lazarus/languages/lazaruside.cs.po

msgid ""
msgstr ""
"Project-Id-Version: Lazarus\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2014-07-04 07:37+0100\n"
"Last-Translator: Václav Valíček <valicek1994@gmail.com>\n"
"Language-Team: Czech <vaclav@valicek.name>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-SourceCharset: UTF-8\n"
"X-Generator: Poedit 1.5.4\n"
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
"Language: cs\n"

#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Vybrat skupiny"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Vybrat skupiny, které se mají zakázat při dosáhnutí bodu přerušení"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Vybrat skupiny, které se mají povolit při dosáhnutí bodu přerušení"

#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Některé skupiny v seznamu Povolené/Zakázané neexistují.%0:sMají se vytvořit?%0:s%0:s%1:s"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Použít přednastavené schéma"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Nulovat všechna nastavení"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Nulovat všechna nastavení žlábku"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Nulovat všechna nastavení textu"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Přidat bod historie"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Kontextové menu"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Kontextové menu (ladění)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Kontextové menu (tab)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Skočit na implementaci"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Skočit na implementaci / příslušný konec bloku"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Zpět v historii"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Vpřed v historii"

#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Nic / Přednastavené"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Vložit"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Pokračovat %0:s (Navaž na: %1:s)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr "Pokračovat %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Vybrat text"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Vybrat text (po řádcích)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Vybrat text (elementy)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Vybrat text (po slovech)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Vybrat text (sloupce)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Vybrat text (řádky)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Nastavit volnou značku"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Vybrat aktuální řádek (celý)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Vybrat aktuální řádek (text)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Vybrat aktuální odstavec"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Vybrat aktuální slovo"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Vynulovat přiblížení"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Tato stránka nezobrazuje aktuální nastavení. Viz stránka Rozšířené. Zde můžete nastavit výchozí hodnoty"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Obecné"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Standardní, všechny akce (body přerušení, složení) při stisknutí tlačítka myši"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Rozšířené, akce (body přerušení, složení) při uvolnění tlačítka myši. Výběr při současném stisknutí tlačítka myši a pohybu"

#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numers to select lines"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Žlábek"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Pravé tlačítko myši přesune kurzor"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Tažení výběru (kopírovat/vložit)"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Extra-1 tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Extra-2 tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt dvojitý"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl dvojitý"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Dvojitý"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift dvojitý"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Čtyřnásobný"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Trojitý"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Prostřední tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Prostřední"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Levé 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Levé 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Pravé"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Pravé tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl kolečko"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift tlačítko"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Kolečko"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift kolečko"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Máte neuložené změny. Použitím této stránky vrátíte zpět změny provedené na pokročilé stránce"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Posunout horizontálně (systémová rychlost)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Posunout horizontálně (jeden řádek)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Posunout horizontálně (stránku)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Posunout horizontálně (půl stránky)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Posunout horizontálně (stránka bez jedné řádky)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Nic / Předvolené"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Posunout (systémová rychlost)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Posunout (jeden řádek)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Posunout (stránku)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Posunout (půl stránky)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Posunout (stránku bez jedné řádky)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Přiblížení"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Žádné >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Pouze pro čtení"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Malé písmena, první písmeno velké"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Přidat operátor přiřazení :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Zvýraznění závorky"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Strom složení kódu"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Přednastavený text"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Zakázané body přerušení"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Povolit body přerušení"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Chybový řádek"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Bod vykonávání"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Popisovač složení kódu"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Celkový"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Žlábek"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "PokudDefinováno"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Řádek"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Editor Syncron"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Editor šablon"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Oddělovač žlábku"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Vzestupně další"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Zvýraznit aktuální slovo"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Postupné hledání"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Chybný bod přerušení"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Zvýraznění aktuálního řádku"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Číslo řádku"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Změněný řádek"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Odkaz myši"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Vybraná oblast"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Aktivní buňka"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Jiné buňky"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Synchronizované buňky"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Aktivní buňka"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Jiné buňky"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Synchronizované buňky"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Textový blok"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Neznámý bod přerušení"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Slovní závorky"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Zobrazit speciální znaky"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Přidat středník"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Přizpůsobit vrchní linku kvůli komentářů vpředu"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Všechny soubory"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Abecedně"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Kurzor vždy viditelný"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nejednoznačná akce souboru:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Varování při překládání"

#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr ""

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Nastavení aplikace"

#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Zahrnout kontrolní kód"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaticky vytvořené formuláře:"

#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr ""

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Při vytváření nových formulářů je přidat do seznamu automaticky vytvářených formulářů."

