal-format
msgid "%s%sStream position: %s"
msgstr "%s%sPosición del stream: %s"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm ya existe"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Tipo desconocido %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent  Donde está el TCustomNonFormDesignerForm? %s"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator ya registrado: %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "El editor de componentes de la clase \"%s\"ha creado el error:%s\"%s\""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "El componente de tipo %s no ha podido establecer su propietario a %s:%s"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr "No se puede borrar la selección de edición del formulario%s%s"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Cambiar"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Cambiar modo de construcción"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Cambiar Clase"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Cambiadas %s coordenada de %s desde \"%d\" hasta \"%d\" dentro de %s."

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Cambiar codificación"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Modificar archivo"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Cambiar Padre"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Los cambios no serán salvados"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Cambia a Unix /"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Cambia a Windows \\"

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Carácter"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa de caracteres"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Chequea Todo"

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Compruebe si hay cambios en los archivos del disco a través de contenido en lugar de timestamp (fechado)"

#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Verifique si el paquete %s genera un fichero %s.ppu, comprobar que nada borre este fichero y que no existan dos paquetes con acceso a la unidad fuente."

#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Comprueba si el paquete %s se encuentra en las dependencias"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
#, fuzzy
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Verificar si el siguiente elemento en el fuente esta en un \"end\" y si no retornar un \"LineEnding +  end; + LineEnding\""

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Comprobar opciones"

#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". comprueba el trayecto de búsqueda del paquete %s, prueba una reconstrucción limpia, comprueba la implementación de las secciones uses."

#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "Verifique el siguiente símbolo en el origen y agrega un punto y coma si es necesario."

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Comprobar el objetivo (SO, CPU, tipo de widget LCL). Tal vez tenga que recompilar el paquete para este objetivo o establecer otro objetivo para el proyecto."

#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Marcar/Desmarcar todo"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Escoja un nombre distinto"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Escoge un fichero con plantillas CodeTools"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Seleccione un enlace FPCDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Seleccione una tecla ..."

#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Escoge un nombre para el componente"

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Escojer un archivo de ejemplo"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Escoger un archivo de mensaje FPC"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Elija un archivo Pascal para ejemplos de sangrado"

#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Escoge el ejecutable para compilador (%s)"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Elija un archivo de mensajes del compilador"

#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Escoge el ejecutable para depurador"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Seleccione un paquete Delphi (*.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Seleccione un proyecto Delphi (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Escoja unidad Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Escoja directorio"

#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Escoja un ejecutable"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Escoja directorio fuente de FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Escoja Directorio de Lazarus"

#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Escoge ejecutable para \"make\""

#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Escoja nombre y texto"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Elija uno de estos elementos para crear un nuevo Archivo"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Elija uno de estos elementos para crear un nuevo Paquete"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Elija uno de estos elementos para crear un nuevo Proyecto"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Seleccione uno de esos elementos para heredar de uno existente"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Escoja archivo fuente del programa (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Elija estructura para encerrar la selección"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Seleccione el directorio para pruebas"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Dependencia circular detectada"

#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "&Clase"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Completado de Clases"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Las clases y propiedades ya existen. Los valores no fueron verificados."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "La clase \"%s\" no es una clase de componente registrada.%sNo se ha podido pegar."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Clase no encontrada"

#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr "Clase %s no encontrarda en %s(%s,%s)"

#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "La clase \"%s\" del método \"%s\" no fue encontrada."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Limpiar"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Limpiar Directorio"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Limpiar subdirectorios"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Mantener todos los archivos de texto"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Mantener archivos según el criterio indicado"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Eliminar archivos según el filtro determinado"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "sintaxis simple (e.j. * en vez de .*)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Limpiar todo"

#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Limpiar archivos comunes"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Limpiar Código Fuente de Lazarus"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Cambia después de la construcción a automáticamente"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Limpiar"

#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Limpiar y construir"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Limpiar y construir proyecto"

#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr "Limpiar paquete \"%s\". "

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "¿Limpiar ruta de la unidad?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Limpiar"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "¿Limpiar Directorio?"

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Limpiar filtro de opciones"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Pulse aquí para explorar el archivo"

#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Pulse para mirar las opciones"

#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Pulse para seleccionar la pagina de paleta"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Clonar"

#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "&Cerrar"

#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Cerrar todo"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Cerrar Todos los Chequeados"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Cerrar archivos"

#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Ocultar ventana"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Cerrando una Ventana del Editor de Código. ¿Quiere cerrar todos los archivos u ocultar la ventana?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Cerrar Ventana del Editor de Código"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opciones específicas de la interfaz LCL:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parámetros"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Componentes"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Herencia"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Páginas"

#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "Paleta está &visible"

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "&Restaurar valores por defecto"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Archivo de configuración adicional del compilador ambiguo"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Llamar a:"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%s Pulse Aceptar si estás seguro de hacer eso."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Comando:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Código"

#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navegador de Código"

#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Opciones de creación de código"

#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Sección de clase"

#: lazarusidestrconsts.liscodecreationdialoglocation
#, fuzzy
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Ubicación"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Opciones de generación de código"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Añadir ruta"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Explorar"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Confirmar reemplazar"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Crear un elemento de ayuda"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Eliminar ruta"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Descripción"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Errores"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Ejemplo"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Ajustes FPDoc"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Insertar etiqueta de formateo en negritas"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Insertar etiqueta de formato de código"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Insertar etiqueta de formato cursiva"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Insertar etiqueta de formato de remarcado"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Insertar etiqueta de formato subrayado"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Insertar etiqueta de formato variable"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Heredado"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Insertar un enlace ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Insertar etiqueta de formato de párrafo"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(no se encontró descripción heredada)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NINGUNO>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Ver también"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Descripción corta de"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Corta"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorar constantes en las siguientes funciones"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Buscar constantes char sin nombre"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Observador de código"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorar las siguientes constantes sin nombre"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Añadir plantilla"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Añadir plantilla de código"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
#, object-pascal-format
msgid " A token \"%s\" already exists! "
msgstr "¡Ya existe un token \"%s\"!   "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Autocompletar en"

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Cambiar"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Comentar:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Editar plantilla de código"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Error"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Acción: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Los nodos creados automáticamente no se pueden editar,%saunque no tengan nodos hijos que no hayan sido creados automáticamente."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, autogenerado"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Los nodos generados automáticamente no pueden editarse."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Bloquear"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor de Defines de CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Ruta del compilador"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Convertir nodo"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Crear Defines para %s el directorio"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Crear Defines para el Compilador de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Crear Defines para las fuentes SVN de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Crear Defines para el Proyecto %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Crear Macros FPC y rutas para un directorio de proyecto de fpc"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Define"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Define Recursivo"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Borrar nodo"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes.%sPor ejemplo: c:/Archivos de Programa/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes,%sque son usados por este %s proyecto.%sPor ejemplo: c:/Archivos de Programa/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Descripción:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "%s directorio"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Salir sin Guardar"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Directorios de las fuentes SVN de FPC"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Directorio"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Insertar Plantilla de Compilador de Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Insertar Plantilla de Directorio de Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Insertar Plantilla de Proyecto de Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Insertar Plantilla de Compilador de Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Insertar Plantilla de Directorio de Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Insertar Plantilla de Proyecto de Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Insertar Plantilla de Compilador de Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Insertar Plantilla de Directorio de Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Insertar Plantilla de Proyecto de Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Insertar Plantilla de Compilador de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Insertar Plantilla de Proyecto Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Insertar plantilla de código de SVN de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Insertar Plantilla de Compilador de Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Insertar Plantilla de Directorio de Kylix3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Insertar Plantilla de Proyecto de Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Insertar nodo como hijo"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Insertar nodo debajo"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Insertar Plantilla"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Padre no válido"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nodo padre no válido"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nodo previo no válido"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "El %s directorio principal,%s donde Borland ha instalado todos %s los fuentes.%sPor ejemplo: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "El %s directorio principal,%sdonde Borland ha instalado todos %s los fuentes,%sque son usados por este %s proyecto.%sPor ejemplo: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Mover nodo abajo"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Mover nodo un nivel abajo"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Mover nodo un nivel arriba"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Mover nodo arriba"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nombre:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nuevo Nodo"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "El nodo es de sólo-lectura"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nada seleccionado"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "El nodo padre no puede contener nodos hijo."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "El nodo previo no puede contener nodos hijo."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Directorio del proyecto"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "%s directorio de proyecto"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Error de lectura"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Guardar y salir"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Seleccionar Nodo:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "El directorio de fuentes SVN de Free PAscal. No requerido. Esto mejorará la depuración y la posibilidad de encontrar declaraciónes."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Directorio de proyecto de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "El directorio SVN de fuentes de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "La ruta al compilador Free Pascal.%s Por ejemplo %s/usr/bin/%s -n%s o %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "La ruta al compilador Free Pascal para este proyecto. Sólo es necesario si activa fuente FPC SVN abajo. Se usa para autocrear macros."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "El path para el compilador Free Pascal para esta fuente.%sUtilizado para autocrear macros."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "El %s directorio de proyecto,%sque contiene el archivo .dpr, dpk"

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Undefine"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Undefine Todo"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Undefine Recursivo"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valor como Rutas de Archivo"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valor como texto"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%svalor \"%s\" es inválido."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variable:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Error de escritura"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "En"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Paréntesis"

#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Signo de intercalación (^)"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dos puntos"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Coma"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificador"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Palabra Clave"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nueva línea"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Nada"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Número"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punto"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Punto y coma"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Espacio"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Constante de cadena"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Símbolo"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Ejecutar después de"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Ejecutar antes de"

#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr "Dirección"

#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr "Clase"

#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Colapsar Todo (/)"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Colapsar todas las clases"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Colapsar todos los paquetes"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Colapsar todas las unidades"

#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr "Retorna"

#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr "Visibilidad"

#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr ""

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parámetros de la línea de comando"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parámetros de la línea de comandos del programa"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compilar"

#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr ""

#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Compilar los siguientes modos"

#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Compilar proyecto"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilador"

#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr "Falta %s"

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "El compilador \"%s\" no soporta el objetivo %s-%s"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Error: compilador no válido: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nombre de archivo del compilador"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Sugerencia: puede establecer la ruta del compilador en Herramientas -> Opciones-> Archivos -> Ruta del compilador"

#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr "Fichero de mensajes del compilador no encontrado:%s%s"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOTA: No se ha encontrado el archivo de configuración de las CodeTools - usando valores predeterminados"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOTA: Cargando archivo antiguo de opciones de CodeTools: "

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compilar"

#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr ""

#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "compilar con -vd para más detalles. Verifica si hay duplicados."

#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (compilando ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Mostrar descripciones largas"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Extender mucho a la izquierda"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Extender un poco a la izquierda"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nunca"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Extender unicamente a la derecha"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
#, object-pascal-format
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "El nombre del componente \"%s\" es una palabra clave Pascal"

#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "El nombre del componente \"%s\" es una palabra"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
#, object-pascal-format
msgid "Component name \"%s\" is not a valid identifier"
msgstr "El nombre del Componente \"%s\" no es un identificador válido"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Ver Todos"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Abrir paquete"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Abrir unidad"

#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Comprimir"

#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "El directorio resultante se comprimirá en un archivo ZIP."

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Probar"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condición"

#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Condicionales"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Directorio de configuración de Lazarus"

#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Fichero de configuración para añadidos:"

#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Configurar Construcción %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Configurar \"Construir Lazarus\""

#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Configurar la barra de herramientas"

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Configurar IDE Lazarus"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Confirmar"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Confirmación"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus será reconstruido con los perfiles siguientes:%s¿Continuar?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Confirmar cambios"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Confirmar eliminación"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "¿Quiere reconstruir Lazarus con el perfil: %s ?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Confirmar nuevo conjunto de paquetes para el IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Acción"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Conjunto de paquetes nuevo"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Conjunto de paquetes antiguo"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Conflicto"

#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Detectado conflicto"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Aplicación de consola"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Un programa de linea de comando de Free Pascal utilizando TCustomApplication para comprobar fácilmente las opciones de línea de comandos, control de excepciones, etc."

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Código de Constructor"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contiene"

#: lazarusidestrconsts.liscontents
#, fuzzy
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Contenidos"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensible al contexto"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Continuar"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continuar y no volver a preguntar"

#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "continuar construyendo"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continuar sin cargar el formulario"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Colaboradores"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "El control necesita un padre"

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Añadir comentario después del reemplazo"

#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "Se agregó el modificador de sintaxis MODE Delphi después del nombre de la unidad."

#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Añadiendo flag (bandera) para procedimiento \"Register\" en unidad %s."

#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" falta en la función de reemplazo: %s"

#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Paréntesis no encontrado"

#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr " { *Convertido desde %s* }"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Un desplazamiento es añadido a la coordenada superior de los controles dentro de los contenedores visuales"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Coordinar desplazamientos"

#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr "Borrado fichero %s"

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr "Añadidos defines %s en opciones personalizadas"

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr "Añadido paquete %s como una dependencia."

#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr "Agregar unit \"%s\" en la sección uses"

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Todos los subdirectorios serán escaneados buscando archivos de unidades"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "¡BeginCodeTools falló!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Categorias:"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr "Cambiada la codificación para %s a UTF-8"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Conversión Abortada."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversion Preparada."

#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr "Conversión tuvo: %s"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Convertir paquete de Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Convertir proyecto de Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Convertir unidad de Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Convirtiendo ficheros de unidad encontrados durante la conversión ***"

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Convirtiendo ficheros de unidad pertenecientes al proyecto/paquete ***"

#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr "Error=\"%s\""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Ha ocurrido una Excepción durante la conversión de la unidad. Continuando con ficheros de formulario de unidades ya convertidas..."

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Falló convirtiendo unidad"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr "Falló convirtiendo unidad\"%s\""

#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Arregladas las mayúsculas o minúsculas de la unidad \"%s\" a \"%s\"."

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Encontrar todos los ficheros unidad"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Función Delphi"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) archivo de inclusión no encontrado"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nombre Delphi"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "El nombre del paquete existe"

#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Paquete %s es necesario pero no esta instalado en Lazarus! Instalarlo más tarde."

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr "Se omite la unidad %s del proyecto"

#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr "Unit \"%s\" removida desde la sección uses"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Reparando unidades utilizadas y ficheros de formulario ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Reemplazada unidad \"%s\" con \"%s\" en sección 'uses'."

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Ya existe un paquete con el nombre \"%s\"%sPor favor, cierre este paquete primero."

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Nombre de unidad existe en LCL"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr "Unidades para reemplazar en %s"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL ya tiene una unidad con nombre %s. ¿Borrar fichero local %s?"

#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "El fichero .dproj todavía no está soportado. Este tipo de fichero lo utiliza Delphi 2007 y superior. Por favor selecciona un fichero .dpr para proyectos o .dpk para paquetes."

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Error de conversión"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Convertir"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Convertir Codificación de Página"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Convertir Codificación de Página de Proyectos/paquetes"

#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Otras opciones que afectan a la conversión"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Convertir proyecto o paquete"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Objetivo"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Multiplataforma"

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Multiplataforma contra Solo-Windows"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "El convertidor añade compilación condicional para soportar diferentes objetivos"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Usar el mismo archivo de formulario DFM"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Mismo archivo DMF para Lazarus y Delphi en lugar de copiarlo a LFM"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Soportar Delphi"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Usar compilación condicional para soportar Delphi"

#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr "Nombre de unidad reparado de %s para %s."

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Reemplazo de Funciones"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Algunas funciones Delphi pueden ser sustituidas por funciones del LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funciones / procedimientos a reemplazar"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Desplazamiento a la izquierda"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nombre Nuevo"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Contenedor Primario"

#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr "Hay problemas al tratar de encontrar todas las unidades desde ficheros de proyecto %s"

#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr "Problemas al reparar ficheros include en fichero %s"

#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr "Problemas al reparar fichero de formulario %s"

#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Reparando ficheros include : "

#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr "Reemplazada llamada %s con %s"

#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "El reemplazo del número de parámetro de función debería ser >= 1: %s"

#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr "\"$\" debería ir seguido por un número: %s"

#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Detenido debido a que ya existe un paquete con el mismo nombre"

#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr "Este reporte se ha guardado en %s"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Desplazamiento superior"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Reemplazo de Tipos"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Tipos desconocidos en el archivo del formulario (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Tipos a reemplazar"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Reemplazo de Unidades"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Nombres de unidad en la sección uses de la unidad fuente"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unidades a reemplazar"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Propiedades desconocidas"

#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr "El usuario ha elegido finalizar la conversión del fichero %s"

#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Agregar/Configurar/Borrar barra de herramienta(s)"

#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Agregar división"

#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Agregar elemento seleccionado a la barra de herramienta"

#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Comandos disponibles"

#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Estilo del borde de la barra de herramientas"

#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Nada"

#: lazarusidestrconsts.liscoolbarborderstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Simple"

#: lazarusidestrconsts.liscoolbarcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"

#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Plantillas de Código"

#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Configurar"

#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "¿Está seguro que desea borrar la barra de herramientas seleccionada?"

#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "¡Aquí debe estar al menos una barra de herramientas!"

#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Diseñador"

#: lazarusidestrconsts.liscoolbargeneralsettings
#, fuzzy
msgid "General Coolbar Settings"
msgstr "Configuración general de Coolbar"

#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Estilo asignado a la barra de herramientas"

#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Simple"

#: lazarusidestrconsts.liscoolbargrabstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Doble"

#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "Líneas horizontales"

#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "Líneas Verticales"

#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Pinza"

#: lazarusidestrconsts.liscoolbargrabstyleitem5
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Botón"

#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Anchura"

#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "Menú principal del IDE"

#: lazarusidestrconsts.liscoolbarmessages
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Mensajes"

#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Mover los elementos seleccionados de la barra de herramientas abajo"

#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Mover los elementos seleccionados de la barra de herramientas arriba"

#: lazarusidestrconsts.liscoolbaroptions
#, fuzzy
msgid "IDE CoolBar"
msgstr "CoolBar del IDE"

#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Editor de paquetes"

#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Archivos del editor de paquetes"

#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Remover los elementos seleccionados de la barra de herramientas"

#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Restaurar valores predeterminados"

#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "¡Por favor, seleccione una barra de herramienta primero!"

#: lazarusidestrconsts.liscoolbarsourceeditor
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Editor de Código Fuente"

#: lazarusidestrconsts.liscoolbarsourcetab
#, fuzzy
msgid "Source Tab"
msgstr "Source Tab"

#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Comandos de la barra de herramienta"

#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "Coolbar está &visible"

#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Ancho del Coolbar"

#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Copiar"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Copiar Todo"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Copiar Todos los Elementos al Portapapeles "

#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Copiar mensajes Todos/Originales al portapapeles"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Copiar toda la salida al portapapeles"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copiar Todos los Mensajes Mostrados al Portapapeles"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copiar descripción al portapapeles"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Error de Copia"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Error de copia"

#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr "Copiar nombre de fichero %s"

#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Copiar nombre de fichero al portapapeles"

#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "La copia de archivos falló"

#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr "Copiar \"%s\" al portapapeles"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Copiar un formulario completo no está implementado."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Copiar elemento al Portapapeles"

#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Copia/Mueve fichero a Directorio"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Copiar los elementos seleccionados al Portapapeles"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Copiar Mensajes Seleccionados al Portapapeles"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Escanear mensajes FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Escanear mensajes de Make"

#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Analizar en busca de mensajes:"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Saltar llamada de compilador"

#: lazarusidestrconsts.liscouldnotadditomainsource
#, object-pascal-format
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "¡No se pudo añadir \"{$I %s}\" al código principal!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
#, object-pascal-format
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "¡No se pudo añadir \"{$R %s}\" al código principal!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
#, object-pascal-format
msgid "Could not add \"%s\" to main source!"
msgstr "¡No se pudo añadir \"%s\" al código principal!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
#, object-pascal-format
msgid "Could not remove \"%s\" from main source!"
msgstr "¡No se pudo eliminar \"%s\" del código principal!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
#, object-pascal-format
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "¡No se pudo eliminar \"{$I %s}\" del código principal!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
#, object-pascal-format
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "¡No se pudo eliminar \"{$R %s}\" del código principal!"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Advertencia: El archivo de configuración adicional de compilador tiene el mismo nombre que uno de los estándar que el compilador FreePascal está buscando. Esto puede provocar que SÓLO se interprete el archivo adicional de configuración y se ignore la configuración estándar."

#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Abrir Paquete %s"

#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Abrir Unidad %s"

#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ", CPU: %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "¡Cree un proyecto primero!"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Crear los modos de depuración y liberación"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "¿Crear directorio?"

#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Crear filtro"

#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr ""

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Crear función"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Crear nodo de Ayuda"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Crearlo"

#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr "Crear variable local  \"%s\""

#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Crear nuevo añadido"

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Crear nuevo paquete)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Crear nuevo componente paquete"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Crear proyecto"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Crear/actualizar archivo .po cuando se guarde un archivo .lfm"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr "Creando un índice de las fuentes FPC %s ..."

#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Abajo"

#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Arriba"

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Escoja Directorio"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Directorio de valores de CodeTools"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Plantillas de Defines"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<no se ha seleccionado una variable>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Abrir vista previa"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Herramientas"

#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Variable: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nombre de Variable"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Plantillas"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Actualizar todas las firmas de método"

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Actualizar firmas de múltiples procedimientos"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "por favor, elija una macro"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Seleccionar código de macro"

#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Actual"

#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Widgetset LCL actual: \"%s\""

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Estado actual: "

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Columna del cursor en el editor actual"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Línea del cursor en el editor actual"

#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Estas opciones se pasan directamente al compilador después de que se reemplazan las macros."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "opciones personalizadas"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opciones personalizadas"

#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Opciones Personalizadas"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programa personalizado"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Un programa personalizado Free Pascal"

#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Cortar"

#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr "Anexar"

#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr "Nombre de imagen"

#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr "PID"

#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr "Procesos en ejecución"

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Módulo de Datos"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Fecha"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Borrar todos"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Borrar todos"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Desactivar todos"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Desactivar todos"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Activar todos"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Activar todos"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr "Copiar al Portapapeles"

#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Propiedades de Punto de interrupción ..."

#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "&Expresión:"

#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "&Nuevo valor:"

#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "&Resultado:"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Evaluación de Punto de interrupción"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Salto (Hit) de Punto de interrupción "

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Mensaje de Punto de interrupción"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Volcado de Pila (stack) de Punto de interrupción"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Color por defecto"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Excepcción Lanzada"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Cargar Módulo"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Descarga Módulo"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Salida de cadena de depuración"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Salida Proceso"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Comienzo Proceso"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Salida Hilo (Thread)"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Comienzo Hilo (Thread)"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Mensajes de ventana publicado"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Mensajes de ventana enviado"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Borrar"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Desactivar"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Desactivar"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Activar"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Activar"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "No se ha especificado un depurador"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Establecer el punto de interrupción de todas maneras"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "No se ha especificado un depurador.%sEstablecer puntos de interrupción no tendrá efecto hasta que defina un depurador en el diálogo de opciones del depurador en el menú."

#: lazarusidestrconsts.lisdbgterminal
msgctxt "lazarusidestrconsts.lisdbgterminal"
msgid "Console In/Output"
msgstr "Consola de Entrada/Salida"

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Encendido/Apagado"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Desactivar/Activar actualiza toda la ventana"

#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Depurar"

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Depurador"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Error del Depurador%sUuups, el depurador entró en el estado de error%s¡Guarda tu trabajo ahora!%sPulsa Stop y espera lo mejor."

#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Error de Depurador"

#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Información de Depurador"

#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Advertencia de Depurador"

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Depurador no válido"

#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (depurando ...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Conversión automática de tipos para los objetos"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Agregar Excepción"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Ruta adicional de búsqueda"

#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Cerrar automáticamente la ventana del ensamblador después de no encontrar la fuente"

#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Punto de interrupción"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Limpiar reporte en la ejecución"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Depurador"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opciones generales del depurador"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opciones específicas del depurador (depende del tipo de depurador)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Nombre de Excepción duplicado"

#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Introducir el nombre de la Excepción"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Log de eventos"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Gestionado por"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Gestionado por el depurador"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Gestionado por programa"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorar estas extensiones"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Excepciones del lenguaje"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Limitar contador de líneas a"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Módulo"

#: lazarusidestrconsts.lisdebugoptionsfrmname
#, fuzzy
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Nombre:"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
#, fuzzy
#| msgid "Notify on Lazarus Exceptions"
msgid "Notify on Exceptions"
msgstr "Notificar en excepciones de Lazarus"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Excepciones del Sistema Operativo"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Salida"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proceso"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Resetear depurador después de cada ejecución"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Continuar"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Continuar controlado"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Continuar sin controlar"

#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Mostrar mensaje al parar"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Señales"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Hilo"

#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Usar colores en el registro de eventos"

#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Ventanas"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "No se ha podido cargar el archivo"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "No se ha podido cargar el archivo \"%s\"."

#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Decimal"

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Preterminada"

#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
#, fuzzy
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Sección de visibilidad de la clase por defecto de nuevos métodos: Por ejemplo completado de código en OnShow:="

#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "Por defecto es ComboBox con selecciones \"True\" y \"False\""

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(por defecto)"

#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Sección por defecto de métodos"

#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr ""

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Retraso para descripciones largas en la ventana de auto-completar"

#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr ""

#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Borrar"

#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "¿Borrar?"

#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr "¿Borrar añadido \"%s\"?"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Eliminar todo"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "¿Eliminar todos los puntos de interrupción?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
#, object-pascal-format
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "¿Eliminar todos los puntos de interrupción en el archivo \"%s\"?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Eliminar Todo en la misma fuente"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "¿Eliminar todos los puntos de interrupción seleccionados?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "¿Borrar todos estos archivos?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "¿Borrar archivo ambiguo?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Eliminar Punto de Interrupción"

#: lazarusidestrconsts.lisdeletebreakpointatline
#, object-pascal-format
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "¿Eliminar punto de interrupción en%s\"%s\" línea %d?"

#: lazarusidestrconsts.lisdeletebreakpointforaddress
#, object-pascal-format
msgid "Delete breakpoint for address %s?"
msgstr "¿Borrar punto de interrupción para la dirección %s?"

#: lazarusidestrconsts.lisdeletebreakpointforwatch
#, object-pascal-format
msgid "Delete watchpoint for \"%s\"?"
msgstr "¿Borrar punto de observación para \"%s\"?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Fallo al borrar el archivo"

#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "¿Borrar macro \"%s\"?"

#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Borrar modo \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "¿Borrar archivo viejo: \"%s\"?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "¿Eliminar archivo anterior?"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Borrar macro seleccionada?"

#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Borrar este añadido"

#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr "¿Eliminar valor \"%s\"?"

#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr "Borrar valor %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
#, object-pascal-format
msgid "Deleting of file \"%s\" failed."
msgstr "Falló el borrado del archivo \"%s\""

#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "El delimitador es punto y coma."

#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Recursos compatibles con Delphi. Recomendado."

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
#, fuzzy
#| msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "Los paquetes \"Tiempo diseño\" pueden agregar componentes y elementos de menú del IDE. Puede ser utilizados por proyectos, pero no se compilan en el proyecto. El compilador no encontrará unidades de este paquete al compilar el proyecto."

#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Escritorios ..."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Directorio de destino"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Código del Destructor"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Insensible a mayus/mins"

#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Archivo1"

#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Archivo2"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorar si se han añadido o eliminado líneas vacías"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorar las diferencias a final de línea (e.g. #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorar la totalidad de caracteres de espacio"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorar espacios (caracteres de nueva línea no incluídos)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorar espacios al final de línea"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorar espacios a principio de línea"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Sólo selección"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Abrir Difrencias en editor"

#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr "diferente unidad %s encontrada en nueva posición \"%s\""

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Dígitos:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Directivas"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Directivas para la unidad nueva"

#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Directorios"

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Directorio: "

#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr "Directorio \"%s\" no encontrado."

#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr "directorio %s no encontrado"

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Directorio no escribible"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Directorio donde el IDE pone los archivos .po"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Desactivar todo en la misma fuente"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Desactivar Punto de Interrupción"

#: lazarusidestrconsts.lisdisabled
msgctxt "lazarusidestrconsts.lisdisabled"
msgid "Disabled"
msgstr "Desactivado"

#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Desactivar Grupos"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Desactivar I18N para LFM"

#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "¿Deshabilitar opción -Xg?"

#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Deshabilitar opción -Xg"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Ensamblador"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Ir a la Dirección"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Ir a la Dirección"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Ir a la Dirección Actual"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Ir a la Dirección Actual"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Descartar cambios"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Descartar todos los cambios"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Descartar cambios y abrir proyecto"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Descartar cambios y salir"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Descartar cambios, crear nuevo proyecto"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Haga clic en uno de los elementos de abajo para ver la diferencia"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Error leyendo archivo: %s"

#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Ignorar todos los cambios en el disco"

#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Recargar los archivos verificados desde el disco"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Algunos archivos han cambiado en el disco:"

#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr ""

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Distingue entre mayúsculas y minúsculas, ejemplo A y a"

#: lazarusidestrconsts.lisdlgadd
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Añadir ..."

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Todas las opciones ..."

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Cambiar Clase ..."

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Defines ..."

#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Editar ..."

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exportar ..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importar ..."

#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Más ..."

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Abrir ..."

#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Guardar ..."

#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s no existe: %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "No cambiar"

#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
#, object-pascal-format
msgid "%sDo not check if another IDE instance is already running"
msgstr "%sNo verifica si otra instancia del IDE está ejecutándose"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "No cerrar el proyecto"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "no compilar dependencias"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "No mostrar la pantalla de inicio"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "No mostrar este dialogo para este proyecto"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "No volver a mostrar este mensaje"

#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
#, fuzzy
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "No escriba el archivo de información del proyecto actualizado después de la compilación. Si no se especifica, el número de compilación se incrementará si se configura."

#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format, fuzzy
#| msgid ""
#| "The following package(s) are not available locally: %s.\n"
#| "In order to install it, you must download them first. Download now?\n"
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
"El(los) siguiente(s) paquetes no están disponibles localmente: %s.\n"
"Para instalarlo, debes descargarlo primero. ¿Descargar ahora?\n"

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Abajo"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Degradar"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Degradar configuración"

#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Descargar"

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "¿Todavía desea crear el nuevo proyecto?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "¿Todavía quiere abrir otro proyecto?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "¿Todavía quieres salir?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Dibujar lineas de cuadrícula"

#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
#, fuzzy
#| msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Dibujar la selección como enfocada, incluso si la ventana de mensajes no tiene el foco. Utiliza esto si tu tema tiene una apariencia no enfocada apenas visible."

#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr ""

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copiar los componentes seleccionados al portapapeles"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Cortar componentes seleccionados al portapapeles"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Mover componente uno atrás"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Mover componente uno adelante"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Mover componente al fondo"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Mover componente al frente"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Pegar componentes seleccionados desde el portapapeles"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Seleccionar componente padre"

#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Mostrar componentes no visuales"

#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Alternar mostrando los componentes no visuales"

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Duplicar"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Duplicar entrada"

#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Nombre de fichero duplicado"

#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr "Se encontró duplicado del valor \"%s\"."

#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr "Modo \"%s\" está presente en la lista"

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Nombre duplicado"

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Nombre duplicado: Un componente llamado \"%s\" ya existe en el componente heredado %s"

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Archivos ppu duplicados. Elimine uno o asegúrese de que todas las rutas de búsqueda están en el orden correcto (Indicación: FPC usa primero la última ruta)."

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Ruta de búsqueda duplicada"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Fuentes duplicadas. Elimine una o asegúrese de que todas las rutas de búsqueda están en el orden correcto (Indicación: FPC usa primero la última ruta)."

#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Unidad duplicada"

#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Unidad duplicada \"%s\" en \"%s\""

#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr ""

#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr ""

#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr ""

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr ""

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Editar"

#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Editar ayuda adicional para mensajes"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Editar ayuda contextual"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Editar ayuda"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Editar llave (key)"

#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Editar colores"

#: lazarusidestrconsts.liseditormacros
#, fuzzy
#| msgid "Editor macros"
msgid "Editor Macros"
msgstr "Editar macros"

#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Barra de herramientas del Editor"

#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Configuración de la barra de herramientas del Editor"

#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "Barra de herramienta del Editor está &visible"

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Cargar un esquema"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Todos los paquetes"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Proyecto Actual"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Todos los proyectos"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "establecer modo FPC a DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "establecer modo FPC a FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "establecer modo FPC a GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "establecer modo FPC a MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "establecer modo FPC a TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "activar IOCHECKS"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "activar OVERFLOWCHECKS"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "activar RANGECHECKS"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "usar la unidad HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "usar unidad LineInfo"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Una herramienta válida necesita como mínimo un título y un nombre de archivo."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Editar herramienta"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Tecla"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macros"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parámetros:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nombre de archivo del programa:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Escanear salida de mensajes del Compilador Free Pascal"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Escanear salida de mensajes de make"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Título y Nombre de archivo requerido"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Directorio de Trabajo:"

#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
#, fuzzy
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Elevar la prioridad del mensaje para que siempre se muestre ()por defecto esto tiene baja prioridad \"verbose\")"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Todo"

#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Métodos Vacios"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Métodos vacios encontrados:"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Sin clase"

#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr "Sin clase en %s(%s,%s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Solo published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Eliminar métodos"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Buscar en esas secciones de clase:"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "No se puede mostrar métodos vacíos de la clase actual, porque%s%s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vacío"

#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "El directorio de destino para publicación es una ruta relativa o vacía."

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Activar Todo"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Activar todo en la misma fuente"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Activar Punto de Interrupción"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Activo"

#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Habilitado solamente para paquetes"

#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Habilitar \"Use Unit\" de la unidad %s en el paquete %s"

#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Activar Grupos"

#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Habilitar I18N para LFM"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Activar soporte de internacionalización y traducción"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Activar Macros"

#: lazarusidestrconsts.lisenableoptiondwarf
msgid "Enable Dwarf 2 (-gw)?"
msgstr "¿Activar Dwarf 2 (-gw)?"

#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Activar Dwarf 2 (-gw)"

#: lazarusidestrconsts.lisenableoptiondwarf2sets
#, fuzzy
msgid "Enable Dwarf 2 with sets"
msgstr "Activar Dwarf 2 con parámetros"

#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Activar Dwarf 3 (-gw3)"

#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "¿Activar opción -Xg?"

#: lazarusidestrconsts.lisenableoptionxg2
msgid "Enable option -Xg"
msgstr "Activar opción -Xg"

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
#, fuzzy
#| msgid "Enable = replace whole identifier, Disable = replace prefix"
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Activar = reemplazar identificador entero, Desactivar = reemplazar prefijo"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Encerrar"

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Encerrar en $IFDEF"

#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr "Número de ficheros fallidos al convertir: %d"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "La codificación de página del archivo \"%s\"%sen disco es %s. La nueva codificación es %s."

#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Bucle sin fin en macros"

#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr "Entrar nuevo nombre para Macro \"%s\""

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variable de Entorno, nombre como parámetro"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Directorio no encontrado"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nombre de archivo del depurador no válido"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "El archivo de depurador \"%s\" no es un ejecutable."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Directorio de prueba \"%s\" no encontrado."

#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Opción no válida en la posición %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "La opción en la posición %d no admite un argumento: %s"

#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "La opción en la posición %d necesita un argumento: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Error: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Error creando archivo"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Error borrando archivo"

#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Error en %s"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Error en el nombre de archivo del compilador:"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Error en las opciones personalizadas del compilador (Otro):"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Error en las opciones personalizadas del enlazador (Enlazando / Pasando opciones al enlazador):"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Error en las \"Adiciones a la ruta del depurador\":"

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Error en la ruta de búsqueda de \"Archivos de inclusión\":"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Error en la ruta de búsqueda de \"Librerías\":"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Error en la ruta de búsqueda de \"Archivos objeto\":"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Error en la ruta de búsqueda de \"Otras fuentes\""

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Error en la ruta de búsqueda de \"Otros archivos de unidad\":"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Error en el \"Directorio de salida de la unidad\":"

#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr "Error: (lazarus) Modo de construcción inválido \"%s\""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Error cargando archivo"

#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr "Error cargando archivo \"%s\":"

#: lazarusidestrconsts.liserrorloadingfrom
#, object-pascal-format
msgid "Error loading %s from%s%s%s%s"
msgstr "Error cargando %s desde%s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Error al mover componente"

#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Error al mover componente %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Error al nombrar el componente"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Error al abrir componente"

#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Error al abrir el formulario"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Error al analizar el flujo (stream) del componente lfm."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Error al leer lista de paquetes del archivo%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Error al leer XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Error al leer el archivo xml \"%s\"%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Error renombrando archivo"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Errores"

#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", Errores: %s"

#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Error al grabar el formulario"

#: lazarusidestrconsts.liserrorsavingto
#, object-pascal-format
msgid "Error saving %s to%s%s%s%s"
msgstr "Error guardando %s a%s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr "Error al cambiar el nombre del componente de %s a %s"

#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr "Error escribiendo archivo \"%s\""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Error al escribir lista de paquetes al archivo%s%s%s%s"

#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Evaluar expresión"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "E&valuar"

#: lazarusidestrconsts.lisevaluateall
msgid "Evaluate all"
msgstr ""

#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "&Evaluar/Modificar"

#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Limpiar Eventos"

#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Opciones Log Eventos ..."

#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Guardar Eventos a Archivo"

#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Añadir Comentario ..."

#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Añadir Comentario"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Cada n-ésimo número de línea"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Archivo de ejemplo:"

#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Construir todos los seleccionados"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Ejemplos:%sIdentificador%sTMyEnum.Enum%sNombreUnidad.Identificador%s#NombrePaquete.NombreUnidad.Identificador"

#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Abrir primero seleccionado"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Notificación de Excepciones del Depurador"

#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr "%s excluido en tiempo de ejecución"

#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr "ejecutable \"%s\" es un directorio"

#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr "ejecutable \"%s\" carece de permiso para arrancar"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Ejecutando comando después"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Ejecutando comando antes"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Ejecución detenida"

#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr ""

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Salir"

#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr "Código de salida %s"

#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Expandir Todo (*)"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Expandir todas las clases"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Expandir todos los paquetes"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Expandir todas las unidades"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Expandir nombre de archivo del archivo actual del editor"

#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exportar ..."

#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Exportar todo"

#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Exportar todos los elementos a fichero"

#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Exportar las opciones del entorno"

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exportar como HTML"

#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Exportar / Importar"

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportar lista"

#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Exportar lista de paquete (*.xml)"

#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Exportar seleccionados"

#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Exportar >>"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Expresión:"

#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
#, object-pascal-format
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr "¿Extender trayectoria de busqueda de ficheros inlcuidos del paquete \"%s\" con%s\"%s\"?"

#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
#, object-pascal-format
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr "¿Extender trayectoria de busqueda de ficheros incluidos del proyecto con%s\"%s\"?"

#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr "¿Extender la ruta de ficheros incluidos?"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "¿Extender ruta de la unidad?"

#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
#, object-pascal-format
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr "¿Extender trayecto de búsqueda de unidades del paquete \"%s\" con%s\"%s\"?"

#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
#, object-pascal-format
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr "¿Extender trayecto de búsqueda de unidades del proyecto con %s\"%s\"?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extraer"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Extraer Procedimiento"

#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Extremadamente verboso (explicativo)"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Herramientas Externas"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Nº máximo de herramientas alcanzado"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Hay un máximo de %s herramientas."

#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr "Fallo al añadir %d no es uno(s) recurso(s) únicos"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Falló al crear el envoltorio de la aplicación para \"%s\""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Ha fallado La carga del estado de plegado de código"

#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "resolución de macros fallida"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Fallo al guardar archivo."

#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Fatal"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Reducir pintado del diseñador"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Dibujar elementos del diseñador cuando se esté inactivo (reduce la sobrecarga en máquinas lentas)"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Archivo"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Archivo: "

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "El archivo \"%s\"%sno parece ser un archivo de texto.%s¿Abrirlo de todas maneras?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Extensión de archivo de programas"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtro de archivos"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Filtros de Archivo"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Añadir Fila"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Borrar Fila"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Insertar Fila"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Mascara de archivo"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Establecer por defecto"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Estos son filtros de archivos que van a aparecer en todos los cuadros de diálogo de Apertura de Archivos"

#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr ""

#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr "El archivo \"%s\" ha cambiado. ¿Guardar?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "El archivo no tiene proyecto"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Archivo es directorio"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Archivo no es un ejecutable"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "No se puede escribir en el archivo"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "El archivo es un enlace simbólico"

#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "El archivo \"%s\" es virtual."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Error en el enlace al archivo"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Nombre de archivo/Dirección"

#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Estilo de nombre de fichero"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Archivo no encontrado"

#: lazarusidestrconsts.lisfilenotfound2
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "No se encontró el archivo \"%s\"."

#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr "archivo %s no encontrado"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "archivo no encontrado"

#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr "Fichero no encontrado:%s%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "No se encontró el archivo \"%s\".%s¿Desea crearlo?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "El archivo no está en minúsculas"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "El archivo no es de texto"

#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr ""

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Ajustes de archivo"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr "La sintaxis del fichero %s es incorrecta"

#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Los Ficheros: %s, tienen procedimiento registrado: %s, en la sección uses del paquete: %s"

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Todos los archivos que se encuentran ya tiene la codificación correcta ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Archivos con codificación ASCII o UTF-8"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format, fuzzy
#| msgid "File %s is converted to text format."
msgid "File %s was converted to text format."
msgstr "El fichero %s es convertido a formato de texto."

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Archivos sin codificación ASCII o UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "archivo, donde se escribe la salida de depuración. Si no se especifica, la salida de depuración será a la consola."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtro"

#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr "Filtro: %s"

#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Filtra todos los mensajes de cierto tipo"

#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr "Filtra todos los mensajes de tipo %s"

#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "El filtro ya existe"

#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtra los mensajes de depuración e inferiores"

#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtra sugerencias e inferiores"

#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Filtra sugerencias sin posición fuente"

#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "No filtra, no filtra por urgencia"

#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Filtra mensajes no urgentes"

#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "filtra Notas e inferiores"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Conjuntos de filtros"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Filtra el listado de opciones disponibles"

#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Filtra Mensajes explicativos e inferiores"

#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtra advertencias e inferiores"

#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Encontrar ..."

#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Encontrar Declaración de %s"

#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "D&irectorios"

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Máscara archivo"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Incluir &subdirectorios"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Patrón &Multilínea"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "buscar todos los archivos del &proyecto"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Buscar en t&odos los archivos abiertos"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr "buscar en archivo &activo"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "buscar en &directorios"

#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "search in project &group"
msgstr ""

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Donde"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Buscar combinación de teclas"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Encontrar unidad faltante"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Primero"

#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "&Primera prueba"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Corregir fichero LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Punto Flotante"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Enfocar sugerencia"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forzar renombrado"

#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Por ejemplo mostrar arriba del todo las variables locales, a continuación los miembros de la clase actual, después los ancestros, la unidad actual, finalmente las unidades en uso"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Formulario"

#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Para macOS (Darwin)"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Error de formato"

#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Para Windows"

#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr "Encontrada version %s, pero se esperaba %s"

#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Versión de FPC como un número (e.g. 20701)"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "Falló fpcmake"

#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "Fichero de mensaje FPC:"

#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Mensajes FPC: Apéndice"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Recursos FPC"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Fuentes FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC demasiado antiguo"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Versión FPC: "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Versión FPC (ej. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr "Error escribiendo \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Error de sintaxis de FPDoc"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Nombre paquete FPDoc:"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Nombre del paquete FPDoc. El valor predeterminado es el nombre del archivo de proyecto."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Hay un error de sintaxis en el elemento fpdoc \"%s\":%s%s"

#: lazarusidestrconsts.lisfppkgcompilernotexecutable
#, object-pascal-format
msgid "The compiler [%s] configured for Fppkg is not an executable."
msgstr ""

#: lazarusidestrconsts.lisfppkgcompilernotexists
#, object-pascal-format
msgid "The compiler [%s] configured for Fppkg does not exist."
msgstr ""

#: lazarusidestrconsts.lisfppkgcompilernotfound
#, object-pascal-format
msgid "Could not find the compiler [%s] configured for Fppkg."
msgstr ""

#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr ""

#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr ""

#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr ""

#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr ""

#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr ""

#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr ""

#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr ""

#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr ""

#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr ""

#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr ""

#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr ""

#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr ""

#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr ""

#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr ""

#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr ""

#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr ""

#: lazarusidestrconsts.lisfppkgrtlnotfound
msgid "Fppkg reports that the RTL is not installed."
msgstr ""

#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr ""

#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr ""

#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr ""

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Frame (marco de trabajo)"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Buscar hacia atrás"

#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr "liberando líneas del buffer: %s"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Mensajes del Compilador Free Pascal"

#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr ""

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Directorio de las fuentes de Free Pascal"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Bús&queda hacia delante"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Archivos adicionales a buscar (e.g. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Buscar o Renombrar Identificador"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Buscar Referencias"

#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Identificador: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "en todos los paquetes y proyectos abiertos"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "en la unidad actual"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "en el proyecto principal"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "en el proyecto/paquete que es propietario de la unidad actual"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificador no válido"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Renombrar todas las referencias"

#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Renombrando"

#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Buscar"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Buscar también en los comentarios"

#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Completo"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Función"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "General"

#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr ""

#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr ""

#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr ""

#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr ""

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "Obtener la palabra actual en la posición del cursor"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Obtener la palabra actual en la posición del cursor."

#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Configuraciones globales"

#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Ir a la Línea"

#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr "Ir a la selección"

#: lazarusidestrconsts.lisgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
#| "\n"
#| "A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Este código es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU General Public License publicada por la Free Software Foundation; sea versión 2 de la Licencia, o (a su opción) cualquier versión posterior. \n"
"\n"
"Este código se distribuye con la esperanza de que sea útil, pero SIN NINGUNA GARANTÍA, ni siquiera la garantía implícita de COMERCIABILIDAD o IDONEIDAD PARA UN DETERMINADO FIN.  Consulte la GNU General Public License para obtener más detalles. \n"
"\n"
"Una copia de la Licencia Pública General de GNU está disponible en la World Wide Web en <http://www.gnu.org/copyleft/gpl.html>. También puede obtenerlo por escrito de la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Grupo"

#: lazarusidestrconsts.lisgroupassignexisting
#, object-pascal-format
msgid "Assign to existing \"%s\" group?"
msgstr "Asignar al grupo existente \"%s\"?"

#: lazarusidestrconsts.lisgroupemptydelete
#, object-pascal-format
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "No hay mas puntos de interrupción asignados al grupo \"%s\", ¿borrarlo?"

#: lazarusidestrconsts.lisgroupemptydeletemore
#, object-pascal-format
msgid "%sThere are %d more empty groups, delete all?"
msgstr "%sHay %d grupos vacíos más, ¿borrarlos todos?"

#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Grupo de variables locales definidas automáticamente"

#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "El nombre del grupo no puede estar vacío. ¿Limpiar los grupo(s) de puntos de interrupción?"

#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Nombre grupo:"

#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "el nombre de BreakpointGroup debe ser un nombre válido de identificador de Pascal."

#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Establecer nuevo grupo ..."

#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Limpiar grupo(s)"

#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Activar o desactivar los grupos de salida de depuración. Las opciones válidas son:"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Crecer hacia el más largo"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Tiene Ayuda"

#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Colores de cabecera"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Comentario de cabecera para la clase"

#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Ayuda"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Elementos de Ayuda"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Selector de ayuda"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Hexadecimal"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Ayuda para mensaje del Compilador de Free Pascal"

#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Ocultar todas las sugerencias y advertencias mediante la inserción de la directiva {%H-}"

#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Ocultar mensaje a %s mediante la inserción de la directiva {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Ocultar mensaje mediante la inserción de la directiva IDE {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Ocultar mensaje mediante la inserción {$warn %s off} hacia la unidad \"%s\""

#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Ocultar búsqueda"

#: lazarusidestrconsts.lishidewindow
#, fuzzy
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Ocultar ventana"

#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr "Ocultar con opción de paquete (-vm%s)"

#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr "Ocultar con opción de proyecto (-vm%s)"

#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Indicación"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Sugerencia: Se puede definir un valor predeterminado en los condicionales."

#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Una sugerencia en el nombre de propiedades muestra su descripción."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Sugerencia: Compruebe si dos paquetes contienen una unidad con el mismo nombre."

#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Sugerencia: Pulse en \"Mostrar opciones\" para averiguar de donde vienen las rutas heredadas."

#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ", Sugerencias: %s"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Guardar todo"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Paso a paso por instrucciones"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Ejecutar Hasta el Retorno de la Función"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Paso a Paso por Funciones"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Sugerencia: La función \"Crear Resourcestring\" espera una constante de cadena.%sPor favor seleccione únicamente una expresión de cadena y pruebe otra vez."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Cambiar Formulario/Unidad"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Ver Formularios"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Ver Unidades"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Contador"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Bases de Datos (BBDD)"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opciones de ayuda"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Propiedades:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visores"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Ruta a la documentación en HTML de FPC"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontal"

#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Líneas horizontales entre propiedades."

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Adición"

#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Apertura"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Opciones de construcción del IDE"

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "Durante la instalación/desinstalación de paquetes se recompilará y reiniciará el IDE."

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format, fuzzy
#| msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Bienvenido a Lazarus.%0:sLa configuración encontrada del IDE fue utilizada previamente por otra instalación de Lazarus.%0:sSi tienes dos o más instalaciones de Lazarus, no deberían compartir la misma configuración. Esto puede acarrear conflictos, y tus instalaciones de Lazarus pueden quedar inutilizadas.%0:s%0:sSi sólamente tienes una instalación y copias o mueves el ejecutable Lazarus, entonces puedes hacer un upgrade de la configuración.%0:s%1:s%0:s%0:sEscoge:%0:s%0:s* Información actualizada: Utiliza esta configuración y actualizala para ser utilizada con Lazarus en un futuro. La instalación antigua no la volverá a utilizar.%0:s* Ignorar: Usa esta configuración, pero mantiene la advertencia. Esto puede acarrear conflictos con la otra instalación.%0:s* Abortar: Salir ahora. Ahora puedes corregir el problema arrancando Lazarus con la configuración correcta.%0:s%0:sInformación adicional:%0:sEsta configuración está en: %2:s%0:sPertenece a la instalación de Lazarus en: %3:s%:sEl IDE actual fue iniciado desde: %4:s%0:s"

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
#, object-pascal-format
msgid "Creating Makefile for package %s"
msgstr "Creando Makefile para el paquete %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
#, object-pascal-format
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Error: Falló al ejecutar herramienta 'compilar después de' para el paquete %s "

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Información acerca del IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
#, object-pascal-format
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "ADVERTENCIA: nombre de unidad no válido %s, paquete=%s"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Macros IDE"

#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "El IDE mantiene Application.Scaled (Hi-DPI) en la unidad principal."