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Automaticky smazat soubor"

#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Automaticky Zobrazit Prototypy Funkcí"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Skrýt myš při psaní"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Automatické odsazení"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Nastavení chytrého odsazení)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Automatické odsazení"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Automaticky odstranit prázdné metody"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automaticky nastav malá písmena v názvu souboru"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Dostupné formuláře:"

#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr ""

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Pozadí"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(podadresáře ne)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Stejné jméno (v podadresáři)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Za metodami"

#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Výběr"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Odsazení bloku (mezery)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Odsazení bloku"

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(upravit klávesy)"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Mezery/tabulátor podle předchozího řádku"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Pouze pozice"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Mezery"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Taby, utnuté"

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Taby, potom mezery"

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Zarovnání bloků (tabulátorů)"

#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr ""

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Zvýraznění závorky"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Odpovídající závorkový pár"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Rozlišovat velikost znaků"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Kontrolování voleb překladače"

#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr "Nalezen osiřelý soubor: %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Výsledky"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Kontrola překladače..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Kontrola nastavení překladače..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Kontrola data překladače..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Překládání prázdného souboru..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Kontrola chybějících fpc ppu..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Překládání prázdného souboru."

#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr "používán konfigurační soubor %s"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Pořadí tříd"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Poslední"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "malá písmena"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Náhled (max. délka řádku = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefix čtení"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Prefix uložení"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "VELKÁ PÍSMENA"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefix proměnné"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefix nastavení"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center cursor line"
msgstr "Vystředit řádek ukazatele"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Uložit jako - automaticky přejmenovat pascalovské soubory na malé znaky"

#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr ""

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Kontrolovat balíčky při vytváření formuláře"

#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr ""

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Vyberte šablonu kódu (*.dci)"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Ukázat tlačítka pro zavření v zápisníku"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Barevné schéma"

#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Makra ve stylu C (globální)"

#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Použít Ansi řetězce"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Styl assembleru"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Zprávy"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Kontrolovaní a prosazování"

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Příkazy Kompileru"

#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Operátory ve stylu C (*=, +=, /= and -=)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Vytvořit Makefile"

#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Ladění"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Přídavná cesta ladícího nástroje (žádná):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Vytvoření kódu"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Oba"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Svinout"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Skrýt"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Opačné pořadí svinutí v Popup"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Vytvářet ladící informace pro GDB (pomalejší / Větší velikost exe souboru)"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Použít jednotku Heaptrc (kontrola na únik paměti)"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Zahrnout soubory (-Fi):"

#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr "Info pro GDB"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Knihovny (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Spojování"

#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Volby překladače mohou být uloženy jako XML soubor."

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Barva"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Barva editoru)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Nezměněn"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Barvy"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametry příkazové řádky (bez jména aplikace)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Make default indent for new line if comment opens at column:"
msgstr "Vychozí odsazení pro nový řádek pokud komentář začíná ve sloupi:"

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Omezit odsazení na"

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Přefixovat komentáře na zalomení řádku"

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Shoda aktuálního řádku"

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Shoda textu zahrnující \"*\" ze symbolu \"(*\""

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "řádku"

#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr "Shoda textu po symbolu \"%s\""

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr "Shoda textu zahrnující symbol \"%s\""

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Prefixovat nový řádek"

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Zarovnat prefix na odsazení předchozího řádku"

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Zarovnat Prefix pod začátkem komentáře na prvním řádku komentáře"

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Neodsazovat prefix"

#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments"
msgstr "Komentáře"

#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend, if matched or not matched"
msgstr "Rozšířít, pokud odpovídá nebo neodpovídá"

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend, if matched or not matched (not at EOL)"
msgstr "Rozšířit, pokud odpovídá nebo neodpovídá (ne konec řádku)"

#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend, if matched"
msgstr "Rozšířit, pokud odpovídá"

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgstr "Rozšířit, pokud odpovídá s vynechávkou v prostřed textu (ne konec řádku)"

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Kompilace a Linkování"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Zprávy překladače"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Jazykový soubor zpráv překladače (*.msg)"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Volby překladače"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Vlastnosti dokončení"

#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr ""

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Konfigurace a Cíl"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Konfigurační soubory"

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Jiné"

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Ostatní ladící info"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Přetečení"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analyzování"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Kopírovat/Vložit s informací složení"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Kopírovat slovo při kopírování žádného"

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Rozsah"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Přemístitelné"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Nastavit volby překladače jako výchozí"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr "Ukázat chyby"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "&Zobrazit Volby"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Chytré spojování"

#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Jiné zdroje (soubory .pp/.pas, použitou pouze IDE ne překladačem)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Zásobník"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Odstranit symboly ze spustitelného"

#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Druh ladících informací"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automaticky"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Dwarf s množinami"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Dwarf3 (beta)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Staby"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Zaneřádit proměnné (proměnné mají na začátku náhodnou hodnotu)"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Styl jednotky"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Vytvářet kód pro valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Výřečnost"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE ve stylu C++"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Ctrl-prostřední-klik na záložku zavře všechny ostatní"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Kudrnaté {}"

#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Ukazatel za koncem řádku"