#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "El IDE mantiene el título en la unidad principal"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificador"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "El identificador comienza con ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "El identificador contiene ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opciones del IDE"

#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr "El título del IDE muestra el modo seleccionado de construcción"

#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr "El título del IDE muestra el directorio de proyecto"

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "El título del IDE empieza por el nombre del proyecto"

#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Todos los modos de construcción"

#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Opciones de compilador de"

#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Modo de construcción actual"

#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Error abriendo XML"

#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Error abriendo fichero XML \"%s\":%s%s"

#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Exportar opciones del compilador"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "El archivo a exportar ya existe"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "El archivo a exportar \"%s\" existe.%s¿Abrir el archivo y reemplazar sólo las opciones del compilador?%s(Las otras configuraciones se mantendrán.)"

#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importar opciones del compilador"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Cargar desde archivo"

#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr "El fichero \"%s\" no contiene opciones del compilador."

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Archivos recientes"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Guardar al archivo"

#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Si no verificado:"

#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Preguntar si salvar solamente en el caso de que la información de sesión haya cambiado."

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Si desea utilizar dos diferentes versiones de Lazarus debe iniciar el segundo Lazarus con la línea de comando parámetro primary-config-path o pcp.%sPor ejemplo:"

#: lazarusidestrconsts.lisignore
#, fuzzy
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "Ignorar"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorar todo"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorar y continuar"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorar este tipo de excepción"

#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format, fuzzy
msgid "Ignore, use %s as ancestor"
msgstr "Ignorar, use %s como antepasado"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Imitar sangría de la unidad, proyecto o paquete actual"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Comentario de implementación para la clase"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importar ..."

#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Importante"

#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Importar opciones del entorno"

#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importar desde Fichero"

#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
#, fuzzy
msgid "Importing BuildModes is not supported for packages."
msgstr "Importar BuildModes no esta soportado por los paquetes"

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importar lista"

#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Importar lista paquete (*.xml)"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Imposible"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr "En un directorio de fuentes del paquete \"%s\"."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "En un directorio de fuentes del proyecto. Comprobar si hay duplicados."

#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr "Incluir todos los subdirectorios"

#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr "Incluir filtro"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "ruta incluida"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Rutas de archivos include"

#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr "Incluir subdirectorios"

#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ", ppu incompatible=%s"

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Se ha encontrado un directorio de configuración incorrecto"

#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr ""

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Sangría en fuentes pascal"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Índice"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Información"

#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Información acerca de %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Información acerca del FPC en uso"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "En la ruta de búsqueda de unidades de FPC. Probablemente instalado por el paquete FPC. Comprobar si el compilador y el archivo ppu son de la misma instalación."

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Delante de los relacionados"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Elemento heredado"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Parámetros heredados"

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Componente de proyecto heredado"

#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Inicializar Variable Local"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Para crear una copia limpia del proyecto/paquete, todos los archivos en el siguiente directorio seran borrados y todo su contenido se habrá perdido.%s¿Borrar todos los archivos en \"%s\"?"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Insertar"

#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr "Insertar Assignment %s:= ..."

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "insertar fecha"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "insertar fecha y hora"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
#, fuzzy
#| msgid "Insert date and time. Optional: format string"
msgid "Insert date and time. Optional: format string."
msgstr "Insertar fecha y hora. Opcional: cadena de formato"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
#, fuzzy
#| msgid "Insert date. Optional: format string"
msgid "Insert date. Optional: format string."
msgstr "Insertar fecha. Opcional: cadena de formato"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "insertar end si es necesario"

#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
#, fuzzy
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart,          // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName,       // extract/add ClassName.\n"
"WithoutClassName,   // skip classname\n"
"WithoutName,        // skip function name\n"
"WithoutParamList,   // skip param list\n"
"WithVarModifiers,   // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes,  // skip colon, param types and default values\n"
"WithDefaultValues,  // extract default values\n"
"WithResultType,     // extract colon + result type\n"
"WithOfObject,       // extract 'of object'\n"
"WithCallingSpecs,   // extract cdecl; inline;\n"
"WithProcModifiers,  // extract forward; alias; external;\n"
"WithComments,       // extract comments and spaces\n"
"InUpperCase,        // turn to uppercase\n"
"CommentsToSpace,    // replace comments with a single space\n"
"                      //  (default is to skip unnecessary space,\n"
"                      //    e.g 'Do   ;' normally becomes 'Do;'\n"
"                      //    with this option you get 'Do ;')\n"
"WithoutBrackets,    // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon,   // skip semicolon at end\n"
msgstr ""
"Insertar cabecera en el procedure actual.\n"
"\n"
"Parametros opcionales (separados por comas):\n"
"WithStart,          // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName,       // extract/add ClassName.\n"
"WithoutClassName,   // skip classname\n"
"WithoutName,        // skip function name\n"
"WithoutParamList,   // skip param list\n"
"WithVarModifiers,   // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes,  // skip colon, param types and default values\n"
"WithDefaultValues,  // extract default values\n"
"WithResultType,     // extract colon + result type\n"
"WithOfObject,       // extract 'of object'\n"
"WithCallingSpecs,   // extract cdecl; inline;\n"
"WithProcModifiers,  // extract forward; alias; external;\n"
"WithComments,       // extract comments and spaces\n"
"InUpperCase,        // turn to uppercase\n"
"CommentsToSpace,    // replace comments with a single space\n"
"                      //  (default is to skip unnecessary space,\n"
"                      //    e.g 'Do   ;' normally becomes 'Do;'\n"
"                      //    with this option you get 'Do ;')\n"
"WithoutBrackets,    // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon,   // skip semicolon at end\n"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Insertar Macro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
#, fuzzy
#| msgid "Insert name of current procedure"
msgid "Insert name of current procedure."
msgstr "Insertar nombre del procedimiento actual"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Insertar etiqueta PrintShort"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Insertar etiqueta printshort"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Insertar encabezado de procedimiento"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Insertar nombre de procedimiento"

#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Insertar punto y coma si es necesario"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "insertar hora"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
#, fuzzy
#| msgid "Insert time. Optional: format string"
msgid "Insert time. Optional: format string."
msgstr "Inserta hora. Opcional: cadena de formato"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Insertar etiqueta url"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "En sesión"

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Inspeccionar"

#: lazarusidestrconsts.lisinspectaddwatch
#, fuzzy
msgctxt "lazarusidestrconsts.lisinspectaddwatch"
msgid "Add watch"
msgstr "Añadir punto de observación"

#: lazarusidestrconsts.lisinspectclassinherit
#, object-pascal-format, fuzzy
#| msgid "%s : Class %s inherits from %s"
msgid "%s: class %s inherits from %s"
msgstr "%s : Clase %s hereda desde %s"

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Datos"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Inspector de depuración"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Métodos"

#: lazarusidestrconsts.lisinspectpointerto
#, object-pascal-format
msgid "Pointer to %s"
msgstr "Puntero a %s"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Propiedades"

#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr "Mostrar columna de clase"

#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr "Mostrar columna de tipo"

#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr "Mostrar columna de visibilidad"

#: lazarusidestrconsts.lisinspectunavailableerror
#, object-pascal-format
msgid "%s: unavailable (error: %s)"
msgstr "%s: no disponible (error: %s)"

#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr "Instancia"

#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr "Utilizar clase de instancia"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Falló la instalación"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "instalado"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Instálalo, me gusta lo pesado"

#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format, fuzzy
#| msgid ""
#| "The following packages are not installed, but available in the main repository: %s.\n"
#| "Do you wish to install missing packages?\n"
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
"Los siguientes paquetes no están instalados, pero están disponibles en el repositorio principal: %s.\n"
"¿Deseas instalar los paquetes faltantes?\n"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Instalar selección"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Instalar/Desinstalar Paquetes"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "En lugar de compilar el paquete crear un simple Makefile."

#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Codificación insuficiente"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interactivo"

#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr "error interno: %s"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Borrado no válido"

#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Ejecutable Inválido"

#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr "el archivo \"%s\" no es un ejecutable."

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Expresión no válida.%Sugerencia: La función \"Crear Resourcestring\" espera una constante de cadena en un único archivo. Por favor seleccione la expresión e inténtelo de nuevo."

#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Nombre de archivo no válido"

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtro no válido"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr "Línea no válida, columna en mensaje%s%s"

#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr "Macros no válidos en \"%s\""

#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Macros no válidas \"%s\" en utilidad externa \"%s\""

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Macro invalida \"%s\". El nombre de la macro debe ser un identificador Pascal."

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Nombre no válido de la macro \"%s\". El nombre es una palabra clave."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Mascara Inválida"

#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr "Modo no válido %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Selección múltiple no válida"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Inválido (Desactivado)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Inválido (Activado)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificador no válido de Pascal"

#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "El nombre \"%s\" no es un identificador válido en Pascal.%s¿Usar de todas formas?"

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Nombre de procedimiento no válido"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nombre de archivo de proyecto no válido"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Directorio de publcación no válido"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Selección no válida"

#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "versión invalida en %s"

#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s ya forma parte del Proyecto"

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" es un nombre de proyecto no válido.%sPor favor escoja otro (e.g. proyecto1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s es a %s.%sEsta dependencia circular no está permitido."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "directorio no encontrado"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Incidencias"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr "Me pregunto como hizo eso. Error en el %s:"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Me pregunto como hizo eso: Error en el directorio base:"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Historial de Saltos"

#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Saltar hacia el error"

#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
#, fuzzy
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Cuando se encuentra un error en las fuentes en la finalización del identificador, saltar hacia éste."

#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Saltar al procedimiento %s"

#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr "%s KB"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Mantener"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Mantener los archivos convertidos abiertos en el editor"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Todos los archivos del proyecto serán abiertos en el editor después de la conversión"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Mantener en la lista de instalación"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Mantener nombre"

#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Mantener abierto"

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Mantener sangrado en relación a la plantilla de múltiples líneas"

#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Mantener sangrado"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Mantenerlos y continuar"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Tecla"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Comandos personalizados"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Comandos del diseñador"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Comandos del Inspector de Objetos"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Tecla (o 2 teclas en secuencia)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Abortar construcción"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Añadir direcciones de punto de interrupción"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Añadir origen de punto de interrupción"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Añadir Dato/punto de observación"

#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Añadir punto de observación"

#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Construir muchos modos"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Construir proyecto/programa"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Seleccionar esquema de teclas"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Clásico"

#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Limpiar y construir"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Cerrar proyecto"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Edtor de defines de CodeTools"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Compilar projecto/programa"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Configurar \"Archivo de Construcción\""

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Configurar Componentes Personalizados"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Ayuda sensible al contexto"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Convertir paquete de Delphi a paquete de Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Convertir Proyecto de Delphi a Proyecto de Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Convertir Unidad de Delphi a Unidad de Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Convertir archivo DFM a LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
#, fuzzy
#| msgid "Copy selected Components to clipboard"
msgid "Copy selected components"
msgstr "Copiar Componentes seleccionados al portapapeles"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
#, fuzzy
#| msgid "Cut selected Components to clipboard"
msgid "Cut selected components"
msgstr "Cortar componentes seleccionados al portapapeles"

#: lazarusidestrconsts.liskmdefaulttoosx
#, fuzzy
#| msgid "Default adapted to OS X"
msgid "Default adapted to macOS"
msgstr "Adaptado por defecto hacia OS X"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Borrar último caracter"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Editor de Archivos Diff"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Editar Plantillas de Código"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Editar ayuda sensible al contexto"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Encerrar Selección"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evaluar/Modificar"

#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Projectos Ejemplo"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Opciones de herramientas externas"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Búsqueda Incremental"

#: lazarusidestrconsts.liskmgotomarker0
#, fuzzy
#| msgid "Go to marker 0"
msgid "Go to bookmark 0"
msgstr "Ir a marca 0"

#: lazarusidestrconsts.liskmgotomarker1
#, fuzzy
#| msgid "Go to marker 1"
msgid "Go to bookmark 1"
msgstr "Ir a marca 1"

#: lazarusidestrconsts.liskmgotomarker2
#, fuzzy
#| msgid "Go to marker 2"
msgid "Go to bookmark 2"
msgstr "Ir a marca 2"

#: lazarusidestrconsts.liskmgotomarker3
#, fuzzy
#| msgid "Go to marker 3"
msgid "Go to bookmark 3"
msgstr "Ir a marca 3"

#: lazarusidestrconsts.liskmgotomarker4
#, fuzzy
#| msgid "Go to marker 4"
msgid "Go to bookmark 4"
msgstr "Ir a marca 4"

#: lazarusidestrconsts.liskmgotomarker5
#, fuzzy
#| msgid "Go to marker 5"
msgid "Go to bookmark 5"
msgstr "Ir a marca 5"

#: lazarusidestrconsts.liskmgotomarker6
#, fuzzy
#| msgid "Go to marker 6"
msgid "Go to bookmark 6"
msgstr "Ir a marca 6"

#: lazarusidestrconsts.liskmgotomarker7
#, fuzzy
#| msgid "Go to marker 7"
msgid "Go to bookmark 7"
msgstr "Ir a marca 7"

#: lazarusidestrconsts.liskmgotomarker8
#, fuzzy
#| msgid "Go to marker 8"
msgid "Go to bookmark 8"
msgstr "Ir a marca 8"

#: lazarusidestrconsts.liskmgotomarker9
#, fuzzy
#| msgid "Go to marker 9"
msgid "Go to bookmark 9"
msgstr "Ir a marca 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Ir a editor de código 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Ir a editor de código 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Ir a editor de código 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Ir a editor de código 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Ir a editor de código 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Ir a editor de código 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Ir a editor de código 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Ir a editor de código 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Ir a editor de código 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Ir a editor de código 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Insertar fecha y hora"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Insertar nombre de usuario"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspeccionar"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Esquema de teclado"

#: lazarusidestrconsts.liskmlazarusdefault
#, fuzzy
#| msgid "Lazarus (default)"
msgid "Lazarus default"
msgstr "Lazarus (predeterminado)"

#: lazarusidestrconsts.liskmmacosxapple
#, fuzzy
#| msgid "Mac OS X (Apple style)"
msgid "macOS, Apple style"
msgstr "Mac OS X (estilo Apple)"

#: lazarusidestrconsts.liskmmacosxlaz
#, fuzzy
#| msgid "Mac OS X (Lazarus style)"
msgid "macOS, Lazarus style"
msgstr "Mac OS X (estilo Lazarus)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Paquete Nuevo"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nuevo proyecto"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nuevo proyecto desde archivo"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Unidad Nueva"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nota: Todas las teclas obtendrán los valores del esquema seleccionado."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Abrir archivo de paquete"

#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr ""

#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr ""

#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr ""

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "Pegar componentes desde el portapapeles"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pausar programa"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publicar proyecto"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilación rápida, sin enlazar"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Remover Archivo Activo del Proyecto"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Ejecutar programa"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Guardar todo"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Guardar Como"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Guardar proyecto"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Guardar Proyecto Como"

#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Seleccionar Fin de Línea"

#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Seleccionar Principio de Línea"

#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Seleccionar Final de Página"

#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Seleccionar Principio de Página"

#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Seleccionar Palabra Izquierda"

#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Seleccionar Palabra Derecha"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Establecer Macador libre"

#: lazarusidestrconsts.liskmsetmarker0
#, fuzzy
#| msgid "Set marker 0"
msgid "Set bookmark 0"
msgstr "Establecer marca 0"

#: lazarusidestrconsts.liskmsetmarker1
#, fuzzy
#| msgid "Set marker 1"
msgid "Set bookmark 1"
msgstr "Establecer marca 1"

#: lazarusidestrconsts.liskmsetmarker2
#, fuzzy
#| msgid "Set marker 2"
msgid "Set bookmark 2"
msgstr "Establecer marca 2"

#: lazarusidestrconsts.liskmsetmarker3
#, fuzzy
#| msgid "Set marker 3"
msgid "Set bookmark 3"
msgstr "Establecer marca 3"

#: lazarusidestrconsts.liskmsetmarker4
#, fuzzy
#| msgid "Set marker 4"
msgid "Set bookmark 4"
msgstr "Establecer marca 4"

#: lazarusidestrconsts.liskmsetmarker5
#, fuzzy
#| msgid "Set marker 5"
msgid "Set bookmark 5"
msgstr "Establecer marca 5"

#: lazarusidestrconsts.liskmsetmarker6
#, fuzzy
#| msgid "Set marker 6"
msgid "Set bookmark 6"
msgstr "Establecer marca 6"

#: lazarusidestrconsts.liskmsetmarker7
#, fuzzy
#| msgid "Set marker 7"
msgid "Set bookmark 7"
msgstr "Establecer marca 7"

#: lazarusidestrconsts.liskmsetmarker8
#, fuzzy
#| msgid "Set marker 8"
msgid "Set bookmark 8"
msgstr "Establecer marca 8"

#: lazarusidestrconsts.liskmsetmarker9
#, fuzzy
#| msgid "Set marker 9"
msgid "Set bookmark 9"
msgstr "Establecer marca 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Parar Programa"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Cambiar entre Unidad y Formulario"

#: lazarusidestrconsts.liskmtogglemarker0
#, fuzzy
#| msgid "Toggle marker 0"
msgid "Toggle bookmark 0"
msgstr "Intercambiar marcador 0"

#: lazarusidestrconsts.liskmtogglemarker1
#, fuzzy
#| msgid "Toggle marker 1"
msgid "Toggle bookmark 1"
msgstr "Intercambiar marcador 1"

#: lazarusidestrconsts.liskmtogglemarker2
#, fuzzy
#| msgid "Toggle marker 2"
msgid "Toggle bookmark 2"
msgstr "Intercambiar marcador 2"

#: lazarusidestrconsts.liskmtogglemarker3
#, fuzzy
#| msgid "Toggle marker 3"
msgid "Toggle bookmark 3"
msgstr "Intercambiar marcador 3"

#: lazarusidestrconsts.liskmtogglemarker4
#, fuzzy
#| msgid "Toggle marker 4"
msgid "Toggle bookmark 4"
msgstr "Intercambiar marcador 4"

#: lazarusidestrconsts.liskmtogglemarker5
#, fuzzy
#| msgid "Toggle marker 5"
msgid "Toggle bookmark 5"
msgstr "Intercambiar marcador 5"

#: lazarusidestrconsts.liskmtogglemarker6
#, fuzzy
#| msgid "Toggle marker 6"
msgid "Toggle bookmark 6"
msgstr "Intercambiar marcador 6"

#: lazarusidestrconsts.liskmtogglemarker7
#, fuzzy
#| msgid "Toggle marker 7"
msgid "Toggle bookmark 7"
msgstr "Intercambiar marcador 7"

#: lazarusidestrconsts.liskmtogglemarker8
#, fuzzy
#| msgid "Toggle marker 8"
msgid "Toggle bookmark 8"
msgstr "Intercambiar marcador 8"

#: lazarusidestrconsts.liskmtogglemarker9
#, fuzzy
#| msgid "Toggle marker 9"
msgid "Toggle bookmark 9"
msgstr "Intercambiar marcador 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Vista Ensamblador"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Vista Puntos de Interrupción"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Vista Pila (Stack) de llamadas"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Cambiar vista a Visor de Código"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Cambiar vista a Explorador de código"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Cambiar a Vista Paleta de Componentes"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Cambiar Vista a Log de Eventos del Depurador"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Cambiar Vista a Salida del Depurador"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Cambiar vista a Editor de Documentación"

#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Ver Historial"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Cambiar vista de botnes de IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Vista Variables Locales"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Cambiar a vista de Mensajes"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Cambiar vista a Inspector de objetos"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
#, fuzzy
#| msgid "View Terminal Output"
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Ver Terminal de Salida"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Vista Registros"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Cambiar vista a Resultados de la Búsqueda"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Cambiar vista a Editor de código"

#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Ver Hilos (Threads)"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Vista Puntos de Observación"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Ver historial de saltos"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Ver opciones del proyecto"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Ver Fuente del Proyecto"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Ver información de la unidad"

#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Último abierto"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Lanzador de aplicación no válido"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Lanzando línea de comandos"

#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Predeterminados de Lazarus"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Directorio de Lazarus"

#: lazarusidestrconsts.lislazarusdiroverride
#, fuzzy
#| msgid "directory, to be used as a basedirectory"
msgid "directory to be used as a basedirectory"
msgstr "Directorio, para ser usado como directorio base"

#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "IDE de Lazarus v%s"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE de Lazarus"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID de idioma de Lazarus (por ejemplo: en, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nombre de idioma de Lazarus (por ejemplo: inglés, holandés)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opciones] <nombre-proyecto>"

#: lazarusidestrconsts.lislazarussvnrev
#, object-pascal-format
msgid "r%s"
msgstr "r%s"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Acción"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Elija el directorio de salida para el ejecutable del IDE"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "¿Esta seguro de querer borrar este perfil de construcción?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Construir Muchas"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Opciones Comunes"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Confirmar antes de construir"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Confirmar supresión"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "IDE Depurador"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Defines"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Defines sin -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Editar Defines"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Editar la lista de defines que pueden ser usadas por cualquier perfil"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Error escribiendo archivo"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild no es interactivo, abortando."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gestionar Perfiles de Construcción"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gestionar perfiles"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nombre del perfil activo"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Añadir un Perfil Nuevo"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Las actuales opciones de construcción serán asociadas con:"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "IDE Normal"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "IDE Optimizado"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opciones:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Opciones pasadas al compilador"

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Perfil de construcción"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Renombrar Perfil"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nombre nuevo para el perfil:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Reiniciar después de construir el IDE"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Reiniciar Lazarus automaticamente después de construir el IDE (no tiene efecto cuando se construyen otras partes)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Seleccionar perfiles de construcción"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Mostrar dialogo de confirmación cuando se construya directamente desde el menu Herramientas"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Mostrar opciones y definiciones para línea de comandos"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU objetivo:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Directorio objetivo:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "OS objetivo"

#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "No se ha podido escribir el archivo \"%s\":%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Actualizar revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Actualizar la información de la revisión en el dialogo \"Acerca de Lazarus\""

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Limpiar + Construir todo"

#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Versión de Lazarus (e.g. 1.2.4)"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Tipo de Widget LCL"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Añadir enlace a la herencia"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copiar desde heredado"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s no tiene ningún path FPDoc válido.%sNo se puede crear el archivo de fpdoc %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Mover entradas a heredado"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Path no válido FPDoc"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "La unidad %s no es propiedad de ningún paquete o proyecto.%sPor favor, añada la la unidad a un paquete o proyecto.%sNo se pudo crear el archivo fpdoc."

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Izquierda"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Espaciado izquierdo. Este valor de añade al espaciado base y se usa para el espacio izquierdo del control."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Anclaje izquierdo"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Este es el control hermano al cual el lado izquierdo está anclado. Déjelo vacío para que sea el padre."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Lados izquierdos"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Igualar espacio a la izquierda"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Menos"

#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Niveles"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "archivo LFM"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "El archivo LFM contiene propiedades/clases desconocidas que no existen en LCL. Puede ser reemplazados o eliminados."

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Fichero LFM corrupto"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM esta bien"

#: lazarusidestrconsts.lislgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Esta biblioteca es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU Library General Public License publicada por la Free Software Foundation; sea versión 2 de la licencia, o (a su opción) cualquier posterior versión. \n"
"\n"
"Este programa se distribuye con la esperanza de que sea útil, pero SIN NINGUNA GARANTÍA, ni siquiera la garantía implícita de COMERCIABILIDAD o IDONEIDAD PARA UN DETERMINADO FIN. Consulte la GNU Library General Public License para obtener más detalles. \n"
"\n"
"Usted debería haber recibido una copia de la GNU Library General Public License junto con esta biblioteca; Si no, escriba a la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "ruta de biblioteca"

#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr "Una biblioteca compartida de Free Pascal (.dll en Windows, .so en Linux, .dylib en MacOS X)."

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Línea:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Línea/Longitud"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Enlace:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "opciones del enlazador"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Enlace objetivo:"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "listar todos los valores case"

#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "La carga de %s falló"

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Cargar macro desde"

#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "&Local"

#: lazarusidestrconsts.lislocals
#, fuzzy
#| msgid "Locals"
msgctxt "lazarusidestrconsts.lislocals"
msgid "Local Variables"
msgstr "Locales"

#: lazarusidestrconsts.lislocalsdlgcopyall
msgid "Copy &all"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "&Copiar Nombre"

#: lazarusidestrconsts.lislocalsdlgcopynamevalue
msgid "Co&py Name and Value"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr "Copiar &Valor RAW"

#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "C&opiar Valor"

#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Locales no evaluadas"

#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Log pila(stack) de llamadas"

#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(marco límite. 0 - sin límites)"

#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Evaluar expresión"

#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Registrar Mensaje"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "cadena en minúsculas"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
#, fuzzy
#| msgid "Lowercase string given as parameter"
msgid "Lowercase string given as parameter."
msgstr "cadena dada como parámetro en minúsculas"

#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr ""

#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr ""

#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr ""

#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr ""

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk ha desaparecido en disco. Utilizando como alternativa %s"

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk extraviado"

#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Archivos de inclusión .lrs"

#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr ""

#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr "Macro %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Introducir datos"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Introducir Parámetros de Ejecución"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "La unidad principal tiene una sección uses que contiene todas las unidades del proyecto"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "La unidad principal es una fuente Pascal"

#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Asumir Pascal incluso si no finaliza con los sufijos .pas/.pp."

#: lazarusidestrconsts.lismakecurrent
#, fuzzy
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Actual"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Hacer ejecutable"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make no encontrado"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Crear ResourceString"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Añadir a sección"

#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring \"%s\" ya existe.%sPor favor escoja otro nombre.%sUse Ignorar para añadirla de todas formas."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opciones de conversión"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificador Personalizado"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificador"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Longitud de identificador:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefijo de Identificador:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Insertar afabéticamente"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Insertar sensible al contexto"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Sección de Resourcesting no válida"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Por favor, escoja una sección de resourcestring de la lista."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Ya existe Resourcestring"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sección Resourcestring:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Previsualizar fuente"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Constante de Cadena en Código Fuente"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Las cadenas con mismo valor:"

#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Asegúrate de que todos los ficheros ppu del paquete se encuentren en su correspondiente directorio de salida."

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Gestionar Editores de fuente ..."

#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
#, fuzzy
#| msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Número máximo de hilos para compilación paralela. El valor predeterminado es 0, lo que lleva a obtener el número de núcleos en el sistema."

#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Máximos procesos paralelos, 0 significa por defecto (%s)"

#: lazarusidestrconsts.lismaxs
#, object-pascal-format
msgid "Max %d"
msgstr "Máx %d"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr "%s Tal vez tenga que recompilar el paquete."

#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr "%s MB"

#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Acción"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Volcado de Memoria"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Abortar Construcción"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Acerca de FPC"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Añadir Punto de Interrupción"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Añadir archivo Activo al Paquete ..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Añadir Punto de Salto al Historial"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Añadir Archivo de Editor al Proyecto"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Añadir Punto de Observación ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Dividir Líneas en la Selección"

#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr "&Break"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Construir Archivo"

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Construir Lazarus con el Perfil Actual"

#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Construir Lazarus con el Perfil: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Verificar archivo LFM en Editor"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Limpiar Directorio ..."

#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Limpiar y Construir ..."

#: lazarusidestrconsts.lismenucloseall
msgid "Close A&ll"
msgstr "Cerrar Todos"

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "&Cerrar Editor Archivo"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Cerrar Proyecto"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Editor de Defines de CodeTools ..."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Comentar Selección"

#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Comparar Ficheros ..."

#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Compilar algunos Modos ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completar Código"

#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Código completo (con diálogo)"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configurar Archivo Construir+Ejecutar"

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Configurar Componentes Personalizados ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Configuración de Herramientas Externas ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configurar \"Construir Lazarus\" ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Ayuda sensible al contexto"

#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr "&Continuar"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Convertir Paquete de Delphi a Paquete de Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Convertir Proyecto de Delphi a Proyecto de Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Convertir Unidad de Delphi a Unidad de Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Convertir Archivo Binario DFM a Texto LFM y Comprobar Sintaxis..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Convertir Codificación de Página de Proyectos/Paquetes ..."

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Ventanas de Depuración"

#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Conversión Delphi"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editar"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Plantillas de Código ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Editar Ayuda sensible al contexto"

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Instalar/Desinstalar Paquetes ..."

#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format, fuzzy
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "Clave de acelerador(&&) \"%s\" necesita cambio"

#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Añadir un elemento nuevo encima del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Añadir un elemento nuevo después del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Añadir un elemento nuevo antes del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Añadir un elemento nuevo debajo del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Añadir un submenú a la derecha del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Añadir un submenu abajo del elemento seleccionado"

#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "&Añadir desde plantilla ..."

#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr "Añadir icono desde %s"

#: lazarusidestrconsts.lismenueditoraddimagelisticon
#, fuzzy
msgid "Add imagelist &icon"
msgstr "Añadir &icono de lista de imagenes"

#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Añadir elemento de menu"

#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "6Añadir elemento nuevo encima"

#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Añadir elemento nue&vo antes"

#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "&Añadir elemento nuevo despues"

#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Añadir nue&vo elemento antes"

#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Añadir &OnClick handler"

#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Añadir separador &antes"

#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Añadir un separador &despues"

#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Añadir submenu"

#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Añadir &submenú abajo"

#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Añadir &submenú a la derecha"

#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Una nueva plantilla de menú descrita como \"%s\" ha sido grabada basada en %s, con %d subelementos"

#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
#, fuzzy
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "&Editar,Edición básica de menu,&Deshacer,Ctrl+Z,&Rehacer,,-,,Seleccionar &todo,Ctrl+A,Cort&ar,Ctrl+X,C&opiar,Ctrl+C,Peg&ar,Ctrl+V,Pegado e&special,,-,,B&uscar,,R&eemplazar,,&Ir hacia ...,,"

#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Archivo,Archivo de menú básico,&Nuevo,,&Abrir ...,,&Grabar,,Grabar &como,,-,,&Imprimir,,Configu&ración de impresión ...,,-,,Sal&ir,,"

#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Ayuda,Menú de ayuda básica,&Contenidos de ayuda,F1,&Indice de ayuda,,Ayuda &enlinea,,-,,Información de &Licencia,,&Verificar actualizaciones,,-,,&Acerca,,"

#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "&Ventana,Menú de ventana básico,&Nueva ventana,,&Tile,,&Cascada,&Arreglar todo,,-,,&Ocultar,,&Mostrar,,"

#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Título"

#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format, fuzzy
msgid "Captioned items: %s"
msgstr "Elementos subtitulados: %s"

#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "Título no debería quedar en blanco"

#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr "Cambiar el acelerador en conflicto \"%s\""

#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Cambiar &icono de lista de imagen"

#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr "Cambiar %s por %s"

#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr "Cambiar el atajo en conflicto \"%s\""

#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format, fuzzy
msgid "Change the shortCut for %s"
msgstr "Cambiar shortCut por %s"

#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr "Cambiar shortCutKey2 por %s"

#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Elegir plantilla para borrar"

#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Elegir plantilla para insertar"

#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Presionar un elemente no-gris para editar su atajo o presionar en la cabecera para ordenar por esa columna"

#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "Componente es de tipo inesperado"

#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "Componente no tiene nombre"

#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<Resolución de conflictos completa>"

#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr "Conflictos inicialmente encontrados: %d"

#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format, fuzzy
msgid "Deepest nested menu level: %s"
msgstr "Nivel de menú anidado más profundo: %s"

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "&Borrar Elemento"

#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "&Borrar plantilla de menú ..."

#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Borrar plantilla de menú grabada"

#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Borrar plantilla de menú seleccionada"

#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "¿Borrar este elemento de su subelemento?"

#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Visualizar la vista previa como Menú &Popup"

#: lazarusidestrconsts.lismenueditoreditcaption
#, fuzzy
msgid "Edit &Caption"
msgstr "Editar &Título"

#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format, fuzzy
msgid "Editing Caption of %s"
msgstr "Editar título de %s"

#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr "Para resolver el conflicto editar %s.%s"

#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr "Editar %s para %s"

#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr "Editar %s.%s - no el elemento de menú seleccionado"

#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "Entrar una &Descripción de menú"

#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr "Entrar un nuevo ShortCut para %s"

#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Entrar un nuevo ShortCutKey2 para %s"

#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Plantillas guardadas existentes"

#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "Otro conflicto de atajo"

#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Obtener ayuda para usar este editor"

#: lazarusidestrconsts.lismenueditorgrabkey
#, fuzzy
msgid "&Grab key"
msgstr "&Agarrar tecla"

#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr "GroupIndex: %d"

#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr "Valores en uso: %s"

#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Descripción inadecuada"

#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr "Insertar plantilla de menú en la raíz de %s"

#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Insertar plantilla de menú seleccionada"

#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "no está asignado"

#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr "Elementos con icono: %s"

#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr "Lista de atajos y &aceleradores para %s ..."

#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr "Lista de atajos para %s"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor de Menú"

#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Acciones de elementos de menú"

#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr "Conflictos de atajos de elemento de menú en %s"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Mover Abajo (o derecha)"

#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Mo&ver elemento abajo"

#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "&Mover elemento hacia la izquierda"

#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Mo&ver elemento hacia la derecha"

#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "&Mover elemento arriba"

#: lazarusidestrconsts.lismenueditormoveselecteditemdown
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Mover el elemento seleccionado hacia abajo"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Mover elemento seleccionado hacia la izquierda"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Mover elemento seleccionado hacia la derecha"

#: lazarusidestrconsts.lismenueditormoveselecteditemup
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Mover el elemento seleccionado hacia arriba"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Mover Arriba (o Izquierda)"

#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "n/a"

#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(sin menú seleccionado)"

#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<nada>"

#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "<nada>,<nada>"

#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<sin conflictos de atajo>"

#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Sin plantilla de usuario grabadas"

#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr "Elige un icono desde %s"

#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr "Asignación de ventanas emergentes: %s"

#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "Elemento Radio"

#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr "Conflictos restantes: %s"

#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "&Remover todos los separadores"

#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr "Conflictos resueltos: %s"

#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Resolver conflictos seleccionados"

#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "&Resolver conflictos seleccionados ..."

#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Plantillas guardadas"

#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "&Grabar menú como una plantilla ..."

#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Grabar menú como una plantilla"

#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Grabar menú como plantilla para un uso futuro"

#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Grabar el menú mostrado como una nueva plantilla"

#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr "%s conflictos con %s"

#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr "Se&paradores"

#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr "Elementos atajo: %s"

#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "Atajo aún no ha cambiado"

#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Atajos"

#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Ata&jos"

#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Teclas de atajos y aceleradores"

#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr "Atajos (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Teclas de atajos (%d) y aceleradores (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Atajo, Propiedad de origen"

#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr "Atajos usados en %s"

#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr "Atajos usados en %s (%d)"

#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr "ShowMenuEditor: TMenu parámetro es nulo"

#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr "\"%s\" en %s"

#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format, fuzzy
#| msgid ""
#| "\"%s\" is already in use in %s as a shortcut.\n"
#| "Try a different shortcut.\n"
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
"\"%s\" está usado en %s como un atajo.\n"
"Intenta con un diferente atajo.\n"

#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Por favor expanda: \"%s\" no es una Descripción suficiente"

#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr "Algunos widgetsets no permiten separadores en la barra de menú principal"

#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr "%s: Atajos"

#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s: Teclas de atajos y aceleradores"

#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - OnClick: %s"

#: lazarusidestrconsts.lismenueditorssubmenu
#, object-pascal-format
msgid "%s submenu"
msgstr "%s submenu"

#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Plantillas estandar"

#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Descripción de plantilla:"

#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "&Plantillas"

#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Plantilla guardada"

#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
#, fuzzy
#| msgid ""
#| "There are no user-saved menu templates.\n"
#| "\n"
#| "Only standard default templates are available.\n"
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
"No hay plantillas de menú guardadas por el usuario.\n"
"\n"
"Solo las plantillas estándar por defecto están disponibles.\n"

#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName: índice invalido %d para FScanList"

#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format, fuzzy
#| msgid ""
#| "You have to change the shortcut from %s\n"
#| "to avoid a conflict\n"
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
"Tienes que cambiar el atajo desde %s\n"
"para evitar un conflicto\n"

#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
#, fuzzy
msgid "You must enter text for the Caption"
msgstr "Debes ingresar texto para el Caption"

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Encerrar en $IFDEF ..."

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Encerrar Selección ..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Evaluar/Modificar ..."

#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Proyectos Ejemplo ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Extraer Procedimiento ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Archivo"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Buscar"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Buscar..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Buscar Otro Final del Bloque de Código"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Buscar Inicio del Bloque de Código"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Buscar Declaración desde Cursor"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Buscar Referencias del Identificador ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Buscar &en Archivos ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Buscar &Siguiente"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Buscar &Anterior"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Buscar Referencias de Unidades Utilizadas"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opciones ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Ir a Directiva de Inclusión"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Ir a Línea ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Buscar IFDEF/ENDIF Fuera de Lugar"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Buscar bloque sin Cerrar"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "A&yuda"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Interioridades del IDE"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Búsqueda Incremental"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Sangrar Selección"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Entrada de registro de cambios"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Insertar desde Mapa de Caracteres ..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Insertar palabra clave de CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Fecha y Hora Actual"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Insertar Nombre de archivo completo ..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "General"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Aviso GPL"

#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Aviso GPL (traducido)"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Aviso LGPL"

#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Aviso LGPL (traducido)"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Aviso MIT"

#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Aviso MIT (traducido)"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Aviso LGPL modificado"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Aviso LGPL Modificada (traducido)"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Nombre de Usuario Actual"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Inspeccionar"

#: lazarusidestrconsts.lismenujumpback
msgid "Jump Back"
msgstr "Saltar Hacia Atrás"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump Forward"
msgstr "Saltar Hacia Adelante"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Saltar a"

#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Saltar a la Implementacion"

#: lazarusidestrconsts.lismenujumptoimplementationuses
#, fuzzy
msgid "Jump to Implementation uses"
msgstr "Saltar a los uses de implementación"

#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Saltar a inicialización"

#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Salta a la interfaz"

#: lazarusidestrconsts.lismenujumptointerfaceuses
#, fuzzy
msgid "Jump to Interface uses"
msgstr "Saltar a los uses de la interfaz"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Saltar al Marcador Siguiente"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Saltar al Error Siguiente"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Saltar al Marcador Anterior"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Saltar al Error Anterior"

#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Saltar al inicio del Procedure"

#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Saltar a la cabecera del Procedure"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Selección en Minúsculas"

#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr "Editor Macros ..."

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Crear ResourceString ..."

#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Pegado múltiple ..."

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nuevo Componente"

#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr "Nuevo %s"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nuevo Formulario"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nuevo ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Paquete Nuevo ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nuevo Proyecto ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Nuevo proyecto desde archivo ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nueva Unidad"

#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Aceptar"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Ayuda en línea"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Abrir ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Abrir Nombre de Archivo en Cursor"

#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Abrir folder ..."

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Abrir Paquete cargado ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Abrir Archivo de Paquete (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Abrir Paquete de Unidad Actual"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Abrir Proyecto ..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Abrir &Reciente"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Abrir Paquete Reciente"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Abrir Proyecto Reciente"

#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Abrir Unit ..."

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Pa&quete"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Gráfico de Paquete"

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Enlaces de Paquete ..."

#: lazarusidestrconsts.lismenupastefromclipboard
#, fuzzy
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Pegar desde el portapapeles"

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Nuevo paquete componente"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Lista de Procedimientos ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Proyecto"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspector de Proyecto"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opciones del Proyecto ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Ejecuta&r"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publicar Proyecto ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Compilado Rápido"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Comprobación Rápida de la Sintaxis"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Verificación rápida de sintaxis exitosa"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Eliminar del Proyecto ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Renombrar Identificador ..."

#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Reportar un error"

#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Re-grabar formularios con i18n habilitado"

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Escanear de Nuevo el Directorio de Fuentes de FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Reiniciar Depurador"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Deshacer"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "Ejecuta&r"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Ejecutar Archivo"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Parámetros de Ejecución ..."

#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Step over to &Cursor"
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Ejecutar hasta el &Cursor"

#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Ejecutar sin depuración"

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Guardar"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Guard&ar Como ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Guardar Proyecto"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Guardar Proyecto Como ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Buscar"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Seleccionar"

#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Seleccionar Todo"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Seleccionar Bloque de Código"

#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Seleccionar Línea"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Seleccionar Párrafo"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Seleccionar Paréntesis"

#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Seleccionar Palabra"

#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Establecer un Marcador Libre"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Ver Punto de Ejecucción"

#: lazarusidestrconsts.lismenushowsmarthint
#, fuzzy
msgid "Context sensitive smart hint"
msgstr "Sugerencia inteligente sensible al contexto"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Ordenar selección ..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "&Fuente"

#: lazarusidestrconsts.lismenustepinto
msgid "Step In&to"
msgstr "Paso a paso por Ins&trucciones"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr "Paso a Paso por Instrucciones (Contexto)"

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Avanzar una Instrucción"

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Avanzar una Instrucción"

#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr "Ejecutar hasta el retorno de la función"

#: lazarusidestrconsts.lismenustepover
msgid "&Step Over"
msgstr "Paso a Paso por Funciones"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr "Paso a Paso por Funciones (Contexto)"

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Saltar una Instrucción"

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Saltar una Instrucción"

#: lazarusidestrconsts.lismenusteptocursor
msgctxt "lazarusidestrconsts.lismenusteptocursor"
msgid "Step over to &Cursor"
msgstr ""

#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Intercambiar Mayús./Minús. en Selección"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Tabulaciones a Espacios en Selección"

#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Acerca de"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Intercambiar Comentario en Selección"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Herramientas"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Descomentar Selección"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Desangrar Selección"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Selección en Mayúsculas"

#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Añadir Unidad a Sección Uses ..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Ver"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Editor de Anclaje"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Ensamblador"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Puntos de Interrupción"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Pila (stack) de Llamadas"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Navegador de Código"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Paleta de Componentes"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "Lista de &Componentes"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Log de Eventos"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Depurar Salida"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Formularios ..."

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Historial"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Historial de Saltos"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Variables Locales"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Ventana de Mensajes"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspector de Objetos"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Ver Fuente Proyecto"

#: lazarusidestrconsts.lismenuviewpseudoterminal
#, fuzzy
#| msgid "Terminal Output"
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Salida Terminal"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registros"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Explorador de Restricciones"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Buscar Resultados"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor de Código Fuente"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Orden de Tabulación"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Hilos (Threads)"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Cambiar Vista Formulario/Unidad"

#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Dependencias de la Unidad ..."

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Información de la Unidad ..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Unidades ..."

#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Puntos de Observación"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Que necesitas para construir"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Ven&tana"

#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Otras Pestañas"

#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Proyectos"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor de Mensajes"

#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Ventana de Mensajes"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Método de clase no hallado"

#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr "directorio desaparecido \"%s\""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eventos desaparecidos"

#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr "ejecutable desaparecido \"%s\""

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificadores desaparecidos"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Paquetes Desaparecidos"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Sus opciones son:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Descomentar"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Solo para Delphi"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Descomentar las unidades seleccionadas."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Usar las unidades solo para Delphi."

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Buscar unidades. Las rutas encontradas son añadidas a la configuración del proyecto."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Abortar ahora, instalar paquetes o arreglar las rutas e intentar de nuevo."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Ruta de Busqueda de Unidades"

#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Omitir esta Unidad"

#: lazarusidestrconsts.lismitnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (c) <year> <copyright holders>\n"
#| "\n"
#| "Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
#| "\n"
#| "The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
#| "\n"
#| "THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permiso se concede por el presente, gratuitamente, a cualquier persona a obtener una copia de este software y archivos asociados de documentación (el \"Software\"), para tratar en el Software sin restricción, incluyendo sin limitación los derechos para utilizar, copia, modificar, combina, publica, distribuir, otorgar una sublicencia, y/o vender copias del Software y para permitir a las personas a quienes el Software se suministra para hacerlo, sujeto a la siguiente condiciones:\n"
"\n"
"El sobre aviso de copyright y este aviso de permiso se incluirán en todas las copias o partes sustanciales de la Software.\n"
"\n"
"EL SOFTWARE ES PROPORCIONADO \"COMO ES\", SIN GARANTÍA DE CUALQUIER TIPO, EXPRESS O IMPLÍCITAS, INCLUYENDO PERO NO LIMITADO A LAS GARANTÍAS DE COMERCIABILIDAD, APTITUD PARA UN PARTICULAR PROPÓSITO Y NO INFRACCIÓN. EN NINGÚN CASO LOS AUTORES O LOS TITULARES DEL COPYRIGHT SERÁ RESPONSABLE DE CUALQUIER RECLAMACIÓN, DAÑOS U OTRA RESPONSABILIDAD, YA SEA EN UNA ACCIÓN DE RESPONSABILIDAD CONTRACTUAL, EXTRACONTRACTUAL O DE OTRO TIPO, QUE SE PRESENTA, DE O EN RELACIÓN CON EL SOFTWARE O EL USO U OTRAS OPERACIONES EN EL SOFTWARE.\n"

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Añadidos y reemplazos"

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Añade opciones personalizadas:"

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Añade opciones arbitrarias de fpc, e.g. -O1 -ghtl -dFlag"

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Aplicar a todos los paquetes."

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Aplicar a todos los paquetes y proyectos."

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr "Aplicar a todos los paquetes coincidentes en nombre con \"%s\""

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Aplicar a proyecto."

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Crear un nuevo grupo de opciones"

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Opción personalizada"

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Eliminar el objetivo seleccionado u opción"

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "No añadir opciones personlaizadas:"

#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr "No tiene Macro de IDE %s:=%s"

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "No reemplazar OutDir (-FU)"

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr "Excluir todos los paquetes que coincidan con el nombre \"%s\""

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format, fuzzy
#| msgid "expected \":=\" after macro name, but found \"%s\""
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "se esperaba \":=\" después de nombre de macro, pero se encontró \"%s\""

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format, fuzzy
#| msgid "expected macro name, but found \"%s\""
msgid "expected macro name but found \"%s\""
msgstr "nombre de macro esperado, pero se encontró \"%s\""

#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr "Desde %s hasta %s"

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "Macro de IDE"

#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr "Macro de IDE %s:=%s"

#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr "carácter no válido  \"%s\" at %s"

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr "carácter no válido en valor de macro \"%s\""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "nombre de macro perdido"

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Mover el elemento seleccionado hacia abajo"

#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Mover el elemento seleccionado hacia arriba"

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Nuevo Objetivo"

#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr "Reemplazar OutDir (-FU): %s"

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Reemplazar directorio de salida (-FU)"

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Reemplazar directorio de salida -FU de objetivo"

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Rehacer el último deshacer de esta rejilla"

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Establecer una macro de IDE, e.g.: LCLWidgetType:=win32"

#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr "establecer \"%s\""

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Almacenado en el IDE (environmentoptions.xml)"

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Almacenado en el proyecto (.lpi)"

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Almacenado en la sesión del proyecto (.lps)"

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Objetivos: "

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Deshacer último cambio realizado en esta rejilla"

#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr "Usar codificación del sistema"

#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr "Deshabilitar soporte para UTF-8 para codificación de cadenas por defecto."

#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr "Valor \"%s\""

#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr "(era \"%s\")"

#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
#, fuzzy
msgid "WidgetSet change is available only for LCL projects"
msgstr "Cambios al WidgetSet están disponibles solo para proyectos LCL"

#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", Modo: %s"

#: lazarusidestrconsts.lismodifiedlgplnotice
#, fuzzy
#| msgid ""
#| "<description>\n"
#| "\n"
#| "Copyright (C) <year> <name of author> <contact>\n"
#| "\n"
#| "This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
#| "\n"
#| "As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
#| "\n"
#| "This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
#| "\n"
#| "You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Esta biblioteca es software libre; usted puede redistribuirlo y/o modificarlo bajo los términos de la GNU Library General Public License publicada por la Free Software Foundation; sea versión 2 de la licencia, o (a su opción) cualquier versión posterior con la siguiente modificación:\n"
"\n"
"Como una excepción especial, los titulares de derechos de autor de esta biblioteca darle permiso para vincular esta biblioteca con módulos independientes para producir un ejecutable, independientemente de los términos de la licencia de estos módulos independientes y a copiar y distribuir el archivo ejecutable resultante en términos de su elección, siempre y cuando cumplan también, para cada uno módulo independiente linkado, los términos y condiciones de la licencia de dicho módulo. Un módulo independiente es un módulo que no sea derivado o basado en esta biblioteca. Si se modifica esta biblioteca, usted puede extender esta excepción a su versión de la biblioteca, pero no está obligado a hacerlo. Si usted no desea hacerlo, elimine esta declaración de excepción de su versión del programa.\n"
"\n"
"Esto se distribuye con la esperanza que sea útil, pero sin ninguna garantía; ni siquiera la garantía implícita de comerciabilidad o idoneidad para un fin determinado. Consulte la GNU Library General Public License para obtener más detalles. \n"
"\n"
"Usted debería haber recibido una copia de la GNU Library General Public License junto con esta biblioteca; Si no, escriba a la Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Modificar"

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Más"

#: lazarusidestrconsts.lismoresub
#, fuzzy
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Más"

#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Mover"

#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr ""

#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Mover Ficheros"

#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "¿Mover ficheros?"

#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Mover %s ficheros(s) desde %s al directorio%s%s%sof %s?"

#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Mover \"%s\" una posición abajo"

#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Mover \"%s\" una posición arriba"

#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "¿Mover o Copiar ficheros?"