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor"
msgstr "Kurzor"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Kurzor přeskakuje výběr"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Kurzor přeskakuje tabulátory"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Uživatelsky definované rozšíření (.pp.xxx)"

#: lazarusidestrconsts.dlgdcifiledci
msgid "DCI file (*.dci)"
msgstr ""

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor cest"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Typ a cesta ladiče"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Výchozí písmo editoru"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Výchozí hodnota"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Odstranit šablonu "

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Plocha"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Tlačítka - "

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop Files"
msgstr "Soubory na ploše"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Pokyny"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Nabídky - "

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Směr"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Zakázat vyhlazování grafiky"

#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr ""

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Použít barvu pravého okraje"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Kreslit úroveň oddělovače"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Barva zanořené řádky"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Barva řádky"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (místní)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Sekce jednotka"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Odstavec uses"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (místní)"

#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr ""

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Zpět"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tučné"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Podadresář"

#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Šablony kódu"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Doplnit ukončovací příkaz bloku pascalu"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Uživatelsky definované rozšíření"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(%s sec prodleva)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Zobrazení"

#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Soubory editoru"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Dokončení identifikátorů"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Převrácené"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorovat zámky, použít nejdelší nepoužitý editor"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorovat zámky pokud je editor aktuální"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorovat zámky pokud je editor v aktuálním okně"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Zamčeno pokud je text zobrazen"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Odemknuté"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Odemčeno pokud je text vystředěný"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nová záložka, existující nebo nové okno"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nová záložka v novém okně"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nová záložka v existujícím okně"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Tato volba použije nejdelší nepoužitý editor pro soubor i v případě, že je zamčen a/nebo vyžaduje rolování. Určení nejdelšího nepoužitého editoru nezohledňuje pořadí, v němž byla okna zobrazena i pokud je toto nastaveno pro \"stejná kritéria pořadí\". Tato volba bude vždy úspěšná, další volby nikdy testovány."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Tato volba zjistí, zda aktuální aktivní editor má cílový soubor a pokud ano, tak použije aktuální editor i pokud je zamčený a/nebo vyžaduje rolování."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Tato volba zjistí, zda existuje editor pro cílový soubor v aktuálním okně a pokud ano, tak použije tento editor i pokud je zamčený a/nebo vyžaduje rolování."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Tato volba použije zamčený (pouze zamčený) editor, který nevyžaduje rolování k zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné části obrazovky)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Tato volba použije libovolný nezamčený editor."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Tato volba použije nezamčený editor, který nevyžaduje rolování pro zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné vystředěné části obrazovky, kromě 2-5 řádek nahoře/dole)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Tato volba otevře novou záložku v existujícím nebo novém okně pokud není nalezena nezamčená záložka. Tato volba vždy uspěje, další volby už nejsou testovány."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v novém okně (i pokud by jiná existující okna mohla být použita pro novou záložku). Tato volba vždy uspěje, další volby již nejsou testovány."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v existujícím (pouze existujícím) okně. Záložka je otevřena pouze pokud existující okno dosud nemá editor pto cílový soubor."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Kurzíva"

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Velikost fontu editoru"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Volby editoru"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Globální nastavení schéma"

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Různé"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Vypnuto"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Zapnuto"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tab a odsazení"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Podtržené"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Vlastnosti prvku"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Klávesa End skočí k nejbližšímu konci"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Zeptat"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Poznámky: Soubory projektu jsou všechny soubory v adresáři projektu"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Záloha"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Soubory"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Mřížka"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Jazyk"

#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr ""

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Vodící čáry"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Různé"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Žádné"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Jiné soubory"

#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Listy projektu"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Po překladu zaměřit okno zpráv"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Dodatečné mezery znaku"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dodatečné mezery řádku"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Používat externí soubor ladících symbolů GDB."

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Přípony souboru"

#: lazarusidestrconsts.dlgfiles
msgid "%s files"
msgstr ""

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Najít text od kurzoru"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Díl"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Sekce chunk"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Komentář"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Uzel"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Položka"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Seznam <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objekt (zděděný, vkládaný)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (místní)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Komentář (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (vnořené)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Komentář { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Vnořené komentáře"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedura)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedura"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Komentář //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Sekce Unit"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Použití"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (globální)"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Komentář"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Uzel"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Zpracování instrukcí"

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Popředí"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Politika vkládání procedur"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Udržovat pořadí procedur"

#: lazarusidestrconsts.dlgfpcexecutable
msgid "Compiler executable (e.g. %s)"
msgstr ""

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Zdrojový adresář FPC"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Textová značka"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor formuláře"

#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Od začátku"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr "&Od kurzoru"

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Získat pozici"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Celkový"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Vytvářet kód pro gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Barva zachytávače"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Barva mřížky"

#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr ""

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rozměr mřížky X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Velikost horizontálního kroku mřížky"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rozměr mřížky Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Velikost svislého kroku mřížky"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Kódové nástroje"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Ladič"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Prostředí"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Vrátit zpět skupinu"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Ukázat vodící čáry"

#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr ""

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Žlábek"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Složeno"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Barva žlábku"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Barva okraje žlábku"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Index oddělovače žlábku"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Poloviční posouvání stránky"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Velikost haldy a zásobníku"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Velikost haldy"

#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr ""

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Výška:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Skrýt okna IDE při spuštění"

#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr ""

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Skrýt záložky v jednostránkových oknech"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Barva zvýraznění"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Barva zvýraznění písma"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Nalevo od kurzoru"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Napravo od kurzoru"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Zobrazení tipů pro nepoužitý parametr \"Sender\""

#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Zobrazení tipů k nepoužitým jednotkám v hlavním zdrojovém kódu"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Klávesa Home skočí k nejbližšímu startu"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Hostitelská aplikace"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Dokončení identifikátoru"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Politika identifikátorů"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Volby IDE"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Aktivní $IFDEF kód"

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Neaktivní $IFDEF kód"

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Zahrnut $IFDEF kód smíšeného stavu"

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Aktivní  $IFDEF node"

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Neaktivní $IFDEF uzel"

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Zahrnut $IFDEF uzel smíšerného stavu"

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignorovat"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Zahrnout systémové proměnné"

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Odsazení"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Taby"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Před metodami"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Jméno konstruktoru musí být 'init' (destruktor musí být 'done')"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Vložit části třídy"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementace"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Rozhraní"

#: lazarusidestrconsts.dlginsertmethods
msgid "Insert methods"
msgstr "Vložit metody"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Vložit do sekce použitých jednotek"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Vložit mezeru po"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Vložit mezeru před"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval v sekundách"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skákání (např. metoda skákání)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Udržovat x-ovou pozici kurzoru"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Upravit klávesu)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mapování kláves"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Chyba mapování kláves"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Politika klíčových slov"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Povolit LABEL a GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Jazyk"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Poslední (např. na konci zdrojového kódu)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Adresář Lazarusu (výchozí pro všechny projekty)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Vlevo:"

#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Vodící čáry Vlevo, Nahoře"

#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr "1 (rychlé a přátelské k ladění)"

#: lazarusidestrconsts.dlglevel2opt
msgid "2 (quick optimizations)"
msgstr "2 (Úroveň 1 + rychlá optimalizace)"

#: lazarusidestrconsts.dlglevel3opt
msgid "3 (slow optimizations)"
msgstr "3 (Úroveň 2 + pomalá optimalizace)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization)"
msgstr "0 (bez zvláštní optimalizace)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Dělení řádků"

#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Chytré spojování"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Načíst nastavení plochy ze souboru"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hlavní menu"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Zobrazit formuláře projektu"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Zobrazit rámce projektů"

#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Zobrazit jednotky projektu"

#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr ""

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Okraj a žlábek"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Barva značkovače"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight of Word under Caret"
msgstr "Zvýraznění slova pod kurzorem"

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Uživatelem definované zvýraznění syntaxe"

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Odstranit"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr "Odstranit seznam \"%s\"?"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr "Přidat slovo nebo označení"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr "Odebrat slovo nebo označneí"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr "Přehodit slovo nebo označení"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Duplikovat slovo nebo označení"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "Označení %s už existuje. Duplicity budou odstraněny při uložení seznamu."

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Přidat/Odebrat ve všech editorech"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Odstranit seznam"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Jméno"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Přidat seznam"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Rozlišovat velikost písmen"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Nastavit ohraničení na konci pojmu"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Nastavit ohraničení na začátku pojmu"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Ignorovat ohraničení pro pojmy delší než "

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "výběr"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "aktuální slovo"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Nastavení pro označení přidaná podle klíče"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Inteligentní shoda hranice výběru"

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Nový seznam"

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Žádné seznamy"

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Vybrat ..."

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr "Nastavení kláves"

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Hlavní nastavení"

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "Ztotožnit hranice u slov do délky:"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Ignorovat klíčová slova"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr "Vypnout časovač pro označení aktuálního slova"

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Oříznout mezery (při zvýraznění aktuálního výběru)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum čítače"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Max. délka řádku:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum nedávných souborů"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum nedávných souborů projektů"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Slučovat metody a vlastnosti"

#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Jednoduchý"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Dvojitý"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Trojitý"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Čtyřnásobný"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Jakékoliv"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Vlevo"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Uprostřed"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Předat řízení"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Vpravo"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Kolečko dolů"

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Kolečko nahoru"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Zachytit"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Přesunout kurzor (extra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Reaguj při uvolnění tlačítka myši"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Akce"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Klik"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Úpravy myši"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Zdvojená položka"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Tento záznam je v konfliktu s existujícím záznamem"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Tlačítko"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Kurzor"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Obsah"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Klik"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Akce"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Nahoru/dolů"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Volba"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Řadit"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Myš"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Pokročilé"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Příkaz-IDE"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "A"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "A"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Všechno"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Žlábek"