#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "¿Mover o copiar %s fichero(s) desde %s al directorio%s%s%sof %s"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Mover Página"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Mover item selecionado abajo (Ctrl+Down)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Mover item selecionado arriba (Ctrl+Up)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Mover a: "

#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr ""

#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Mover estas unidades romperá su sección uses. Ver ventana de mensajes para más detalles."

#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "C style: \" => \\\""

#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr "Escape de &citas"

#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Pegado múltiple"

#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "Pascal style: ' => ''"

#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "&Opciones de pegado"

#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "&Previsualización"

#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Texto &después de cada línea"

#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Texto &antes de cada línea"

#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "&Trim contenido del portapapeles"

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"

#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Colores de mensaje"

#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Multiples directorios se separan mediante punto y coma (;)"

#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", multiples paquetes: "

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Guardar mensajes al archivo (*.txt)"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nombre"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflicto de nombre"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Nombre del modo de construcción activa"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nombre del nuevo procedimiento"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nunca"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nuevo"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nueva clase"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nueva aplicación de consola"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Crear un nuevo archivo de editor.%s Escoja el tipo."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Crear un nuevo archivo de texto vacío."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Crear un proyecto nuevo.%s Escoja el tipo."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Crear un paquete estándar nuevo.%sUn paquete es una colección de unidades y componentes."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Crear una unidad nueva con un módulo de datos."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Crear una unidad nueva con un frame."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Crear una unidad nueva con un formulario LCL."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Heredar de un formulario o componente de proyecto."

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "No se han seleccionado elementos"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Por favor seleccione primero un elemento."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Codificación de página nueva:"

#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Macro %d"

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Nuevo nombre de Macro"

#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
#, fuzzy
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Nuevas implementaciones de métodos son insertadas entre los métodos existentes de esta clase. Por orden alfabético, o al último, o en orden de declaración."

#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
#, fuzzy
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Nuevo método o declaraciones de miembro en la sección class..end son insertadas alfabéticamente o añadidas al último."

#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Nueva página"

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nuevo proyecto)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Nuevas macros grabadas. No han sido salvadas"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Las unidades nuevas son añadidas a las secciones uses"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "No"

#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr ""

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "No crear archivos de respaldo"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Ningún perfil ha sido seleccionado para ser construido"

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Sin cambios"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "No se ha seleccionado código"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "No se heredan opciones del compilador."

#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr ""

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "sin indicios"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "No hay ninguna ventana IDE seleccionada"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Sin archivo LFM"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Ningúna macro seleccionada"

#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(no se ha seleccionado un mensaje)"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "sin nombre"

#: lazarusidestrconsts.lisnone
#, object-pascal-format
msgid "%snone"
msgstr "%sninguno"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "ninguno, clic para elegir uno"

#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Ninguno seleccionado)"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "No hay ningún nodo seleccionado"

#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "No es un archivo Pascal"

#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr "Ningún archivo de programa \"%s\" ha sido encontrado."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "No se ha encontrado sección de ResourceString"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalmente el filtro es una expresión regular. En Sintaxis Simple un . es un caracter normal, un * significa cualquier cosa, un ? significa cualquier caracter, coma y punto y coma separan alternativas. Por ejemplo: Simple Syntax *.pas;*.pp corresponde a ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "No se ha encontrado constante de cadena"

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "No es un paquete para tiempo de diseño"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "No es un paquete instalable"

#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr ""

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr "Identificador Pascal no valido"

#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Nota"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Abajo"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Izquierda"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Derecho"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Arriba"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOTA: No se pudo crear la Plantilla de Defines para los Fuentes de Free Pascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOTA: No se pudo crear la Plantilla de Defines para los fuentes de Lazarus"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "sin plantilla seleccionada"

#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr "%s no encontrado en %s en línea %s, columna %s.%sPuede que el mensaje esté desactualizado"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "No implementado"

#: lazarusidestrconsts.lisnotimplementedyet
#, object-pascal-format
msgid "Not implemented yet:%s%s"
msgstr "No implementado todavía:%s%s"

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "no instalado"

#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Paquetes no instalados"

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Todavía no"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Ahora cargado: "

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Crear"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Crear un proyecto nuevo"

#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Número de archivos a convertir: %s"

#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "El Inspector de Objetos se hace visible cuando los componentes se seleccionan en el diseñador."

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - predeterminado"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "ruta de objeto"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Cambiar a pestaña Favoritos del Inspector de Objetos"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "¿? (Desactivado)"

#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr " de paquete %s"

#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr "del Inspector de Proyecto"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Añadir a propiedades favoritas"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Elija una clase base para la propiedad favorita \"%s\"."

#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "Clase \"%s\" no encontrada."

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Quitar de propiedades favoritas"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "instalar automáticamente dinámicos"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "instalar automáticamente estáticos"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Descripción: "

#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription:  %s"
msgstr "%s Descripción: %s"

#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename:  %s"
msgstr "Nombre de archivo: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "instalado dinámico"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "instalado estático"

#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense:  %s"
msgstr "%sLicencia:  %s"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "falta"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modificado"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Abrir Paquete Cargado"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nombre de Paquete"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Por favor seleccione un paquete"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "sólo lectura"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Estado"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format, fuzzy
#| msgid "%sThis package is installed, but the lpk file was not found"
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sEste paquete ya está instalado, pero no se ha encontrado el archivo lpk."

#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "Aceptar"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Clase antigua"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "¿? (Activado)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Al final de línea (ej. retorno o tecla enter)"

#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "disponible en el repositorio principal"

#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "solo 32bits"

#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Solo disponible en Windows. Ejecutar la herramienta oculta."

#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Solo disponible en Windows. Ejecutar herramienta en una nueva consola."

#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Solamente mensajes que se ajusten a esta expresión regular:"

#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Solamente mensajes con estos IDs de FPC (separados por comas):"

#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Solo registrar los archivos de paquete de Lazarus (.lpk). No construir."

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Sólo busca palabras completas"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Al pegar desde portapapeles"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Abrir"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Abrir como un archivo XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Abrir el diseñador de la unidad abierta"

#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "El formulario se carga en el diseñador cuando se abre su unidad fuente."

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Abrir archivo existente"

#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Abrir archivo"

#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Abrir archivo"

#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Abrir archivo en el cursor"

#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Abrir en administrador de archivos"

#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "Abrir directorio de destino en el administrador de archivos"

#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Abrir %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "¿Abrir paquete?"

#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "Abrir paquete %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Abrir archivo de paquete"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "¿Abrir Proyecto?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Abrir proyecto"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Abrir proyecto otra vez"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Abrir archivo de Proyecto"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Abrir enlace simbólico"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Abrir objetivo"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Abrir el archivo como código normal"

#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format
msgid "Open the package %s?"
msgstr "¿Abrir el paquete %s?"

#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format
msgid "Open the project %s?"
msgstr "¿Abrir el proyecto %s?"

#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Abrir Opciones de Utilidades"

#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Abrir Unit"

#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Abrir URL"

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Abrir XML"

#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Opciones"

#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Opciones cambiadas, recompila limpiando con -B"

#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "ignorado"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "o"

#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ", OS: %s"

#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format, fuzzy
#| msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "Otros trayectos de fuente de paquete \"%s\" contienen el directorio \"%s\", que ya existe en el trayecto de búsqueda de unidad. "

#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "directorio de salida de %s contiene la fuente de la unidad de Pascal \"%s\""

#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr ""

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Reemplazar lenguaje. Por ejemplo --languaje=de. Para los valores posibles mirar los archivos en el directorio languages"

#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "Reemplazar tipos de cadenas de resultados de funciones con el primer tipo de expresión de parámetros"

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, object-pascal-format
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sreemplaza al compilador predeterminado. ej. ppc386 ppcx64 ppcppc etc. El predeterminado se almacena en environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, object-pascal-format
msgid "%soverride the project or IDE build mode."
msgstr "%sreemplaza el projecto o el modo de construcción del IDE"

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sreemplaza al cpu del proyecto. ej. i386 x86_64 powerpc powerpc_64 etc. predeterminado: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sreemplaza al sistema operativo del proyecto. ej. win32 linux. predeterminado: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
#, object-pascal-format
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sreemplaza el widgetset del proyecto. ej. gtk gtk2 qt win32 carbon. predeterminado: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "¿Sobreescribir archivo?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Sobreescribir archivo en disco"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Propietario' ya es usado por TReader/TWriter. Por favor, escoja otro nombre."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paquete"

#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "paquete %s"

#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", paquete %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Información de paquete"

#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr ""

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "El nombre de paquete comienza con ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "El nombre de paquete contiene ..."

#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "El paquete necesita un directorio de salida."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "El paquete necesita instalación"

#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr "Opción de Paquete \"%s\""

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Directorios de salida de paquetes"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Directorios de fuentes de paquetes"

#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "Unidad de paquete"

#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr "Página"

#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Nombre de página"

#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr "El nombre de página  \"%s\" ya existe. No se añade."

#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Pánico"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analizado"

#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr "analizador \"%s\": %s"

#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Analizadores:"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Cuenta de pasadas"

#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
#, object-pascal-format, fuzzy, badformat
msgid "passing compiler define \"%s\" twice with different values"
msgstr "pasar la definición \"% s\" del compilador dos veces con diferentes valores"

#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
#, object-pascal-format, fuzzy, badformat
msgid "passing compiler option -%s twice with different values"
msgstr "pasar la definición -% s del compilador dos veces con diferentes valores"

#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Pegar"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Pegar portapapeles"

#: lazarusidestrconsts.lispastefromclipboard
#, fuzzy
#| msgid "Paste from clipboard"
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Pegar desde el portapapeles"

#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Colores Pastel"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Ruta"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Explorar"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Borrar Paths Invalidos"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Mover ruta abajo (Ctrl+Abajo)"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Mover ruta arriba (Ctrl+Arriba)"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Añadir nuevo path a la lista"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Borrar el path seleccionado"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Quitar paths no existentes (gris) de la lista"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Reemplazar el path seleccionado con un nuevo path"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Añadir plantilla a la lista"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Ruta de plantillas"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Buscar rutas:"

#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr ""

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "path para el cache instantfpc"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Ruta a la utilidad make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Ruta a Instancia Fallida"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pausar"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Limpia para usar el nombre del paquete"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Desactiva I18N de lfm"

#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Añadir Archivos desde el Sistema de Archivos"

#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr "Añadir otros elementos"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Agregar al Proyecto"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Aplicar cambios"

#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(disponible en línea)"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Llamar %sRegistro%s procedimiento de la unidad seleccionada"

#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr ""

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Limpiar las dependencias ..."

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Borrar nombre de archivo predeterminado/preferido de la dependencia"

#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr ""

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "¿Compilar todo?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compilar paquete"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
#, object-pascal-format
msgid "Compiler Options for Package %s"
msgstr "Opciones del Compilador para el paquete %s"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Crear fpmake.pp"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Crear Makefile"

#: lazarusidestrconsts.lispckeditdefault
#, object-pascal-format
msgid "%s, default: %s"
msgstr "%s, predeterminado: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Propiedades de la dependencia"

#: lazarusidestrconsts.lispckediteditgeneraloptions
#, fuzzy
#| msgid "Edit General Options"
msgid "Edit general options"
msgstr "Editar Opciones Generales"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Propiedades de archivo"

#: lazarusidestrconsts.lispckeditfpmakepackage
msgid "(fpmake)"
msgstr "(fpmake)"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalar"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versión máxima no válida"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versión mínima no válida"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versión máxima:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versión mínima:"

#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Modificado: %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Mover dependencia abajo"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Mover dependencia arriba"

#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Paquete %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "El paquete \"%s\" ha cambiado.%s¿Guardar paquete?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "paquete %s no guardado"

#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Página: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Re-Añadir dependencia"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Re-Añadir archivo"

#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Sólo-Lectura: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Recompilar Todo Requerido"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Recompilar Limpio"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "¿Re-Compilar este y todos los paquetes requeridos?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrar complementos"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registrar unidad"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Eliminar dependencia"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "¿Eliminar dependencia?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "¿Eliminar la dependencia \"%s\"%s del paquete \"%s\"?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Archivos Eliminados"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Paquetes requeridos eliminados"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Eliminar archivo"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "¿Eliminar archivo?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "¿Eliminar el archivo \"%s\"%s del paquete \"%s\"?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Eliminar elemento seleccionado"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Paquetes Requeridos"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Guardar Paquete"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Almacenar nombre de archivo como predeterminado para esta dependencia"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Almacenar nombre de archivo como preferido para esta dependencia"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versión máxima \"%s\" no es una versión válida de paquete.%s(ejemplo correcto 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La versión mínima \"%s\" no es una versión válida de paquete.%s(ejemplo correcto 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Desinstalar"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Ver Fuente de Paquete"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Base, no puede ser desinstalado"

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Instalado"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalar en próximo inicio"

#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sEstado: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Desinstalar en el próximo inicio (a menos que se necesite por parte de algún paquete instalado)"

#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Desinstalar paquete %s"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Añadir opciones a los proyectos y paquetes dependientes"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Añadir rutas a los paquetes/proyectos dependientes"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Autor"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Reconstruir automáticamente según las necesidades"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Reconstruir automáticamente al reconstruir todo"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personalizado"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Descripción / Abstracto"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Tiempo de Diseño"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Tiempo de diseño y tiempo de ejecución"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integración del IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Incluir"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipo del paquete no válido"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Biblioteca"

#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licencia"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Enlazador"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Mayor"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilación manual (nunca automáticamente)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Menor"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objecto"

#: lazarusidestrconsts.lispckoptspackagefileoptions
msgid "Additional Package File Options"
msgstr ""

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opciones de Paquete"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Tipo de paquete"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Proporciona"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Publicar"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Tiempo Ejecución"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "El paquete \"%s\" tiene la bandera de auto instalar.%s Eso significa que se instalará en el IDE. Los paquetes de instalación%s deben ser paquetes de diseño."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Este paquete proporciona lo mismo que los paquetes siguientes:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Actualizar / Reconstruir"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Uso"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Paquete:"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Path de búsqueda para archivos fpdoc XML. Varios path deben estar separadas por punto y coma."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Mostrar las dependencias innecesarias"

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Cuando el formulario se guarda, el IDE puede almacenar todas las propiedades TTranslateString del paquete en el archivo po. Para ello es necesario habilitar I18N para este paquete, proporcione un directorio po de salida y deje esta opción sin marcar."

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Abortar"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progreso"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Colapsar directorio"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflicto encontrado"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Editar Unidad Virtual"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Expander directorio"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nombre de archivo:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Corregir MAY/min en Ficheros"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nombre de archivo de unidad no válido"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nombre de unidad no válido"

#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr "Archivos perdidos del paquete %s"

#: lazarusidestrconsts.lispendingon
msgid "Pending (On)"
msgstr "Pendiente (On)"

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Nuevo archivo no está en ruta de inclusión"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Ningún archivo perdido. Todos los archivos existen."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Eliminar archivos"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Revertir paquete"

#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Guardar paquete como ..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Mostrar jerarquía de directorios"

#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Mostrar archivos perdidos"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Ordenar Archivos Permanentemente"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Ordenar archivos alfabéticamente"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "El archivo \"%s\" no está actualmente en la ruta de inclusión del paquete.%s¿Añadir \"%s\" a la ruta de inclusión? "

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nombre de unidad:"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Usar todas las unidades dentro del directorio"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "No usar ninguna unidad dentro del directorio"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Limpieza de dependencias de paquetes"

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Limpiar selección"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Añadir ruta de fuentes compilados"

#: lazarusidestrconsts.lispkgdefsnamespaces
msgid "Namespaces"
msgstr "Namespaces"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Directorio de salida"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Marca de directorio fuente del Paquete"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Ruta de Unidad"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Eliminar dependencias"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "¿Desea realmente olvidar todos los cambios en el paquete %s y recargarlo desde el archivo?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nueva unidad no presente un ruta de unidades"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publicar Paquete"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "¿Revertir paquete?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "El archivo \"%s\"%sno está actualmente en la ruta de unidades del paquete.%s¿Añadir \"%s\" a la ruta de unidades?"

#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
#, fuzzy
msgid "More functions for the package"
msgstr "Más funciones para el paquete"

#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binario"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Incluir Archivo"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Archivo xml de problemas"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus desde texto"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Recurso de Lazarus"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Unidad Principal"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Texto"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unidad virtual"

#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
#, fuzzy
#| msgid "Package directory. Parameter is package ID"
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Directorio paquete. Parametro es ID paquete"

#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
#, fuzzy
#| msgid "Package include files search path. Parameter is package ID"
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Path busqueda inclusion de paquete. Parametro es ID paquete"

#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Nombre de Paquete. Parametro es package ID, ejm. \"Nombre\" o \"Nombre 1.0\""

#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Salida de directorio del Paquete (Package). Parametro es package ID, ejm. \"Nombre\" o \"Nombre 1.0\""

#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
#, fuzzy
#| msgid "Package source search path. Parameter is package ID"
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Path busqueda fuentes de paquete. Parametro es ID paquete"

#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
#, fuzzy
#| msgid "Package unit search path. Parameter is package ID"
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Path busqueda unidad de paquete. Parametro es ID paquete"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sAñadiendo nueva Dependencia para paquete %s: paquete %s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sAñadiendo nueva Dependencia para proyecto %s: paquete %s"

#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Agregar una unidad hacia la clausula uses del archivo principal del paquete. Deshabilitar solo para unidades que no deberían ser compilados en todos los casos."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Encontradas unidades ambiguas"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Paquetes instalados automáticamente"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sAmbos paquetes están conectados. Esto significa que cualquiera de los dos paquetes usa al otro, o ambos son usados por un tercer paquete."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dependencia rota"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Dependencia circular encontrada"

#: lazarusidestrconsts.lispkgmangcompilepackage
#, object-pascal-format
msgid "Compile package %s"
msgstr "Compilar paquete %s"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Falló el borrado"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "¿Borrar archivo de Paquete Viejo?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "¿Borrar archivo de paquete viejo \"%s\"?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Dependencia sin Propietario: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Error leyendo archivo"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Error Leyendo Paquete"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
#, object-pascal-format
msgid "Error: updating po files failed for package %s"
msgstr "Error: falló al actualizar archivos .po para el paquete %s"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Error escribiendo archivo"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Error Escribiendo Paquete"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "El archivo ya está en el paquete"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "El archivo está en el Proyecto"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "El nombre de archivo difiere del nombre del paquete"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "El nombre del archivo es usado por otro paquete"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "El nombre del archivo es usado por el proyecto"

#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "No se encontró el archivo \"%s\""

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Archivo no guardado"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "Instalar el paquete %s instalará automáticamente el paquete:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "Instalar el paquete %s instalará automáticamente los paquetes:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Nombre de compilador no válido"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Extensión de archivo no válida"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Extensión de archivo del paquete no válida"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nombre de archivo del paquete no válido"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nombre del paquete no válido"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nombre de Paquete no válido"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Cargar el paquete %s reemplazará el paquete %s%sdel archivo%s.%sEl paquete viejo ha sido modificado.%s¿Guardar el paquete viejo %s?"

#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Paquete: %s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflictos de paquete"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "El paquete no es de Tiempo de diseño"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Se requiere el Paquete"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "archivo fuente principal del paquete"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "El nombre de paquete ya existe"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Los paquetes deben de tener la extensión .lpk"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Porfavor compile el paquete primero."

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Por favor guarde el archivo antes de añadirlo al paquete"

#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Proyecto: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "¿Reconstruir Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "¿Renombrar archivo en minúsculas?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "¿Reemplazar archivo existente \"%s\"?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Reemplazar Archivo"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Uno o más paquetes necesarios no fueron encontrados. Ver el gráfico de paquete para más detalles."

#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format, fuzzy
#| msgid ""
#| "The package %s is already open in the IDE.\n"
#| "You cannot save a package with the same name.\n"
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
"El paquete %s está abierto en el IDE.\n"
"No puedes grabar un paquete con el mismo nombre.\n"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "¿Guardar paquete?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Guardar Paquete %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "¿Debería renombrarse el archivo \"%s\"%s en minúsculas?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Saltar este paquete"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Archivo de configuración de paquetes estáticos"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
#, object-pascal-format
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "El archivo de compilador para el paquete %s no es un ejecutable válido:%s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "El archivo \"%s\"%sya está en el paquete %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "El archivo \"%s\" no es un paquete de lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "El nombre de archivo \"%s\" no se corresponde con el nombre del paquete \"%s\" en el archivo.%s¿Cambiar el nombre del paquete a \"%s\"?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "El nombre de archivo \"%s\" es parte del proyecto actual.%sLos proyectos y los paquetes no deberían compartir archivos."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "El nombre de archivo \"%s\" está siendo usado por%s el paquete \"%s\"%s en el archivo \"%s\"."

#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
#, object-pascal-format
msgid "The file \"%s\" of package %s was not found."
msgstr "El archivo \"%s\" del paquete %s no se a encontrado."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Falló la carga del siguiente paquete:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Falló la carga de los siguientes paquetes:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sLas siguientes unidades serán añadidas a la sección uses de%s%s:%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
#, object-pascal-format
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Falló la compilación del paquete \"%s\".%s¿Eliminarlo de la lista de instalación?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "El nombre de archivo del paquete \"%s\" en \"%s\"%s no es un nombre de paquete de lazarus válido."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "El paquete %s es un paquete de sólo ejecución.%sLos paquetes de sólo ejecución no pueden ser instalados en el IDE."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format, fuzzy
#| msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "El paquete \"%s\" está compilado de forma automáticamente y su directorio de salida es \"%s\", que está en el path de búsqueda de unit predeterminado del compilador. El paquete utiliza otros paquetes que también utiliza la búsqueda de unit por defecto del compilador. Esto crea un bucle infinito. %sUsted puede solucionar este problema quitandolo del path de su fichero de configuración del compilador (por ejemplo fpc.cfg)%so al deshabilitar la actualización automática de este paquete o mediante la eliminación de las dependencias."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format, fuzzy
#| msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "El paquete \"%s\" está marcado para instalar, pero no se puede encontrar.%s¿Borrar la dependencia de la lista de paquetes de instalación?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format, fuzzy
#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "El paquete %s es requerido por %s, que está marcado para instalar.%sMira el gráfico de paquete."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "El nombre de paquete \"%s\" no es un nombre de paquete válido%sPor favor escoja otro nombre (e.j. paquete1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "El nombre de paquete \"%s\" de%s del archivo \"%s\" no es válido."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "El paquete \"%s\" fue marcado.%sActualmente lazarus solo soporta paquetes enlazados estáticamente. La desinstalación completa necesita reconstruir y reiniciar lazarus.%s¿Quiere reconstruir lazarus ahora?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "El paquete \"%s\" se marcó para instalar.%sActualmente lazarus solo soporta paquetes enlazados estáticamente. La instalación completa necesita reconstruir y reiniciar lazarus.%s¿Desea reconstruir ahora Lazarus?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "El proyecto requiere el paquete \"%s\".%sPero no se ha encontrado. Mire Proyecto -> Inspector de Proyecto."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Hay dos unidades con el mismo nombre:%s1. \"%s\" de %s%s2. \"%s\" de %s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "Hay una dependencia circular en los paquetes. Ver el gráfico de paquetes."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Hay una unidad FPC con el mismo nombre que el paquete:%s\"%s\""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Hay una unidad de FPC con el mismo nombre como:%s\"%s\" desde %s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Ya hay otro paquete con el nombre \"%s\".%sPaquete en conflicto: \"%s\"%sArchivo: \"%s\""

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Ya hay un paquete \"%s\" cargado %s del archivo \"%s\".%sMire Paquete -> Gráfico de paquete.%s Es imposible reemplazarlo."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Hay un paquete sin guardar en los paquetes requeridos. Mire el gráfico de paquete."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Hay una unidad con el mismo nombre que el paquete:%s1. \"%s\" de %s%s2. \"%s\""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Este es un paquete virtual. Todavía no tiene código. Por favor, guarde el paquete primero."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "No se ha podido crear el directorio"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
#, object-pascal-format
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "No se ha podido crear el directorio de salida \"%s\"%s para el paquete %s"

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
#, object-pascal-format
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "No se ha podido crear el directorio fuente de paquete \"%s\"%s para el paquete %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "No se ha podido crear el directorio objetivo para lazarus:\"%s\"%s.%s Este directorio se necesita paralos cambios realizados en el IDE de lazarus con sus propios paquetes."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\"."
msgstr "No se ha podido borrar el archivo \"%s\"."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "No se ha podido borrar el archivo"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
#, object-pascal-format
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "No se ha podido borrar el archivo de estado viejo \"%s\"%s para el paquete %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "No se pudo cargar el paquete"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
#, object-pascal-format
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "No se ha podido abrir el paquete \"%s\".%sEste paquete está marcado para instalación."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
#, object-pascal-format
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "No se ha podido leer el archivo de estado \"%s\"%s del paquete %s.%s Error: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "No se ha podido escribir el paquete \"%s\"%s al archivo \"%s\".%sError: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
#, object-pascal-format
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "No se ha podido escribir el archivo de estado \"%s\"%s del paquete %s.%sError: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "¿Desinstalar paquete?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "¿Desinstalar paquete %s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Paquete sin guardar"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Usar unidad"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Advertencia: El archivo \"%s\"%s pertenece al proyecto actual."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "mantener"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nuevo"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "quitar"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Seleccionar un paquete"

#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Instalado"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr "No se puede registrar los componentes sin una unidad"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
#, object-pascal-format
msgid "Component Class \"%s\" already defined"
msgstr "La clase \"%s\" del Componente ya está definida"

#: lazarusidestrconsts.lispkgsysfilename
#, object-pascal-format
msgid "%s%sFile Name: \"%s\""
msgstr "%s%sNombre de Archivo: \"%s\""

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Clase de componente no válida"

#: lazarusidestrconsts.lispkgsysinvalidunitname
#, object-pascal-format
msgid "Invalid Unitname: %s"
msgstr "Nombre de unidad no válido: %s"

#: lazarusidestrconsts.lispkgsyslpkfilename
#, object-pascal-format
msgid "%s%slpk file: \"%s\""
msgstr "%s%sarchivo lpk: \"%s\""

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Archivo de paquete no encontrado"

#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Error de registro del paquete"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Registrar procedimiento como nulo"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
#, fuzzy
#| msgid "RegisterUnit was called, but no package is registering."
msgid "RegisterUnit was called but no package is registering."
msgstr "Se llamó a RegisterUnit, pero no se está registrando un paquete."