#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Svinout strom"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Zasunuto [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Roztaženo [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Čísla řádek"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Výběr"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opt"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Jiné akce použitím stejného tlačítka"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Můžou být spouštěny v závislosti na modifikační klávese, nastavení předání řízení, jednoduché/dvojité, nahoru/dolu ..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtrovat modifikační klávesy"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Zprávy"

#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Multi-caret (column-select) move with cursor"
msgstr ""

#: lazarusidestrconsts.dlgmulticaretmode
msgid "Multi-caret move with cursor"
msgstr ""

#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi caret for column selection"
msgstr ""

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Vícenásobný výběr"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find Editor for Jump Targets"
msgstr "Najít editor pro cílové skoky"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Pořadí použití kritérií pro nalezení vhodného editoru"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Posledně aktivní editor pro tento soubor"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (souboru) v posledně aktivním okně"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Seznam priorit kritérií pro výběr editoru:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Stránky a okna"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Záložky zápisníku"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Pojmenování"

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Automaticky nepřejmenovávat"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Žádná dostupná jednotka k přidání."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Bez zvýrazňování"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Umístění záložky zdrojového zápisníku"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Nerozdělovat řádek po"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Nerozdělovat řádek před"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspektor objektů"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Výška položky"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Různé"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Nastavení rychlosti"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Použít výchozí nastavení Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Použít výchozí nastavení Lazarusu"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Úrovně optimalizace"

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Ostatní optimalizace"

#: lazarusidestrconsts.dlgotherunitfiles
#, fuzzy
#| msgid "Other unit files (-Fu) (delimiter is semicolon):"
msgid "Other unit files (-Fu):"
msgstr "Jiné soubory jednotek (-Fu) (středník je oddělovač)"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Přepsání bloku"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Popisky pro paletu komponent"

#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Výchozí přípona pascalu"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Zvýraznit ovládací příkazy jako klíčová slova"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Volby rozšířených klíčových slov Pascalu"

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Odpovídající klíčová slova"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Předat nastavení spojovači s \"-k\", mezera je oddělovač"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Zvýraznit klíčové slovo \"String\""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Výchozí"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Žádné"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Pouze \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Trvalý blok"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Trvalý ukazatel"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikace"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "jako vyvolávající (asInvoker)"

#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "Vyčistit ikonu"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Vytvořit aplikační balík"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Načíst &defaultní"

#: lazarusidestrconsts.dlgpodpiaware
msgid "Enabled DPI Awareness (for Vista+)"
msgstr "Zapnuté zohlednění DPI (pro Vista+)"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Úroveň spouštění"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formuláře"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "nejvyšší možné (highestAvailable)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ikona:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(velikost: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(žádné)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "Načíst ikonu"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Různé"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "vyžaduje administrátora (requireAdministrator)"

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Zdroje (Resources)"

#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "Uložit ikonu"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sezení"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Nadpis:"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "UI přístup (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
#, fuzzy
#| msgid "Use Application Bundle for running and debugging (Darwin only)"
msgid "Use Application Bundle for running and debugging"
msgstr "Použít aplikační balík pro spuštění a ladění (pouze Darwin)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (Windows only)"
msgid "Use manifest file to enable themes"
msgstr "Použít soubor manifest k povolení grafických stylů (pouze Windows)"

#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr ""

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Priority"

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Volby projektu"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Volby pro projekt %s"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Soubory projektu"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "&Dotázat se při nahrazení"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Dokončení vlastnosti"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Jméno vlastnosti"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Otevřít poslední projekt při startu"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Ukázat mezery od okrajů"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Zobrazit mřížku"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Přichytit k mřížce"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Odkazy"

#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "&Regulární výrazy"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Nahradit &vše"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace with"
msgstr "&Nahradit s"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Hlášení"

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Vodící čáry Vpravo, Dole"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Pravý klik provede výběr"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Pravý okraj"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Pracovní složka:"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Pravý klik provede výběr"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Vytváření vodících linek"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Výběr vodících linek"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Prostředí"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Místní"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systémové proměnné"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Použít zobrazení"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Uživatelské předefinování"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Spustit s parametry"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Uložit nastavení plochy do souboru"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Uložený řádek"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Ukládat informace editoru pro zavřené soubory"

#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr ""

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Ukládat informace editoru pouze pro soubory projektu"

#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr ""

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Rozsah"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Posunout o jedno méně"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Posouvání"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Ukázat pokyny posuvníku"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Posouvání za konec souboru"

#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "Kurzor za koncem řádku"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Vyhledávací adresář \"%s\" nenalezen."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Hledání přerušeno uživatelem."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Hledání ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Cesty"

#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr ""

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "&Vybraný text"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Nastavit všechny prvky na výchozí"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Nastavit prvek na výchozí"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Nastavit hodnotu vlastnosti"

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Ukázat všechny jednotky"