#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
#, object-pascal-format
msgid "%s%sThe lpk file was not found."
msgstr "%s%sEl archivo lpk no se ha encontrado."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
#, object-pascal-format, fuzzy
#| msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "El paquete \"%s\" está instalado pero se encontró un archivo de paquete (.lpk) no válido.%sSe ha creado un paquete vacío."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Este es el paquete predeterminado. Usado únicamente para componentes sin paquete. Estos componentes están sin actualizar."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
#, fuzzy
#| msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Este paquete está instalado pero el archivo .lpk no se encuentra. Todos sus componentes están desactivados. Por favor, corrija esto."

#: lazarusidestrconsts.lispkgsysunitname
#, object-pascal-format
msgid "%s%sUnit Name: \"%s\""
msgstr "%s%sNombre de Unidad: \"%s\""

#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
#, object-pascal-format
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Unidad \"%s\" no se encontró en el archivo lpk.%sProvablemente este lpk no se utilizó para la construcción de este IDE. O el mal uso en el paquete del procedimiento RegisterUnit."

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Unidad \"%s\" ha sido removida del paquete (lpk)"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
#, fuzzy
#| msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "No se necesitan las siguientes dependencias, debido a la transitividad automática entre dependencias de paquetes."

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "El proyecto reemplaza el directorio de salida de los siguientes paquetes.%sver Proyecto / Opciones de proyecto (sección de opciones de compilador) / Adiciones y Reemplazos%s%s"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Este archivo no está en ningún paquete cargado."

#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr "Transitividad"

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "No se puede leer el archivo del paquete \"%s\".%sError: %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Reproducir"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Global"

#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "En línea"

#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "Paquetes en línea no pueden ser borrados"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Enlaces de paquete"

#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Mostrar enlaces globales en"

#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Mostrar enlaces en línea"

#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Mostrar enlaces de usuario en"

#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Algunos paquetes no puedes ser borrados"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Usuario"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
#, fuzzy
#| msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Por favor solucione el error mostrado en la ventana de mensajes, que normalmente está debajo del editor de código fuente."

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Por favor abra una unidad antes de ejecutar."

#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
msgid "Please select at least one build mode."
msgstr "Por favor, seleccione al menos un modo de contrucción"

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Por favor seleccione algo de código para extraer un nuevo procedure/method"

#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Todo>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Cambiar Fuente"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copiar nombre del método al portapapeles"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrar por cualquier coincidencia en el método"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtar por coincidencia en el comienzo del método"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Saltar a selección"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "Ninguno"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objetos"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Lista de Procedimientos."

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipo"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Seleccione el directorio de archivos .po"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "No guardar ninguna información de la sesión"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Puntero"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Guardar en el directorio de configuración del IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Guardar en el archivo .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Guardar en el archivo .lps en el directorio del proyecto"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Guardar información de la sesión en"

#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi es el fichero principal del proyecto, .lps es un fichero separado para datos de sesión únicamente."

#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Posición"

#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr "%s (posición fuera de la fuente)"

#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr "ppu en directorio incorrecto=%s."

#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "%s.ppu no encontrado. Verifica tu archivo fpc.cfg."

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Palabra anterior"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, fuzzy
#| msgid "primary config directory, where Lazarus stores its config files. Default is "
msgid "primary config directory where Lazarus stores its config files. Default is "
msgstr "directorio de configuración primario, donde Lazarus guarda sus archivos de configuración. Por defecto es "

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Ruta de configuración primaria"

#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr "anterior %s"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Prioridad"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privado"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Método privado"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format, fuzzy
#| msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Es probable que necesite instalar algunos paquetes antes de continuar.%sAdvertencia:%sEl proyecto utiliza los siguientes paquetes en tiempo de diseño, los cuales pueden ser necesarios para abrir el formulario en el diseñador. Si continua, podría obtener errores relativos a componentes desaparecidos y la carga del formulario probablemente producirá resultados no deseados.%sSe recomienda cancelar e instalar esos paquetes primero."

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedimiento"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedimiento con interface"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programa"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programa detectado"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Un programa de comando de linea de Free Pascal agregó algunos ajustes útiles."

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "El archivo de código del programa debe de tener una extensión de pascal del tipo .pas, .pp o .lpr"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Ya existe la dependencia"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Añadir archivos de editor"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versión Min-Max no válida"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versión no válida"

#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr ""

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versión máxima (opcional):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versión mínima (opcional)"

#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Nuevo requerimiento de FPMake"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nuevo Requerimiento"

#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr "En línea (%s)"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nombre de paquete:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paquete no encontrado"

#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Tipo de paquete:"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "La dependencia \"%s\" no se ha encontrado.%sPor favor, escoja un paquete existente."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La versión máxima \"%s\" no es válida.%sPor favor use el formato mayor.menor.release.construccion%s Por ejemplo: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La versión máxima es menor que la versión mínima."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La Versión Mínima \"%s\" no es válida.%sPor favor use el formato mayor.menor.release.construccion%s Por ejemplo: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "El proyecto ya tiene una dependencia para el paquete \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "El nombre de unidad \"%s\" ya existe en el proyecto%s con archivo: \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "EL nombre de unidad \"%s\" ya existe en la selección%s con archivo: \"%s\"."

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Ya existe el nombre de unidad"

#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Proyecto %s"

#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Proyecto: "

#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "proyecto"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Proyecto cambiado"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "El proyecto ha cambiado en el disco"

#: lazarusidestrconsts.lisprojectcount
#, object-pascal-format
msgid "%d projects"
msgstr "%d proyectos"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Directorio del Proyecto"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "El título de la barra de tareas muestra también la ruta del proyecto"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nombre de archivo del proyecto"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Ruta Include del proyecto"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Archivo de información del proyecto detectado"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "El proyecto es ejecutable"

#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Generar un ejecutable binario que se pueda ejecutar."

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Proyecto"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Propiedades de la macro del proyecto"

#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""

#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Opción de proyecto"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Directorio de salida del proyecto (ej. el directorio ppu)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Directorio salida de Proyecto"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Directorio donde el archivo principal del proyecto debe estar"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Sesión de proyecto"

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Session de proyecto cambiada"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Directorios de fuentes del proyecto"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s en dirección %1:x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr "El proyecto %s ha lanzado una excepción de la clase '%s'."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "El proyecto %s ha lanzado una excepción '%s' con el mensaje:%s%s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s En archivo '%1:s' en dirección %2:x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s En archivo '%1:s' en linea %2:d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s En archivo '%1:s' en linea %2:d:%0:s%3:s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Ruta fuente del proyecto"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "Unidad del proyecto"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Ruta de Unidad del proyecto"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Asistente de proyecto"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Confirmar borrado de dependencia"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Confirmar eliminación de archivo"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "¿Borrar dependencia para %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Inspector de Proyecto - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Paquetes requeridos eliminados"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "¿Eliminar el archivo %s del proyecto?"

#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr "¿Eliminar %s elementos del proyecto?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
#, object-pascal-format
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "No se puede leer el archivo de estado %s del proyecto %s.%sError: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
#, object-pascal-format
msgid "Unable to write state file for project %s%sError: %s"
msgstr "No es posible escribir el archivo de estado para el proyecto %s%sError: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Construir siempre (incluso si nada ha cambiado)"

#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Puede que se necesite si existe un error en el análisis de dependencias, normalmente no es necesario."

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Error"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "No se ha podido cambiar en el programa fuente la lista de crear automáticamente formularios.%sPor favor corrija los errores primero."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Marca del directorio fuente del proyecto"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Preguntar por valor"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Propiedades (reemplazar o eliminar)"

#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr "Propiedad %s"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protegido"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Método protegido"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Método público"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Método publicado"

#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr "Publicado hacia %s"

#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "Los archivos que pertenecen al proyecto / paquete se incluirán automáticamente."

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Directorio para publicar el proyecto"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Publicar Proyecto"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Guardar archivos .lrs en el directorio de salida"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "El recurso estará disponible para FPC."

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Una unidad de pascal debe tener la extension .pp o .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Editar unidad virtual"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Ya hay una unidad con este nombre.%sArchivo: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "El nombre de unidad no es un identificador Pascal válido"

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "El nombre de unidad se usa cuando el IDE extiende la cláusula uses."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "El nombre de la unidad y el nombre del archivo no coinciden.%sEjemplo: unit1.pas y Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Convertir Proyecto &Delphi"

#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Nuevo Proyecto"

#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "Abrir Proyect&o"

#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Abrir Proyecto &Reciente"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Ver Proyectos &Ejemplo"

#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Corrección rápida de error"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Corrección rápida"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Solución rápida: Eliminar unidad"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Buscar identificador"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Salir"

#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "Salir de Lazarus"

#: lazarusidestrconsts.lisrange
#, fuzzy
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "Rango"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Error de lectura"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "¿Eliminar realmente?"

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Tabs recientes"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Grabar"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Grabados"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Record/Estructura"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Rehacer"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registros"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Expresión Regular"

#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relativo"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Rutas relativas"

#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Quitar"

#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "¿Quitar?"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Eliminar todas las propiedades inválidas"

#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Eliminar todos los mensajes de tipo filtro"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Eliminar todas las Unidades"

#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Eliminar Opción de Compilador Ocultar Mensaje"

#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "¿Eliminar %s dependencias del paquete \"%s\"?"

#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr "Propiedad eliminada \"%s\"."

#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "¿Eliminar %s ficheros del paquete \"%s\"?"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Eliminar de la lista de instalación"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Eliminar del Proyecto"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Borrar de la ruta de búsqueda"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Quitar rutas incluidas?"

#: lazarusidestrconsts.lisremovelocalvariable
#, object-pascal-format
msgid "Remove local variable %s"
msgstr "Eliminar variable local %s"

#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr "Eliminar variable local \"%s\""

#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Eliminar Mensaje de tipo Filtro"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Eliminar archivos no existentes"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Eliminar las unidades seleccionadas"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Quitarlos"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Eliminar las rutas de \"Otras fuentes\""

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Quitar ruta de unidad"

#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr "Eliminar uses \"%s\""

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Renombrar"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Renombrar ..."

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "¿Renombrar archivo?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Fallo al renombrar archivo"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Mostrar lista de Identificadores renombrados"

#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Renombrar a %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Renombrar en minúsculas"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Reabrir proyecto"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Re-Abrir con otra codificación de página"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Cuenta a Repetir:"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Reemplazar"

#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Propiedad reemplazada\"%s\" con \"%s\"."

#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Tipo reemplazado \"%s\" con \"%s\"."

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Reemplazo"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Reemplazo de funciones"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Reemplazos"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Arreglar propiedades y tipos"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Reemplazar el indentificador del conjunto"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Falló la recolocación de la selección"

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Escanear de nuevo"

#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr "Resetear"

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Restablecer todos los filtros de archivos a los valores predeterminados?"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "¿Resetear Left, Top, Width, Height de los componentes seleccionados al valor de sus ancestros?"

#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "El nombre del recurso debe ser único"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Error al guardar recurso"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Tipo de recursos del proyecto"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Reiniciar"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Result:"

#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
#, fuzzy
#| msgid ""
#| "returns list of all values of case variable in front of variable\n"
#| "\n"
#| "Optional Parameters (comma separated):\n"
#| "WithoutExtraIndent    // the case list will be generated without extra indentation\n"
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent    // the case list will be generated without extra indentation"
msgstr "Devuelve una lista de todos los valores de una variable CASE frente a la variable"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Fallo al revertir"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Derecha"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Anclaje derecho"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Espaciado derecho. Este valor se añade al espaciado base y se usa para el espaciado derecho del control."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Este es el control hermano al cual el lado derecho está anclado. Déjelo vacío para que sea el padre."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Lados derechos"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Igualar espacio a la derecha"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Raiz"

#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr "Directorio raiz"

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Ejecutar"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "Los paquetes \"tiempo ejecución y diseño\"  no tienen limitaciones."

#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Ejecutar"

#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr "%s (ejecutando ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "archivo no ejecutable"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format
msgid "The host application \"%s\" is not executable."
msgstr "La aplicación huésped \"%s\" no es ejecutable."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Ejecutar"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Tiempo de ejecución solo, no puede ser instalado en el IDE"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "Los paquetes \"solo tiempo ejecución\" son solamente para proyectos. No pueden ser instalados en el IDE, ni siquiera indirectamente."

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
#, fuzzy
#| msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "Los paquetes \"tiempo ejecución\" pueden ser utilizados por proyectos. No pueden ser instalados en el IDE, añ menos requiere algún paquete de tiempo de diseño."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "fallo al ejecutar"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Métodos Abstractos - todavía no sobrecargados"

#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "Métodos abstractos de %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "El cursor no está en la declaración de una clase"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "El IDE está ocupado"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s es una clase abstracta, tiene %s métodos abstractos."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "No se han encontrado métodos abstractos"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Ignorar todo lo seleccionado"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Ignorar la primera selección"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "No seleccionar nada"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Hay %s métodos abstractos que sobrecargar.%sSeleccione los métodos para los cuales se crearán las sobrecargas:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "No quedan métodos abstractos que sobrecargar."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Este método no puede ser sobrecargado porque está definido en la clase actual"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "No se pueden mostrar los métodos abstractos de la clase actual porque"

#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Guardar"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Guardar Todo"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Salva Todos los Chequeados"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Guardar todos los archivos modificados"

#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Guardar todo/Mensajes originales a Fichero ..."

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Diálogo guardar y salir"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Guardar y reconstruir el IDE"

#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Guardar Como"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Guardar archivos cambiados?"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "¿Guardar cambios?"

#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "¿Guardar cambios al proyecto %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Guardar el archivo actual del editor"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Salvado con ajustes de IDE"

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Salvado con session de proyecto"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Guardar archivo como"

#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "¿Guardar archivo \"%s\"%santes de cerrar formulario \"%s\"?"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Guardar macro como"

#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Guardar mensajes"

#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr "Guardar proyecto %s (*%s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr "Guardar cambios en la sesion al proyecot %s?"

#: lazarusidestrconsts.lissavesessionfoldstate
msgid "Save fold info"
msgstr "Guardar información de pliege (fold)"

#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "El editor de código soporta plegado (ocultado temporal) de bloques de código."

#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Guardar salto historial"

#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "hacer Ctrl-Clic en un identificador en el editor de código hace que guarde en el historial de saltos."

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Guardar opciones"

#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Guardar los Mensajes Mostrados a Fichero ..."

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Guardar "

#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Guardar el archivo \"%s\" como \"%s\" pierde caracteres en la línea %s, columna %s."

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Factor de Escala:"

#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Escanear ficheros en el directorio padre"

#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Buscar por ficheros fuente en directorios hermanos (directorio padre y sus hijos)"

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Escaneando"

#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr "%s. Escaneando ..."

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Escaneando el directorio padre"

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Rutas de busqueda"

#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr "Buscar Unidad  \"%s\""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, fuzzy
#| msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgid "secondary config directory where Lazarus searches for config template files. Default is "
msgstr "directorio secundario de configuración, donde Lazarus busca las plantillas de archivos de configuración. Por defecto es "

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Ruta de configuración secundaria"

#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "&Segunda prueba"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Ver mensajes."

#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sVea Proyeco -> Inspector de Proyecto"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Seleccionar un elemento de ayuda:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Seleccionar un nodo"

#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Seleccionar otro widgetset LCD (macro LCLWidgetType)"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Seleccionar desde archivos Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Seleccionado"

#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Seleccionar adición:"

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Controles seleccionados e hijos"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(vecino inferior seleccionado)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Seleccionado mapeo de comandos"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "seleccionado para instalación"

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "seleccionado para desinstalación"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(vecino izquierdo seleccionado)"

#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Mensaje seleccionado en ventana de mensajes:"

#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(vecino derecho seleccionado)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(vecino superior seleccionado)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Seleccionar el archivo"

#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr ""

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Selecciona directorio de fuentes de FPC"

#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Seleccionar Frame"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "La selección excede la constante de cadena"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Herramienta de selección"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Selecciona directorio fuente Lazarus"

#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr "Selecciona ruta a %s"

#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "selecciona directorio destino"

#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Establecer todos los colores:"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Establecer predeterminado"

#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Seleccionar esto para traducir los mensajes del compilador a otro lenguaje (i.e. no Inglés). Por ejemplo: Aleman: $(FPCSrcDir)/compiler/msg/errordu.msg."

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Configurar sangría predeterminada)"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Corto:"

#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Corto, sin trayecto"

#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "¿Debería el componente \"%s\" ser auto creado cuando se inicie la aplicación?"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Mostrar"

#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr "Mostar métodos abstractos de \"%s\""

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Mostrar árbol de componentes"

#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Mostrar consola"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Mostrar descripciones de declaración"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Mostrar diferencias entre modos ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Ver unidades/paquetes vacios"

#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Mostrar mensajes de FPC \"líneas compiladas\""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Mostrar iconos (Glyphs) para:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Mostrar columna de marcas"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Mostrar ayuda"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Mostrar descripciones en el Inspector de Objetos"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Mostrar identificadores"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Mostrar ventana de información"

#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Mostrar Tipo de ID de Mensaje"

#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr ""

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Mostrar solo modificados"

#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
#, fuzzy
#| msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Mostrar solo un botón en la barra de tareas para el IDE completo, en lugar de uno por ventana. Algunos gestores de ventanas de Linux tales como Cinamon no soportan esto y siempre muestran un botón por ventana."

#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Mostrar salida"

#: lazarusidestrconsts.lisshowoverviewgutter
#, fuzzy
#| msgid "Show overview Gutter"
msgid "Show overview gutter"
msgstr "Mostrar columna de marcas general"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Mostrar paquetes"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Mostrar posicion de editor fuentes"

#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr ""

#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Mostrar identificadores usados recientemente en la parte superior"

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Mostrar rutas relativas"

#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Mostrar todos los controles en un árbol jerárquico"

#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Un recuadro al fondo muestra la descripción de la propiedad seleccionada."

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Mostrar diálogo de configuracion para los ajustes más importantes"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Mostrar caracteres especiales"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Mostrar barra de estado"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Mostrar unidades"

#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Mostrar unidades con secciones de inicialización/finalización"

#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Estas unidades pueden inicializar datos globales utilizados por el programa/aplicación. Remover con cuidado."

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Mostrar unidades no utilizadas ..."

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Mostrar descripciones de valores cuando este depurando"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Mostrar versión y salir"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Encoger al más pequeño"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Hermano"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Programa simple"

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "El mas sencillo programa Free Pascar en linea de comandos"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Sintaxis simple"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Saltar errores"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Omitir archivo"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Saltar archivo y continuar cargando"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Continuar cargando el último proyecto"

#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr "Saltar esas advertencias"

#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Más lento pero más exacto"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Más pequeño en lugar de más rápido"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Coincidencias"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Lo siento, este tipo no está todavía implementado"

#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr "Ordenar para el campo de acción"

#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Ordenando"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Ascendiendo"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensible a Mayúsculas"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Descendente"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Dominio"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorar espacios"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Líneas"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opciones"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Párrafos"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Vista previa"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Aceptar"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Ordenar Selección"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Palabras"

#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr "Ordenar lista de rangos Unicode alfabeticamente"

#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "Origen \"%s\"%sy directorios destino \"%s\"%sson lo mismo. Por favor, selecciona otro directorio"

#: lazarusidestrconsts.lissourceanddestinationarethesame
#, object-pascal-format
msgid "Source and Destination are the same:%s%s"
msgstr "Origen y destino son el mismo:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "Punto de Interrupción en Código Fuente ..."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "El directorio fuente \"%s\" no existe."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Gestor de ventana del editor de fuente"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Fuente modificado"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "El código fuente de la página \"%s\" ha cambiado.¿Guardar?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Las fuentes de páginas han cambiado. ¿Guardar página \"%s\"? (%d más)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Rutas fuente"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Igualar espacio"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "OS Fuente"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Buscando"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Buscar texto"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Comenzar Conversión"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Arrancar IDE"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Empezar con un proyecto nuevo"

#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "La barra de estado muestra el nombre de propiedad y clase donde se ha publicado."

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Detener"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "¿Parar esta sesión de depuración y reconstruir el proyecto?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "¿Parar Depurando?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "¿Parar sesión de depuración?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Detener en excepción"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "¿Parar la depuración?"

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Guarde delimitadores de ruta \\ y / como"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Archivo lpi extraño"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Error de flujo"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Cadena"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Estilo"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Subprocedimiento"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Subprocedimiento en el mismo nivel"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Éxito"

#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Se ha exportado satisfactoriamente a \"%s\"."

#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "Se han exportado satisfactoriamente los modos %d de construcción (BuildModes) a \"%s\"."

#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Se han exportado satisfactoriamente las opciones del compilador a \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Satisfactoriamente importado desde \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "Satisfactoriamente importados %d modos de construcción (BuildModes) desde \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Opciones de compilador importadas satisfactoriamente desde \"%s\"."

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Sugerir nombre predeterminado del nuevo archivo en minúsculas"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Ruta de inclusión sospechosa"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Ruta de unidad sospechosa"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revisión SVN: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nombre de variable no válido"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" no es un identificador válido."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "No hacer caso de variable de sistema"

#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Cambiar Configuraciones de Filtrado"

#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Cambiar a la solapa de Favoritos después de preguntar por nombre de componente."

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Modo de sintaxis"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu no se encuentra. Revise su fpc.cfg."

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Ordenar el orden de tabulación de todos los controles secundarios de \"%s\" por sus posiciones?"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Mover el control seleccionado hacia abajo en el orden de tabulación"

#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "Orden de tabulación de %s"

#: lazarusidestrconsts.listaborderrecursionhint
#, fuzzy
msgid "Calculate tab order recursively for child controls"
msgstr "Calcular recursivamente el orden de tabulación para controles secundarios"

#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "recursivamente"

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Calcular el orden de tabulación de los controles por parte de sus posiciones X- e Y-"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Mover el control seleccionado hacia arriba en el orden de tabulación"

#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "Tabs por %s"

#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Tomar una Instantanea"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Objetivo:"

#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", Objetivo: %s"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU objetivo"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nombre de archivo final: (-o, vacio = usar el directorio de salida de la unidad)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nombre del archivo final (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nombre del archivo objetivo del proyecto"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "NombreDeArchivo + Parametros objetivo"

#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "El destino es de solo lectura"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "OS objetivo:"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Celda Editable"

#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format, fuzzy
#| msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Inserta una celda editable. Las células se puede navegar con el tabulador.%0:sLa macro \"param\" toma una lista de argumentos separados por comas.%0:sEl primer argumento es el valor predeterminado.%0:sEl segundo argumento (opcional) puede ser utilizado para conectar la celda a otro celda (syncro edit)%0:s%0:s mientras param(\"foo\") hace param(foo);%0:sInserta dos celdas independientes, ambos con el texto por defecto \"foo\"%0:sLas comillas son opcionales%0:s%0:s si param(\"foo\") > 0 y param(\"foo\", sync = 1) < 99 entonces %0:sInserta dos celdas vinculadas, ya sea una edición, cambiará la otra también%0:sEl valor \"1\" se refiere a la posición del otro \"param()\", así que si hay más params:%0:s si param(\"bar\") y param(foo) > 0 y param(foo,sync=2) < 99 entonces%0:sLa segunda y tercera están vinculadas. (el tercero se refiere a \"2\") %0:s%0:s\"sync se puede acortar a \"s\":%0:s si param(\"foo\") > 0 y param(\"foo\",s=1) < 99 entonces%0:s%0:s si param(\"bar\") y param(\"foo\") > 0 y param(\"foo\",sync) < 99 entonces%0:sEl segundo y tercero están vinculados.%0:sNota: \"Sync no tiene una posición y no \"=\", así que se sincroniza a la celda anterior con el mismo defecto (en este caso \"foo\")"

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Fichero plantilla"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Directorio de prueba"

#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Comprobar URL"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr "El envoltorio de la aplicación fue creado para \"%s\""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "La clase \"%s\" es del tipo TControl y no puede ser pegada en un objeto que no es un control.%sNo se puede pegar."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
#, object-pascal-format
msgid "The Codetools found an error:%s%s"
msgstr "Codetools encontró un error:%s%s"

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "El archivo del complilador \"%s\" parece no ser correcto:%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format, fuzzy
#| msgid "The component %s can not be deleted, because it is not owned by %s."
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "El componente %s no pude ser eliminado por que %s no es su propietario"

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "El editor de componentes de la clase \"%s\" ha creado el error:\"%s\"%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "El editor de componentes de la clase \"%s\"%sinvocado con el verbo #%s \"%s\"%sha creado el error:\"%s\"%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "El componente %s hereda de %s.%sPara eliminar un componente heredado, abra el ancestro y borrelo ahí."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "El componente %s es heredado de %s.%sPara renombrar un componente heredado abre el padre y renombralo alli."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "El nombre del componente debe ser unico entre todos los componentes del formulario/módulo de datos. El nombre es cotejado sin diferenciar entre minúsculas o mayúsculas como un identificador pascal normal. "

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "La configuración se degradó/convirtio."