#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of non-visual components"
msgstr ""

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Ukázat kompilované procedury"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Ukázat čísla řádků"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Ukázat podmínky"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Ukázat ladící informace"

#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr ""

#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr ""

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Ukázat vše"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Ukázat spustitelné informace (pouze Win32)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Ukázat obecné informace"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Ukázat pokyny žlábku"

#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Ukázat tipy"

#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr ""

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Ukázat čísla řádků"

#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr ""

#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Ukázat poznámky"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Ukázat přehled"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Ukázat zkoušené soubory"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Ukázat použité soubory"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Ukázat varování"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Ukázat jedno tlačítko v Panelu úloh"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Přeskočit dopředné deklarace tříd"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Lomítko //"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Chytré záložky"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol za (.~pp)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Čítač (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol ve předu (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Přichycovat k vodícím čarám"

#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr ""

#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr ""

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Mezery"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Tipy pro hlavní tlačítka (Otevřít, Uložit, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Původ"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Velikost zásobníku"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr "Klíčové slovo Static v objektech"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zastavit po počtu chyb:"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Připojit text k uzavíracímu řetězci"

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Přefix. řetězce na novém řádku"

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Řetězec ''"

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Rozšířit řetězce na zalomení"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Podvlastnosti"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Nastavení syntaxe"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab odsazuje bloky"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Ukázat čísla záložek v zápisníku"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátor k mezerám"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Šířka záložek"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Cílová rodina CPU"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Cílový OS"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Cílová platforma"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Cílový procesor"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Volby specifické pro Cíl"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Složka pro sestavení pokusných projektů"

#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "Hledaný &Text"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Tip aktuální třídy/procedury"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Nahoře:"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Styl ořezání mezer"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Ukazatel nebo editace"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Řádek upravený"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Nechat řádek"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Pouze pozice"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Odstranit okrajové mezery"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Navrátit zpět po uložení"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Vrátit zpět / Znovu opakovat"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Omezení vrátitelných akcí"

#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Závislosti jednotky"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Obnovit"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Výstupní adresář jednotky (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Neuložený řádek"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Skládání bloků kódu"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Použít přídavný Konfigurační soubor překladače"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Kreslení oddělovače"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Použít spouštěcí aplikaci"

#: lazarusidestrconsts.dlguseminimumime
#, fuzzy
#| msgid "Ime handled by System"
msgid "IME handled by System"
msgstr "Ime obsluhováno systémem"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Chyba při nahrávání uživatelského schéma ze souboru %s"

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Použít (a upravit) nastavení globálního schéma"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Použít nastavení lokálního schéma"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Použít zvýraznění syntaxe"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Použít historii záložek při zavření záložky"

#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Přidatt jednotku do sekce použitých jednotek"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Užvaněnost během překládání:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Viditelný žlábek"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Viditelný pravý okraj"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Pouze celková slova"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Šířka:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Win32 GUI aplikace"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Okno"

#: lazarusidestrconsts.dlgwinpos
msgid "Window positions"
msgstr "Poloha okna"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Výjimky"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Slova"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Náhled"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Vypsat FPC logo"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Hromadně vybrané komponenty musí být z jednoho formuláře."

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Zarovnat ..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Smazat sekci"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Zrcadlit vodorovně"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Zrcadlit svisle"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Zpět o jeden"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Dopředu o jedno"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Přesunout dozadu"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Přesunout dopředu"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Reset ..."

#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Uložit formulář jako XML"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Měřítko ..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Měřítko"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Vybrat vše"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Velikost ..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Velikost"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Volba: Přitáhnout k mřížce"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Volba: Přitáhnout k vodícím čarám"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-pořadí"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Na obou stranách"

#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Smazat všechny snímky"

#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Přepnout zobrazení snímku nebo aktuálního"

#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Vytvořit snímek"

#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Zapnout/Vypnout automatické snímky"

#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Odstranit vybraný záznam"

#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Zobrazit historii"

#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Zobrazit snímky"

#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr "Umístění"

#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Čas"

#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Historie"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = nic, 1 = vykreslit dělící linky pouze pro nejvyšší úroveň, 2 = vykreslit linky pro první dvě nejvyšší úrovně, ..."

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Přidat soubory"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add Files to Package"
msgstr "Přidat soubory do balíčku"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Přidat do balíčku"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nejednoznačný typ předka"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Víceznačné jméno třídy"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Víceznačné jméno jednotky"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ předka"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Porušená závislost"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Jméno třídy již existuje"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Vytvořit novou komponentu"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr "Vytvořit nový soubor"

#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Vytvořit nový požadavek"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Závislost"

#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr "Existující soubor: \"%s\""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Soubor již existuje"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr "Soubor \"%s\" již v balíčku existuje."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Soubor je použit"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Jméno souboru"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Soubor není jednotka"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Neplatný typ předka"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Neplatná kruhová závislost"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Neplatné jméno třídy"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Neplatný soubor"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Neplatné jméno souboru"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Neplatné jméno jednotky"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" není platné jméno jednotky."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nové jméno třídy:"

#: lazarusidestrconsts.lisa2pnewcomponent
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
msgid "New Component"
msgstr "Nová komponenta"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nový soubor"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, fuzzy
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Pro závislost \"%s\" nebyl nalezen balíček.%sProsím vyberte existující balíček."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Jméno stránky je příliš dlouhé"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Stránka sady:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascalovské jednotky musí mít příponu .pp nebo .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Dialog uložení souboru"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Zkrátit nebo rozšířit jméno souboru"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Ukázat vše"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Přepnout cesty"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Typ předka \"%s\" má stejné jméno jako %sjednotka \"%s\"."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Typ předka \"%s\" není platný paskalovský identifikátor."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Jméno třídy \"%s\" a typ předka \"%s\" jsou totožné."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Jméno třídy \"%s\" již existuje v%sBalíčku %s%sSoubor: \"%s\""

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Jméno třídy \"%s\" má stejné jméno jako %sjednotka \"%s\"."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Jméno třídy \"%s\" není platný identifikátor pascalu."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, fuzzy
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Soubor \"%s\" je částí aktuálního projektu.%sSdílet soubory mezi projekty a balíčky je špatný nápad."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, fuzzy
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Jméno souboru \"%s\" je nejednoznačné, protože balíček zatím nemá předvolený adresář.%sProsím zadejte jméno souboru s úplnou cestou."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
#, fuzzy
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Nejvýšší verze \"%s\" je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximální verze je nižší než Minimální verze."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
#, fuzzy
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Nejnižší verze %s je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Balíček již má závislost na balíčku \"%s\"."

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
#, fuzzy
msgid "The package name \"%s\" is invalid.%sPlease choose an existing package."
msgstr "Jméno balíčku \"%s\" není platné.%sProsím vyberte existující balíček."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Jméno stránky \"%s\" je příliš dlouhé (max. 100 znaků)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Jméno jednotky \"%s\" již v balíčku existuje:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname \"%s\" already exists in this package."
msgstr "Jméno jednotky \"%s\" již existuje v tomto balíčku."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Jméno jednotky \"%s\"%sa jméno souboru \"%s\" se liší."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name \"%s\" does not correspond to the filename."
msgstr "Jméno jednotky \"%s\" nesouhlasí s názvem souboru."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Jméno jednotky \"%s\" je stejné jaké má registrované komponenta.%sToto použití může způsobit podivná chybová hlášení."

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Jméno souboru jednotky:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Jméno jednotky:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Jméno jednotky už existuje"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Neplatné jméno jednotky"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Zrušit změny?"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Přerušit vše"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Přerušit celé načítání"

#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Zrušeno"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Přerušit načítání projektu"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Přerušit celé načítání"

#: lazarusidestrconsts.lisabout
#, fuzzy
#| msgid "About ..."
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Info ..."

#: lazarusidestrconsts.lisabout2
msgid "About %s"
msgstr "Info o %s"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentace:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "O IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "O Lazarusu"

#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licence: GPL/LGPL%sLazarus je IDE pro tvorbu (grafických a konzolových) aplikací s Free Pascalem. Free Pascal je (L)GPL Pascal a Object Pascal překladač, který beží ve Windows, Linuxu, Mac OS X, FreeBSD a jiných.%sLazarus je chybějící částí skládačky, která umožní vytvářet programy pro všechny výše uvedené platformy v prostředí podobném Delphi. IDE je RAD nástroj, který zahrnuje návrháře formulářů.%sVzhledem k tomu, že Lazarus roste, potřebujeme více vývojářů."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Nelze nalézt seznam přispěvatelů."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficiální:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze nevizuální komponenty."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Poděkování"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Akce:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Akce:"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Aktivovat"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Aktivovat vybrané"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktivní"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktivní filtr"

#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Přidat"

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Přidat definice simulující Delphi7"

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Užitečné když má kód kontroly pro podporované verze kompileru"

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr "Přidán chybějící objekt \"%s\" do zdroje pascalu."

#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr "Přidána vlastnost \"%s\" pro %s"

#: lazarusidestrconsts.lisaddfilesindirectory
msgid "Add Files in Directory"
msgstr "Přidat soubory v adresáři"

#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Přidat Filtr ..."

#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr ""

#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr ""

#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr ""

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Přidat klíčové slovo \"do\""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Přidat nové sestavovací makro, kopírovat nastavení z \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Přidat nové makro"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Přidat novou sadu"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Přidat požadavky balíčku?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "přidat balíček (balíčky) do seznamu instalovaných balíčků (použijte s --build-ide k opětovnému sestavení IDE)"

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Přidat balíček %s do projektu?"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Přidat balíček do projektu"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Přidat závorky parametru"

#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Adresa:"

#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "Adresa bodu přerušení ..."