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "El %s contiene un directorio inexistente:%s%s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "El %s contiene un carácter * asterisco.%sLazarus usa este como un carácter normal y no lo desarrolla como máscara de archivo."

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "El FPC actual no tiene archivo de configuración. Ello hará que probablemente no se encuentren algunas unidades. Compruebe su instalación de fpc."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "El depurador \"%s\"%sno existe o no es ejecutable.%sMire Herramientas -> Opciones -> Opciones del depurador"

#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
#, object-pascal-format
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr "El ejecutable del depurador normalmente tiene el nombre \"%s\". Por favor dar la ruta completa del archivo."

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "El modo por defecto debe almacenarse en el proyecto, no en la sesión."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format
msgid "The destination directory%s\"%s\" does not exist."
msgstr "El directorio de destino\"%s\"%s no existe."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
#, object-pascal-format
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "El directorio de destino \"%s\" no existe.%sFavor de verificar el nombre del archivo objetivo del proyecto en Menu > Proyecto > Opciones de Proyecto."

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "El directorio \"%s\" no contiene ningún más archivos del proyecto . Quitar este directorio de la ruta de búsqueda del proyecto?"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "El directorio \"%s\" no contiene más unidades del proyecto. Quitar este directorio de la ruta de busqueda de unidad(unit) del proyecto?"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "El directorio \"%s\" no se necesitará más en la ruta de la unidad.%s¿Eliminarlo?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
#, object-pascal-format
msgid "The directory \"%s\" is not writable."
msgstr "El directorio \"%s\" no es escribible"

#: lazarusidestrconsts.listhedirectorywasnotfound
#, object-pascal-format
msgid "The directory %s was not found."
msgstr "El directorio %s no fue encontrado."

#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "El archivo \"%s\""

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
#, object-pascal-format
msgid "The file %s does not look like a lpi file."
msgstr "El archivo %s no parece un archivo lpi."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "El índice de archivos es necesario para funciones como la busqueda de declaraciones. Durante el escaneo puede editar las fuentes y compilar, pero funciones como la busqueda de declaraciones mostrarán errores de unidad-no-encontrada. Esto puede tardar un minuto."

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
#, object-pascal-format
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "El archivo \"%s\" es un enlace simbólico.%s¿Abrir \"%s\" en su lugar?"

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "El archivo \"%s\" no es un proyecto de lazarus.%s¿Creamos un nuevo proyecto para %s?"

#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr "La máscara de archivo \"%s\" no es válida."

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "La máscara de archivo \"%s\" no es una expresion regular válida."

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "El archivo \"%s\"%sparece ser un programa. ¿Cerrar el proyecto actual y crear un nuevo proyecto de Lazarus para este programa?%s\"No\" cargará el archivo como un fuente normal."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "El archivo %s parece ser el archivo de programa de un proyecto de Lazarus existente"

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
#, object-pascal-format
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr "El archivo \"%s\"%sfue hallado en uno de los directorios de fuentes del paquete %s y parece una Unidad compilada. Las Unidades compiladas deben estar en el directorio de Salida del paquete, de otro modo otros paquetes pueden tener problemas cuando usen éste paquete.%s¿Eliminar el archivo causante de la ambigüedad?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "No se encontró el archivo \"%s\".%s¿Quiere localizarlo usted mismo?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "No se ha encontrado el archivo \"%s\".%sIgnorar seguirá cargando el proyecto,%sAbortar parará la carga."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Los métodos siguientes usados por %s no están en el fuente%s%s%s%s%s¿Eliminar las referencias pendientes?"

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "El directorio de origen FPC \"%s\" no se ve correcto:%s%s"

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "El ejecutable del compilador Free Pascal normalmente tiene el nombre \"%s\". También puede utilizar el compilador objetivo específico, como \"%s\". Por favor indique la ruta completa del archivo."

#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "El IDE está contruyendo todavía."

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "El identificador es una Unidad. Favor de usar la función Archivo -> Guardar Como para renombrar una Unidad."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format, fuzzy
#| msgid "The key %sis already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "La tecla %s%sya ha sido asignada a %s.%s¿Eliminar la asignación anterior y asignar la tecla a la nueva función%s%s?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "El envoltorio de la aplicación %s%snecesario para la ejecución no existe o no es ejecutable.%s¿Ha creado uno?%sVea Proyecto -> Opciones del proyecto -> Configuraciones de la aplicación."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "La aplicación lanzada \"%s\"%sno existe o no es ejecutable.%sMire Ejecutar -> Parámetros de ejecución -> Local"

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "El directorio Lazarus contiene las fuentes del IDE y los archivos del paquete de LCL y muchos paquetes estándar. Por ejemplo, contiene el archivo \"ide%slazarus.lpi\". Los archivos de conversión se encuentran allí también."

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "El directorio de Lazarus \"%s\" no se ve bien:%s%s"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "El archivo LFM (formulario Lazarus) contiene propiedades no válidas. Esto significa por ejemplo que contiene algunas propiedades/clases, que no existen en el LCL actual. La solución normal es eliminar estas propiedades desde el lfm y arreglar el código pascal manualmente."

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "La macro \"%s\" no comienza con \"%s\"."

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "El ejecutable \"make\" normalmente tiene el nombre \"%s\". Es necesario para la construcción del IDE. Por favor dar la ruta completa del archivo."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "El archivo de inclusión nuevo no está todavia en la ruta de busqueda de archivos de inclusión.%s¿Añadir directorio %s?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "La nueva unidad no está todavía en la ruta de búsqueda de unidad.%s¿Añadir directorio %s?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "La configuración anterior se actualizará."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Otras fuentes\" contiene un directorio que ya está en \"Otros archivos de unidad\".%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "No se encuentra el directorio de salida \"%s\"."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "El directorio de salida de %s está listado en la ruta de archivos incluidos de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "El directori de salida de %s está listado en la ruta de archivos incluidos heredada de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "El directorio de salida de %s está listado en la ruta de búsqueda de Unidades heredada de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "El directorio de salida de %s esta listado en la ruta de busqueda de Unidades de %s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "El directorio de salida debería ser un directorio aparte y que no contenga archivos de código fuente."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "El propietario de la clase tiene este nombre"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "El propietario tiene este nombre"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "El paquete %s añade la ruta \"%s\" a las rutas de inclusión del IDE.%sEs probablemente una mala configuración del paquete."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "El paquete %s añade la ruta \"%s\" a las rutas de unidades del IDE.%sEs probablemente una mala configuración del paquete."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "El paquete ya contiene una Unidad con este nombre."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format, fuzzy
#| msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "El paquete %s no se puede instalar, ya que requiere el paquete \"%s\", que es un paquete sólo en tiempo de ejecución."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format, fuzzy
#| msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "El paquete %s no puede ser desinstalado, por que es necesario para el mismo IDE."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format, fuzzy
#| msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "El paquete %s no tiene ningún procedimiento \"Register\", lo que normalmente significa que no proporciona ningún complemento para el IDE. Instalarlo probablemente solo incrementará el tamaño del IDE e incluso podría hacerlo inestable.%sSugerencia: Si quiere usar un paquete en su projecto, use el elemento del menú \"Añadir a proyecto\"."

#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr "El paquete %s esta actualmente en la lista"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "El paquete %s no es un paquete en tiempo de diseño. Este no podra ser instalado en el IDE"

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "La ruta de \"make\" no es correcta: \"%s\""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "El programa \"make\" no se encuentra.%sEsta herramienta es necesaria para construir Lazarus."

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Las opciones de compilador del proyecto y las directivas en la fuente principal difieren. Para la nueva unidad el modo y el tipo de cadena del proyecto son usados:"

#: lazarusidestrconsts.listheprojectdoesnotusedwarf
#, object-pascal-format
msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf."
msgstr "El proyecto no escribe información de depuración en formato Dwarf. El \"%s\" soporta solo Dwarf."

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "El proyecto no usa las interfaces de unidad del LCL, pero es requerido por LCLBase.%sRecibirá errores extraños del enlazador si usa formularios del LCL sin interfaces."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "El proyecto no tiene un archivo fuente principal."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "¡El archivo de info del archivo \"%s\"%s es igual al archivo fuente principal del proyecto!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "El archivo de información del proyecto \"%s\"%sha cambiado en el disco duro."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "El proyecto debe guardarse antes de construirlo%sSi establece el Directorio de Prueba en las opciones del IDE,%spodría crear proyectos nuevos y construirlos a la vez.%s¿Guardar proyecto?"

#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "El proyecto utiliza recursos de FPC que requieren al menos FPC 2.4"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "El proyecto usa OS objetivo=%s y CPU=%s.%sEl system.ppu para este objetivo no se encontró en los directorios de los binarios de FPC. %sAsegúrese de que FPC esta instalado correctamente para este objetivo y que el archivo fpc.cfg contiene los directorios correctos."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "El proyecto escribe los símbolos de depuración a un fichero externo. El \"%s\" soporta sólamente símbolos dentro del ejecutable."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "El proyecto escribe los símbolos de depuración dentro del ejecutable en lugar de un archivo externo. El \"%s\" soporta solo símbolos en un archivo externo."

#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr "%sHay notas adicionales para este mensaje en%s"

#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "No hay llaves conflictivas."

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Hay otros archivos en el directorio con el mismo nombre,%s difieren sólo en may/min:%s%s%s¿Borrarlos?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Hay un archivo con el mismo nombre y extensión similar en disco%sArchivo: %s%sArchivo Ambiguo: %s%s¿Borrar archivo ambiguo?"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Ya existe un modo de construcción con este nombre."

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr "Ya existe una clase de componente con el nombre %s."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Ya existe un componente con este nombre"

#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr "Ya existe un fichero%s%s%sen %s"

#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Ya existe un fichero \"%s\" en %s%sAntiguo: %s%sNuevo: %s%s%s¿Continuar?"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "Ya hay un formulario con el nombre \"%s\""

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgctxt "lazarusidestrconsts.listhereisalreadyamacrowiththename"
msgid "There is already a macro with the name \"%s\"."
msgstr "Ya existe una macro con el nombre \"%s\"."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Ya existe una macro del IDE con el nombre \"%s\""

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr "Ya existe un paquete %s en la lista"

#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Ya existe una unidad \"%s\" en %s%sAntigua: %s%sNueva: %s%sTienes que asegurarte de que el trayecto de búsqueda de unidad contiene únicamente una de ellas.%s%s¿Continuar?"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Ya hay una unidad con el nombre \"%s\". Los identificadores Pascal deben ser únicos."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Hay una unidad con el nombre \"%s\" en el proyecto.%sPor favor escoja un nombre diferente"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "No hay fpc.exe en el directorio de %s. Por lo general, el ejecutable make se instala junto con el compilador FPC."

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Debe existir al menos un modo de construcción."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "La clase de recurso \"%s\" desciende de \"%s\". Problablemente esto es un error para TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Se produjo un error mientras se escribía el componente seleccionado %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Se produjo un error mientras se convertía el flujo binario del componente seleccionado: %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Se produjo un error mientras se copiaba el flujo del compontente al portapapeles:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "No se puede eliminar el componente raiz."

#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Estos archivos serán eliminados"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Estas configuraciones son guardadas con el proyecto."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Estas unidades no se han encontrado:"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Las fuentes de los paquetes de Free Pascal son necesarios para la navegación y el autocompletado de código. Por ejemplo, se tiene el archivo \"%s\"."

#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr "El directorio destino es un archivo:%s"

#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "El nombre de archivo destino es un directorio"

#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr "El destino %s no es escribible."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "El Directorio de prueba no se pudo encontrar:\"%s\"%s%s(ver opciones de IDE)"

#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr "La unidad(unit) \"%s\" ya existe."

#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr "La unidad pertenece al paquete %s."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "La unidad %s existe dos veces en la ruta de unidad de %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "La unidad tiene este nombre"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "En nombre de archivo de la Unidad \"%s\" no esta en minúsculas.%sEl compilador FreePascal no busca todas las coincidencias de mayúsculas/Minúsculas. Se recomienda usar minúsculas en el nombre de archivo.%s¿Renombrar archivo en minúsculas?"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "La unidad %s es parte de las fuentes de FPC, pero el archivo xml correspondiente de fpdoc no fue encontrado.%sYa sea por que usted todavía no ha añadido el directorio fpcdocs a la ruta de búsqueda o la unidad no está documentada todavía.%sLos archivos fpdoc para las fuentes de FPC se puede descargar de: %s%sPor favor agregar el directorio en las opciones del editor fpdoc.%sCon el fin de crear un nuevo archivo en el directorio debe tener permisos de escritura."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "La Unidad %s es usada por otros archivos.%s¿Desea actualizar las referencias automáticamente?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "La unidad también tiene el nombre \"%s\". Los identificadores Pascal deben ser únicos."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "La ruta de búsqueda de Unidades de \"%s\" contiene el directorio de fuentes \"%s\" del paquete %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "El directorio de trabajo \"%s\" no existe.%sPor favor, verifique el directorio de trabajo en el Menu > Ejecutar > Parámetros de Ejecución."

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr "Este componente ya contiene una clase con el nombre %s."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Esta función necesita un archivo .lfm abierto en el editor de código fuente."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "este mensaje de ayuda"

#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Este es un proyecto de prueba para un paquete en tiempo de diseño, la prueba se encuentra fuera del IDE."

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Esto parece un archivo Pascal.%sEs recomendable usar minúsculas para los nombres de archivos para evitar problemas varios en algunos sistemas de archivos y diferentes compiladores.%s¿Renombrar el nombre en minúsculas?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "El proyecto no tiene un archivo fuente principal."

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Este proyecto sólo tiene por defecto un modo de construcción."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Este conjunto de opciones para construir Lazarus no es compatible con esta instalación.%sEl directorio \"%s\" no tiene permisos de escritura.%sVisite el sitio web de Lazarus para conocer otras maneras de instalar Lazarus."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Esta sentencia no puede ser extraida.%sPor favor, seleccione algo de código para extraer un nuevo procedimiento/método."

#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Esto permitirá cambiar todos los modos de construcción una vez. No implementado aún."

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Esto creará una dependencia circular."

#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Esto pondrá un montón de texto (%s) en el portapapeles.%s¿Proceder?"

#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Hilos (Threads)"

#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Actual"

#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Función"

#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "Ir a"

#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Línea"

#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Hilos(Threads) no evaluados"

#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Fuente"

#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Estado"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Título"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "El título en la barra de tareas muestra por ejemplo: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Título (dejar vacio en forma predeterminada)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Función: añadir delimitador de ruta"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr "Función: remover delimitador de ruta final"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Función: extraer extensión de archivo"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Función: extraer nombre y extensión del archivo"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Función: extraer sólo nombre de archivo"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Función: extraer ruta del archivo"

#: lazarusidestrconsts.listmunknownmacro
#, object-pascal-format
msgid "(unknown macro: %s)"
msgstr "(macro desconocida: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Ruta:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Intercambiar mostrar ruta completa o relativa para nombres de archivo"

#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Configuración de barra de herramienta"

#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr "Barra de Herramienta"

#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr "Botones de barras de herramienta resaltados"

#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr "Aumentar la barra de herramientas"

#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr "la utilidad \"%s\" no tiene ejecutable"

#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Cabecera de utilidad: Fallida"

#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Cabecera de utilidad: Funcionando"

#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Cabecera de utilidad: Desplazada hacia arriba"

#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Cabecera de utilidad: Éxito"

#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "utilidad detenida con código de salida %s. Utiliza el menú contextual para obtener más información."

#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr ""

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Arriba"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Anclaje superior"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Frontera superior. Este valor se añadirá a la frontera superior y se usará para el espacio sobre el control."

#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Mostrar sugerencia de Clase/Procedimiento"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Topes"

#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide does not matter)."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Este es el control hermano al cual el lado superior está anclado. Déjelo vacío para que sea el padre."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Igualar espacio superior"

#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr "Total de páginas: %s"

#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Traducir los Mensajes en Inglés"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "El árbol necesita actualizarse"

#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Dos ficheros movidos tendrán el mismo nombre:%s%s%s%s%sen %s"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Tipos (no se eliminan si no hay reemplazo)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Directorios adicionales:"

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Todas las unidades de paquete"

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Todas las unidades del editor de fuentes"

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Todas las unidades"

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Por defecto solamente se buscan las unidades de proyecto y del editor de fuente. Añade aquí el listado de directorios separados por punto y coma para buscarlas también."

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Contraer todos los nodos"

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Expandir todos los nodos"

#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "Fichero: %s"

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtro)"

#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr "Implementación Utiliza: %s"

#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr "implementacion utiliza: %s"

#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr "Interfaces Usa: %s"

#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr "interface usa: %s"

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Proyectos y paquetes"

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Escaneando ..."

#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Escaneando: %s units ..."

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Búsqueda)"

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Encontrar siguiente ocurrencia de ésta frase"

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Encontrar siguiente unidad con ésta frase"

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Encontrar ocurrencia previa de ésta frase"

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Encontrar unidad previa con ésta frase"

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Unidades seleccionadas"

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Mostrar nodos para directorios"

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Mostrar nodos para proyectos y paquetes"

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unidades"

#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Unidades: %s"

#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr "Utilizado por Implementaciones: %s"

#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr "utilizados por implementaciones: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr "Utilizados por Interfaces: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr "utilizados por interfaces: %s"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "No volver a mostrar este mensaje."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Error en expresión regular"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Fuente sin UTF-8"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Ir a línea:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "No encontrado"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "¿Reemplazar esta coincidencia de \"%s\"%s con \"%s\"?"

#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Buscando: %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "¿Continuar busqueda desde el principio?"

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "¿Continuar busqueda desde el final?"

#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "¡Cadena de búsqueda '%s' no encontrada!"

#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "La fuente actual del editor no soporta UTF-8, pero su sistema parece que lo usa.%sEsto significa que los caracteres no ASCII probablemente se muestren de manera incorrecta.%sPuede seleccionar otra fuente en las opciones del editor."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Limpiar cache de includes"

#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s bytes"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Incluido por:"

#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "En Proyecto:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Líneas:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nombre:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "no"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Tamaño:"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipo:"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "si"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Mostrar Valores de CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "No se puede convertir la corriente binaria a texto"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "No se puede copiar los componentes al portapapeles"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "No se ha podido añadir un comentario de cabecera de recurso al archivo recurso \"%s\"%s%sProbablemente sea un error de sintaxis."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "No se ha podido añadir el recurso T%s:FORMDATA al archivo recurso \"%s\"%s%sProbablemente sea un error de sintaxis."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "No se puede añadir la dependencia %s, porque el paquete %s ya tiene una dependencia %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "No se puede añadir la dependencia %s, ya que esto crearía una dependencia circular. Dependencia %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "No se ha podido añadir %s al proyecto, porque en el Proyecto ya hay una unidad con el mismo nombre."

#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "¡No se ha podido hacer copia de seguridad del archivo \"%s\" a \"%s\"!"

#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNo se ha podido cambiar clase de %s a %s"

#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr "No se puede cambiar la escala del proyecto en la fuente.%s%s"

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr "No se puede cambiar el título del proyecto en la fuente.%s%s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "No se ha podido limpiar el directorio destino"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "No se ha podido limpiar \"%s\".%s Por favor verifique los permisos."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "No se puede convertir el texto del componente al formato binario:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "No se ha podido convertir el archivo \"%s\"%s Error: %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "No se ha podido convertir los datos en forma de texto del archivo \"%s\"%s%s en un flujo binario (%s)"

#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr "No se ha podido convertir hacia la codificación \"%s\""

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "No se puede copiar el archivo"

#: lazarusidestrconsts.lisunabletocopyfileto
#, object-pascal-format
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "No se ha podido copiar el archivo \"%s\"%s a \"%s\""

#: lazarusidestrconsts.lisunabletocreatedirectory
#, object-pascal-format
msgid "Unable to create directory \"%s\"."
msgstr "No se ha podido crear el directorio \"%s\""

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "No se ha podido crear el archivo"

#: lazarusidestrconsts.lisunabletocreatefile2
#, object-pascal-format
msgid "Unable to create file \"%s\""
msgstr "No se ha podido crear el archivo \"%s\""

#: lazarusidestrconsts.lisunabletocreatefile3
#, object-pascal-format
msgid "Unable to create file%s\"%s\""
msgstr "No se puede crear el archivoe%s\"%s\""

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
#, object-pascal-format
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "No se puede crear el enlace \"%s\" con destino \"%s\""

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "No se puede crear archivo nuevo, porque ya existe un directorio con este nombre."

#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "No se puede crear nuevo método."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "No se ha podido crear el buffer temporal lfm."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "No se puede borrar"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "No se ha podido borrar el archivo ambiguo \"%s\""

#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr "Incapaz de ejecutar: %s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "No se encontró una sección ResourceString en ésta o en cualquier de las Unidades usadas."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format
msgid "Unable to find a valid classname in \"%s\""
msgstr "No se podido encontrar una clase válida en \"%s\""

#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "No se ha podido encontrar el archivo \"%s\"."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "No se halló el archivo \"%s\".%sSi pertenece a su proyecto, verifique la ruta busqueda en%sProyecto -> Opciones del Compilador -> Rutas-> Otros Archivos de Unidad. Si este archivo pertenece a un paquete, verifique las opciones del compilador del propio paquete. Si este archivo pertenece a Lazarus, asegúrese de efectuar una compilación limpia. Si el archivo pertenece a FPC entonces verifique el archivo fpc.cfg. Si no esta seguro, pruebe con, Proyecto -> Opciones del Compilador ... -> Probar"

#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "No se ha podido encontrar %s en la corriente LFM."

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "No se puede encontrar método."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "No fue posible encontrar la Unidad pascal (.pas,.pp) para el archivo .lfm \"%s\"%s"

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "No se puede encontrar la clase del componente \"%s\".%sEsta no está registrada a través de RegisterClass y no se encontró lfm.%sEsta es necesaria para la unidad:%s%s"

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "No se han podido recoger los cambios en el editor."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "No se haa podido obtener el fuente para el diseñador."

#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr "no se puede cargar el archivo %s: %s"

#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr "No fué posible cargar el paquete \"%s\""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "No se ha podido cargar la clase del componente \"%s\" porque depende de sí misma."

#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr "No se ha podido abrir \"%s\""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "No fué posible abrir el componente ancestro"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "No se ha podido abrir el diseñador.%sLa clase %s no desciende de una clase diseñable como TForm o TDataModule."

#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "No se puede leer %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "No se ha podido leer el archivo"

#: lazarusidestrconsts.lisunabletoreadfile2
#, object-pascal-format
msgid "Unable to read file \"%s\"."
msgstr "¡No se ha podido leer el archivo \"%s\"!"

#: lazarusidestrconsts.lisunabletoreadfileerror
#, object-pascal-format
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "No se ha podido leer el archivo \"%s\"%s Error: %s"

#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "No se puede leer lpi"

#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "Incapaz de leer el estado de salida del proceso"

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "No se puede leer el archivo de información del proyecto\"%s\"%s."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "¡No se ha podido eliminar el archivo de copia de seguridad antiguo \"%s\"!"

#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr "No se ha podido remover el proyecto escalado desde la fuente.%s%s"

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr "No se puede eliminar el título del proyecto de la fuente.%s%s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "No se ha podido renombrar el archivo ambiguo \"%s\"%sa \"%s\""

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "No se puede renombrar el archivo"

#: lazarusidestrconsts.lisunabletorenamefileto
#, object-pascal-format
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "¡No se ha podido renombrar el archivo \"%s\" a \"%s\"!"

#: lazarusidestrconsts.lisunabletorenamefileto2
#, object-pascal-format
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "No se puede renombrar el archivo \"%s\"%sa \"%s\"."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "No se ha podido renombrar el formulario en la fuente."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "No se ha podido renombrar método. Por favor corrija el error mostrado en la ventana de mensaje."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "No se ha podido renombrar la variable en la fuente."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "No es posible ejecutar"

#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr "No se ha podido ejecutar \"%s\""

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "No se puede establecer el control AnchorSide"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "No se puede mostrar método."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "No se han podido establecer flujos de los componentes seleccionados"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "No se han podido establecer flujos de los componentes seleccionados."

#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "No se ha podido establecer flujo%s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "No se ha podido transformar un flujo de componente binario de %s:T%s en texto."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "No se ha podido actualizar la declaración CreateForm en la fuente del proyecto"

#: lazarusidestrconsts.lisunabletowrite2
#, object-pascal-format
msgid "Unable to write \"%s\""
msgstr "No es posible escribir \"%s\""

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "No se ha podido escribir el archivo"

#: lazarusidestrconsts.lisunabletowritefile2
#, object-pascal-format
msgid "Unable to write file \"%s\"."
msgstr "No se ha podido escribir el fichero \"%s\"."

#: lazarusidestrconsts.lisunabletowritefileerror
#, object-pascal-format
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "No se ha podido escribir el archivo \"%s\"%s Error: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
#, object-pascal-format
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "No se puede escribir el archivo de información del proyecto\"%s\"%s.%sError: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
#, object-pascal-format
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "No se puede escribir el archivo de sesión del proyecto%s\"%s\".%sError: %s"

#: lazarusidestrconsts.lisunabletowritetofile2
#, object-pascal-format
msgid "Unable to write to file \"%s\"."
msgstr "No se puede escribir en el archivo \"%s\"."

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
#, object-pascal-format
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "No es posible escribir el stream xml en %s%sError: %s"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Deschequear Todo"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Deshacer"

#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "Desinstalar %s"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Desinstalación imposible"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Desinstalar selección"

#: lazarusidestrconsts.lisunit
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Unidad"

#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr "La Unidad \"%s\" ha cambiado. ¿Guardar?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Existe identificador de unidad"

#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s La unidad %s está en el paquete %s"

#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr ""

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "El Nombre de unidad ya está en el proyecto"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "El nombre de la unidad empieza con ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "El nombre de la unidad contiene ..."

#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr "Unidad %s no encontrada"

#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr "Unidad %s no encontrada en la nueva posición \"%s\""

#: lazarusidestrconsts.lisunitnotfoundinproject
#, object-pascal-format
msgid "A unit not found in project %s"
msgstr "Una unidad no se encuentra en proyecto %s"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Directorio de salida de la unidad"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "ruta de unidad"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Rutas de unidad"

#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr "la unidad  %s requiere el paquete %s"

#: lazarusidestrconsts.lisunitsnotfoundinproject
#, object-pascal-format
msgid "Units not found in project %s"
msgstr "Las unidades no se encuentran en el proyecto %s"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Sin firmar"

#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "Unidades no utilizadas de %s"

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Inusual nombre de archivo del compilador. Por lo general, comienza con la fpc, ppc o ppcross."

#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "Inusual nombre de archivo pas2js. Por lo general, comienza con pas2js."

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Arriba"

#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr ""

#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr ""

#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr ""

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Actualizar información"

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Actualizar otras firmas de procedimiento cuando únicamente cambie la letra mayúsculas/minúsculas"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "¿Actualizar referencias?"

#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
#, object-pascal-format
msgid "Updating PO files failed for package %s"
msgstr "Actualización de ficheros PO fallido para paquete %s"

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Actualiza"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Actualiza la configuración"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "Cadena en mayúsculas"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
#, fuzzy
#| msgid "Uppercase string given as parameter"
msgid "Uppercase string given as parameter."
msgstr "Cadena dada como parámetro en mayúsculas"

#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr "URL en wiki (la dirección base url es %s)"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Mensaje de uso (opción -h)"

#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Usar"

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Usar Ansistrings"

#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Utiliza CheckBox para valores Booleanos"

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Utilizar comentarios en opciones personalizadas"

#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr "utilizado por %s"

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Usar paquetes en tiempo de diseño"

#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "utilizado para formularios auto-creados"

#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Usar filtro para incluir archivos adicionales"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Usar identificador"

#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "Usar identificador %s en %s para %s"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Lanzador de aplicaciones"

#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "Usar paquete %s en paquete %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Usar paquete en paquete"

#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "Usar paquete %s en proyecto"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Usar paquete en proyecto"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Añadir a la lista \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Marcado de texto definidos por el usuario"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Quitar de la lista \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr "Cambiar en la lista \"%s\""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Directorio (home) del usuario"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Añadir unidad a la sección uses"

#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "Usar unidad %s en unidad %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 con BOM"

#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valor:"

#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Valor%s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Valor:"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valores"

#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Los valores que han cambiado de los predeterminados se han almacenado en el fichero .lfm y se muestran de forma diferente en el inspector de objetos"

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variable"

#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Explicativo"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Verificar llamadas de método"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versión"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Desajuste versión"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertical"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copiar información de la versión al portapapeles"

#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "muy explicativo"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Propiedades del Punto de Interrupción ..."

#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Ver Fuente"

#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Cambiar a vista ensamblador"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Ver Fuente (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Advertencia: "

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
#, object-pascal-format
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Advertencia: encontrado archivo ambiguo : \"%s\". El archivo fuente es: \"%s\""

#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ", Advertencias: %s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sAdvertencia: Esta es la unidad principal. La nueva unidad principal será %s.pas."

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Observar"

#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "Observar:"

#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Observar acción"

#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Leer"

#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Leer/Escribir"

#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Escribir"

#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "&Datos/Observacion Punto de Ruptura ..."

#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "&Datos/Observacion punto de ruptura ..."

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Propiedades del punto de observación"

#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Ver ámbito de aplicación"

#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Global"

#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Declaración"

#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Crear &Datos/Observacion punto de ruptura ..."

#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr "Bienvenido a IDE Lazarus %s"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Bienvenido a IDE Lazarus %s%sYa existe una configuración de la versión %s en%s%s"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Qué necesita la construcción"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Cuando una Unidad es renombrada, actualizar referencias ..."

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Cuando esta activado las opciones actuales son guardadas en una plantilla, la cual es usada cuando se crean nuevos proyectos"

#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Cuando sólo hay un elemento de terminación posible, úselo inmediatamente, sin mostrar la caja de terminación"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Cuando se mueva el cursor en el editor de código fuente, mostrar el nodo actual en el explorador de código"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Ventana de menú muestra el nombre del formulario diseñado en lugar de su título"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Útil especialmente si el título ha dejado vacío."

#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "La ventana permanece encima de otras"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", con includes "

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Sin un buen compilador la navegación de código y la compilación será decepcionante."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Sin un adecuado depurador, la depuración será decepcionante."

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Sin un adecuado directorio de Lazarus obtendrá una gran cantidad de advertencias."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Sin un adecuado ejecutable \"make\" la compilación del IDE no es posible."

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Sin el correcto código fuente de FPC la navegacion de código y autocompletado será muy limitado."

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Con los paquetes requeridos"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "&Borrar todo"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "D&esactivar todo"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "Ac&tivar todo"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expresión"

#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr "Panel inspección"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Propiedades"

#: lazarusidestrconsts.liswlwatchlist
msgctxt "lazarusidestrconsts.liswlwatchlist"
msgid "Watches"
msgstr "Lista de puntos de observación"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Palabra en el cursor en el editor actual"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Directorio de trabajo para construcción"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Directorio de trabajo para ejecución"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Error de escritura"

#: lazarusidestrconsts.liswriteerrorfile
#, object-pascal-format
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Error de escritura: %s%sArchivo: %s%s%s"

#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "Fallo en la escritura del archivo de información del paquete."

#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "Fallo en la escritura del archivo de información del proyecto."

#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr "version incorrecta en %s: %s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Error XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
#, object-pascal-format
msgid "XML parser error in file %s%sError: %s"
msgstr "Error de análisis en archivo XML %s%sError: %s"

#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr "Sí"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Puede desactivar esta para las formularios(forms) individuales a través del editor de paquetes"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Puede desactivar esto para formularios individuales a través de la ventana emergente en el inspector de proyectos"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "Puedes descargar FPC y su código fuente desde http://sourceforge.net/projects/lazarus/?source=directory"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgctxt "lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling"
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "No puede construir lazarus mientras está depurando o compilando."

#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "No puedes cambiar el modo de construcción mientras está compilando."

#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Puede seleccionar elementos simplemente pulsando letras subrayadas"

#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Todo>"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor de Código Fuente"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Eliminar seleccionado"

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "no válido"

#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr "archivo lpk (%s) inválido"

#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr "archivo lpk (%s) válido"

#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr "No se puede eliminar el archivo \"%s\""

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "válido"

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Reexaminar archivos de lpl"

#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr ""

#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr ""

#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr ""

#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptlevels
#, fuzzy
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Niveles"

#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr ""

#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr ""

#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr ""

#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr ""

#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr ""

#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr ""

#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr ""

#: lazarusidestrconsts.lvlgraphsplitnone
#, fuzzy
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Nada"

#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr ""

#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr ""

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Añadir la Unidad del paquete a la sección Uses"

#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binario"

#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Decimal"

#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Mostrar tipos de Registros seleccionados"

#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr "Formato"

#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Hex"

#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Octal"

#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Raw"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Añadir Inverso"

#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Añadir nuevo término"

#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr "Adjuntar(Attach) a"

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Atributos"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Incrementar automáticamente el número de construcción"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Incrementado cada vez que el proyecto se compila."

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "Construcción:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Conjunto de caracteres:"

#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr ""

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Cerrar página actual"

#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr ""

#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr ""

#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr ""

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Defines condicionales"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Crear un nuevo define"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Activar internacionalización"

#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr "Entrar PID"

#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Filtrar las líneas de la lista con una cadena"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Hallado, pero no listado aquí: "

#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Excluído"

#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "Forzar actualización de los archivos PO en la siguiente construcción"

#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Identificadores:"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "opciones de i18n"

#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Originales:"

#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "La información de versión se almacena si el formato del ejecutable lo soporta."

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Incluir Información de la Versión en el ejecutable"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Árabe"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr "Automático (o inglés)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalán"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chino"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Checo"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandés"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Inglés"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finlandés"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francés"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Alemán"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebreo"

#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr "Húngaro"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesio"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italiano"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonés"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lituano"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Opciones del lenguaje"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polaco"

#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Portugués"

#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Portugués Brasileño"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Ruso"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Selección de lenguaje:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Eslovaco"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Español"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turco"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ucraniano"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Versión &Mayor:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Versión Me&nor:"

#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria"
msgstr ""

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Más información"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Directorio de salida del archivo PO:"

#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search"
msgstr ""

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Recurso"

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "¿Borrar todos los recursos?"

#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr "Nombre de Fichero"

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tipo"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revisión:"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Seleccionar un elemento heredado"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numeración de versión"

#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr ""

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Comandos del menú de ayuda"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Comandos de comando"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Comandos de CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Comandos para selección de texto en modo columna"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Comandos de movimiento del cursor"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Comandos de edición de texto"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Comandos del menú archivo"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Comandos para plegado de código"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macros"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Comandos de marcas de texto"

#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Comandos de circunflejos múltiple"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Comandos para el menu del Paquete"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Comandos de menú de Proyecto"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Ejecutar comandos de menú"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Comandos de búsqueda y reemplazo de texto"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Comando de selección de texto"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Comandos de bloc de notas fuente"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Edición Sincrónizada"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Edición Sincronizada (no en celda)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Edición Sincronizada (Durante la selección)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Edición de Plantilla"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Edición de Plantilla (no en celda)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Comandos de menú de herramientas"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Comandos del menú Ver"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Comando:"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflicto "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "abortar construcción"

#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Métodos Abstractos ..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "añadir dirección de punto de ruptura"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "añadir fuente de punto de ruptura"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "añadir dato/punto de observación"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Añadir punto de salto"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "añadir punto de observación"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Adjuntar (attach) al Programa"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Completar plantilla de código"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copiar Bloque"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Eliminar Bloque"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Ir al begin del bloque"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Ir al final del bloque"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Esconder Bloque"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Sangrar bloque"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Mover Bloque"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Establecer inicio de bloque"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Establecer final de bloque"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Mostra Bloque"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Intercabiar Bloque"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Desangrar Bloque"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "construir programa/proyecto"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "construir archivo"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Construir lazarus"

#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "contruir algunos modos"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Carácter"

#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "cimpiar y construir"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Borrar texto entero"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Borrar todos los marcadores"

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Borrar marcadores de archivo actual"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Selección de Columna Abajo"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Selección de Columna a final absoluto"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Selección de Columna a comienzo absoluto"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Selección de Columna izquierda"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Selección de Columna Fin de Línea"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Selección de Columna Inicio de Línea"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Columna Seleccionar hasta principio de la linea de texto"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Selección de Columna inferior de página"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Selección de Columna página abajo"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Selección de Columna página arriba"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Selección de Columna página arriba"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Selección de Columna derecha"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Selección de Columna arriba"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Selección de Columna Palabra Izquierda"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Selección de Columna Palabra Derecha"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Modo de selección de columna"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "compilar programa/proyecto"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "configurar archivo de construcción"

#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Copiar"

#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy (Add to Clipboard)"
msgstr ""

#: lazarusidestrconsts.srkmeccopyaddcurrentline
msgid "Copy current line (Add to Clipboard)"
msgstr ""

#: lazarusidestrconsts.srkmeccopycurrentline
msgid "Copy current line"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copiar editor a una nueva ventana"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copiar editor a la ventana libre siguiente"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copiar editor a la ventana libre anterior"

#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Cortar"

#: lazarusidestrconsts.srkmeccutadd
msgid "Cut (Add to Clipboard)"
msgstr ""

#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line (Add to Clipboard)"
msgstr ""

#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line"
msgstr ""

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Borrar al principio de la línea"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Borrar caracter en cursor"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Borrar al final de la línea"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Borrar último Caracter"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Borrar al principio de la palabra"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Borrar línea actual"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Borrar al final de la palabra"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Separar(Detach) del programa"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Mover cursor abajo"

#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr ""

#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr ""

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Mover cursor al fin absoluto"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Mover cursor al principio absoluto"

#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Métodos Vacíos ..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Opciones del IDE"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "evaluar/modificar"

#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Extraer procedimiento"

#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Herramienta externa %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Configuración de las herramientas externas"

#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Buscar texto"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Buscar otro fin de bloque"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Buscar inicio de bloque"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Buscar declaración"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Buscar referencias del identificador"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Buscar en archivos"

#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Buscar siguiente"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Buscar próxima coincidencia de palabra"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Encontrar recargadas"

#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Encontrar sobrecargas ..."

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Buscar previo"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Buscar Anterior Concidencia de palabra"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Buscar Definición de Procedimiento"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Buscar Método de Procedimiento"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Plegar código en cursor"

#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr "Plegar al nivel %d"

#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format
msgid "Go to editor %d"
msgstr "Ir a editor %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Ir a directiva de inclusión del archivo include actual"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Ir a Línea Número"

#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format
msgid "Go to bookmark %d"
msgstr "Ir a marcador %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ir a XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Buscar $IFDEF Fuera de Lugar"

#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Mover cursor parte de palabra a la izquierda (ej. CamelCase)"

#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Mover cursor parte de palabra a la derecha (ej. CamelCase)"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Insertar Entrada de Registro de Cambios"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Insertar desde mapa de caracteres"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Insertar palabra clave CVS de Autor"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Insertar palabra clave CVS de Fecha"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Insertar palabra clave  CVS de cabecera"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Insertar palabra clave CVS de ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Insertar palabra clave CVS de registro"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Insertar palabra clave CVS de nombre"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Insertar palabra clave CVS de Revisión"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Insertar palabra clave CVS de código"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Insertar fecha y hora actual"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Insertar Nombre de Archivo Completo"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Insertar aviso GPL"

#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Insertar aviso GPL (traducido)"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Insertar un GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Insertar aviso LGPL"

#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Insertar aviso LGPL (traducido)"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Saltar línea, dejar el cursor"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Insertar advertencia MIT"

#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Insertar aviso MIT (traducido)"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Insertar Modo"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Insertar aviso LGPL modificado"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Insertar aviso LGPL modificado (traducido)"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Insertar nombre del usuario actual"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspeccionar"

#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Invertir Tarea"

#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Izquierda"

#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Derecha"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Mover cursor a la izquierda"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Saltar línea y mover el cursor"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Mover cursor al final de línea"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Modo de selección de línea"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Mover cursor a principio de línea"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Mover el cursor al comienzo del texto en la línea"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Bloquear Editor"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Hacer Cadena de Recursos"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ir a corchete coincidente"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Mover ventana del editor a la izquierda"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Mover ventana del editor al primero"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Movar editor a una nueva ventana"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Mover editor a la ventana libre siguiente"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Mover editor a la ventana libre anterior"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Mover ventana del editor a la derecha"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Mover ventana del editor al último"

#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr ""

#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr ""

#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr ""

#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr ""

#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr ""

#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr ""

#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Pegado múltiple"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Siguiente Marcador"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Ir a siguiente editor"

#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Ir al editor siguiente en la historia"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Ir al editor siguiente con la misma Fuente"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Ir a la ventana siguiente"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Modo de selección normal"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Abrir Archivo en Cursor"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Sobreescribir Modo"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Mover cursor a la parte inferior de la página"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Mover cursor una página abajo"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Mover cursor una página a la izquierda"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Mover cursor una página a la derecha"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Mover cursor al principio de la página"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Mover cursor una página hacia arriba"

#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Pegar"

#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr ""

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pausar programa"

#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Borrar todas circunflejos extra"

#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "Las teclas del cursor borran todos los circunflejos adicionales"

#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "Las teclas del cursor mueven todos los circunflejos adicionales"

#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Añadir circunflejo adicional"

#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Alternar circunflejo adicional"

#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Remover circunflejo adicional"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Marcador Anterior"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Ir a editor anterior"

#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Ir a editor anterior en el histórico"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Ir al editor anterior con la misma Fuente"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Ir a la ventana anterior"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compilado rápido, sin enlazado"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "eliminar punto de interrupción"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Eliminar Métodos Vacios"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Eliminar Unidades no Usadas"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Renombrar Identificador"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Reemplazar Texto"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Comunicación de errores"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reiniciar depurador"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Mueve cursor derecha"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "ejecutar programa"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "ejecutar Archivo"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parámetros de ejecución"

#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "ejecutar sin depuración"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Desplazar abajo una línea"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Desplazar a la izquierda un carácter"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Desplazar a la derecha un carácter"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Desplazar arriba una línea"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Seleccionar Abajo"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Seleccionar Todo"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Convertir tabulaciones a espacios en la selección"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Seleccionar final absoluto"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Seleccionar principio absoluto"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Seleccionar ir a XY"

#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Seleccoinar parte de la palabra a la izquierda (ej. CamelCase)"

#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Seleccionar parte de la palabra a la derecha (ej. CamelCase)"

#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Seleccionar Izquierda"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Seleccionar Fin de línea"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Seleccionar Principio de Línea"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Seleccionar hasta principio de la linea de texto"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Seleccionar Página del fondo"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Seleccionar Página Abajo"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Selecciona Página Izquierda"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Seleccionar Página Derecha"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Seleccionar Primera Página"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Seleccionar Página Arriba"

#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Seleccionar Derecho"

#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Selección inteligente de palabra izquierdaa (inicio/fin de palabra)"

#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Selección inteligente de palabra derecha (inicio/fin de palabra)"

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Comenzar seleccionado pegajoso"

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Comenzar seleccionado pegajoso (Columnas)"

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Comenzar seleccionado pegajoso (Linea)"

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Parar seleccionado pegajoso"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Seleccionar Arriba"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Seleccionar hasta el extremo izquierdo de la palabra"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Seleccionar hasta el extremo derecho de la palabra"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Seleccionar Palabra Izquierda"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Seleccionar Palabra Derecha"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Establecer un Marcador libre"

#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format
msgid "Set bookmark %d"
msgstr "Establecer marca %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Mayus Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Mostrar Métodos Abstractos"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Mostrar Contexto del Código"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "ver punto de ejecución"

#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Movimiento inteligente del cursor izquierdo (inicio/fin de palabra)"

#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Movimiento inteligente del cursor derecho (inicio/fin de palabra)"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "parar programa"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Reproducir Macro"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Grabar Macro"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Ir a la ultima posición en celda"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Ir a la primer posición en celda"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Seleccinar celda"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Escape"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Celda Siguiente"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Celda Siguiente (Seleccionar todo)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Celda Siguiente (solo primeras)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Celda Siguiente (Seleccionar todo / solo primeras)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Celda Anterior"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Celda Anterior (Seleccionar Todo)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Celda Anterior (solo primeras)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Celda Anterior (Seleccionar Todo / solo primeras)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Iniciar Edición Sincronizada"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Ir a la última posición en la celda"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Ir a la primera posición en la celda"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Seleccionar Celda"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Escape"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Terminar"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Celda Siguiente"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Celda Siguiente (rotar)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Celda Siguiente (todo seleccionado)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Celda Siguiente (rotar/todo seleccionado)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Celda Siguiente (primeras solamente)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Celda Siguiente (girar / primeras solamente)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Celda Siguiente (girar / todas las seleccionadas / primeras solamente)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Celda Siguiente (girar / todas las seleccionadas / primeras solamente)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Celda Anterior"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Celda Anterior (todo seleccionado)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Celda Anterior (primeras solamente)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Celda Anterior (todas las seleccionadas/primeras solamente)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Verificar Sintaxis"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Ver ensamblador"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "intercambiar punto de interrupción"

#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Ver puntos de interrupción"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Ver pila (stack) de llamadas"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Ver explorador de código"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Ver Explorador de Código"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Ver paleta de componentes"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Ver salida del depurador"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Escoger entre formulario y unidad"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Ver editor de documentación"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Ver botones del IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Ver variables locales"

#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr "Intercambiar Marcador %d"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Intercambiar Resaltado de Palabra-Actual"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Ver mensajes"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Cambiar Modo"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Ver Inspector de Objetos"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Ver registros"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Ver Explorador de Restricciones"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Ver resultados de la búsqueda"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Ver Editor de Fuente"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Ver puntos de observación"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Desplegar Todo"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Desplegar en Cursor"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "comando de editor desconocido"

#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Unidades sin Usar ..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Mueve cursor arriba"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Ver editor de anclaje"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Ver componentes"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Ver editor macros"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Ver formularios"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Ver Historial"

#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Ver in/output de consola"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Ver Orden Tab"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Ver Hilos (Threads)"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Ver dependencias de unidades"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Ver información de unidad"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Ver unidades"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Completado de Palabra"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Mueve el cursor al extremo izquierdo de la palabra"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Mueve el cursor al extremo derecho de la palabra"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Mover cursor una palabra a la izquierda"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Mover cursor una palabra a la derecha"

#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Acercar"

#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Alejar"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Editar teclas de comando"

#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Continuar con la siguiente acción mouse up"

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Plegar comentarios"

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Plegar los comentarios de la selección"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Plegar Ifdef inactivo"

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Plegar Ifdef inactivo (excluir estado mixto)"

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Plegar Ifdef inactivo en selección"

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Plegar Ifdef inactivo en seleccion (excluir estado mixto)"

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Ocultar comentarios"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Ocultar los comentarios de la selección"

#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Emparejar el botón de acción de mouse down"

#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Emparejar la línea de acción de mouse down"

#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Emparejar los modificadores de acción de mouse down"

#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Emparejar la acción pos de mouse down"

#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Buscar todas las acciones de mouse down"

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Desplegar Ifdef activo"

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Desplegar Ifdef activo en selección"

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Desplegar Todo"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Desplegar todos los Ifdef"

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Desplegar todos los Ifdef en selección"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Desplegar todo en la selección"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Desplegar comentarios"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Desplegar comentarios en la selección"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Desplagar Ifdef inactivo"

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Desplegar Ifdef inactivo en selección"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "El archivo es de sólo lectura"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "El archivo \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" no se puede escribir."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Bloqueado"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Grabando"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Pausar-Grabación"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Añadir &observación en cursor"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Añadir &Punto de observación en cursor"

#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr "Marcador &%s: %s"

#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr "Marcador &%s"

#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr "Marcador %s"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Cerrar todas las &Otras páginas"

#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr ""

#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr ""

#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr ""

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Cerrar Página"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Copiar Nombre de archivo"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Clonar a una Nueva Ventana"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Clonar a Otra Ventana"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nueva Ventana"

#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Depurar"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Codificación"

#: lazarusidestrconsts.uemevaluatemodify
msgctxt "lazarusidestrconsts.uemevaluatemodify"
msgid "&Evaluate/Modify ..."
msgstr "&Evaluar/Modificar ..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Buscar Declaración"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Buscar en otra Ventana"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ir al Marcador"

#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Ir al Marcador ..."

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Resaltado"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Inspeccionar ..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Invertir Tarea"

#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Fin de Línea"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Bloquear Página"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Mover Página a la Izquierda"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Mover Página totalmente a la Izquierda"

#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Mover Página a la Derecha"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Mover Pagina totalmente a la Derecha"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Mover a Nueva Ventana"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Mover a Otra Ventana"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nueva Ventana"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Ir al Próximo Marcador"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modificado"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Abrir archivo en Cursor"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Ir al Marcador Anterior"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Salto a procedimiento"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Sólo-Lectura"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactorizar"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Establecer un Marcador Libre"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Mostrar Números de Línea"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Fuente"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Intercambiar Marcador"

#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr "Intercambiar Marcador &%s: %s"

#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr "Intercambiar Marcador &%s"

#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Intercambiar Marcador ..."

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Ac&tivar/desactivar Punto de Interrupción"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Ver pila(stack) de llamadas"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "No implementado todavía"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "SOB"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Sólo lectura"

#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr ""

#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr ""

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Información de versión"