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Přidat do cesty hledání \"include\"?"

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Přidat %s do projektu?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Přidat do cesty hledání unit?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Přidat rozhraní jednotky"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Přidat jednotku (nedoporučeno)"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Přidat hodnotu do makra %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Přidat soubor do balíčku"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Cílový balíček"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Typ souboru"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Má registrační proceduru"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Neplatný balíček"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: \"%s\""
msgstr "Neplatné ID balíčku: \"%s\""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Balíček je pouze pro čtení"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package \"%s\" not found."
msgstr "Balíček \"%s\" nenalezen."

#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Ukázat vše"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Soubor \"%s\"%s již je v balíčku %s."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Balíček %s je pouze pro čtení."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit name: "
msgstr "Jméno jednotky: "

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "Soubor \"%s\" už existuje.%sNahradit?"

#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
msgid "A filter with the name \"%s\" already exists."
msgstr "Filtr pojmenovaný \"%s\" už existuje."

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Po vyčištění (vyčistit vše nebo vyčistit běžné soubory) přepnout na automatické čištění"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Zarovnání"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Všechny bloky vypadají dobře."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Všechny módy sestavení>"

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Všechny soubory"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Všechny zděděné volby"

#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr "Všechny možnosti"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Povolit volání funkcí"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Povolit vyhledávání více řádků"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Všechny parametry této funkce jsou již v tomto volání nastaveny. Není co přidat."

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, fuzzy
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Všechny vaše úpravy v \"%s\"%s budou ztraceny a soubor bude otevřen znovu."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alpha"

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternativní klávesa"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternativní klávesa (nebo sekvence dvou kláves)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Vždy"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Vždy převést navrhované přednastavené jméno souboru na malá písmena"

#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Vybrané položky se vždy vykrelí zaměřené"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Vždy ignorovat"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Makro s tímto názvem již existuje."

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Nalezen nejasný soubor"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, fuzzy
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Nalezen nejednoznačný soubor: \"%s\"%sTento soubor může být chybě zaměněn za \"%s\"%sSmazat nejednoznačný soubor?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Víceznačné soubory nalezeny"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous unit found"
msgstr "Nalezena nejednoznačná jednotka"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ukotvit spodní okraj ke spodnímu okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ukotvit spodní okraj k hornímu okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor ukotvení - nevybrán žádný ovládací prvek"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Povolený = Včetně %s v kotvách"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ukotvit levý okraj k levému okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ukotvit levý okraj k pravému okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ukotvit pravý okraj k levému okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ukotvit pravý okraj k pravému okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ukotvení vybraného ovládacího prvku"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ukotvit horní okraj ke spodnímu okraji sourozence. Udržovaná vzdálenost je definována oběmi vlastnostmi BorderSpacing tohoto a sourozeneckého prvku."

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ukotvit horní okraj k hornímu okraji sourozence. Použijte BorderSpacing pro nastavení vzdálenosti. BorderSpacing sourozence je ignorováno."

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
#, fuzzy
msgid "An error occured at last startup while loading %s!%sLoad this project again?"
msgstr "Při posledním startu došlo k chybě při načítání \"%s!\"%sNačíst znovu tento projekt?"

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Jméno třídy aplikace"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Grafická aplikace Free Pascalu používající více platformní knihovny pro své uživatelské prostředí."

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Použít"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "příznaky sestavení (-B) použít také pro závislosti"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Použít konvence"

#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Jednotka projektu nemůže být použita jinými balíčky/projekty"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Okrajový prostor kolem ovládacího prvku. Další čtyři okrajové prostory jsou přidány k této hodnotě."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Zeptat před nahrazením každého nalezeného textu"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Zeptat se před uložením sezení projektu"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
#, fuzzy
#| msgid "Ask for component name after putting it on a designer form"
msgid "Ask for component name after putting it on a designer form."
msgstr "Dotázat se na jméno komponenty po jejím umístění na návrhový formulář"

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Zeptat se na jméno souboru při novém souboru"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Zeptat se na jméno při vytvoření"

#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr "Užitečné nastavení na systémech Windows je: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Automatické dokončení: vypnuto"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Automatické dokončení: zapnuto"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Automaticky pokračovat po:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Značky a párování"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automaticky"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automaticky"

#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "nedokončovat výběr"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Automaticky vyvolat po bodu"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "odsazení řádku"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "mezera"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tabulátor"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "konec slova"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "nepřidávat znak"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Doplňování a Tipy"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Automaticky ukázat"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Dostupné k instalaci"

#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Dostupné módy sestavení projektu:"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Vytvářet zálohy změněných souborů"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Zálohování souboru selhalo"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Vytvořit záložní adresář pod adresářem projektu"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Změna jména nebo verze balíčku naruší závislosti. Měly by být změněny také tyto závislosti?%sVyberte Ano ke změně všech uvedených závislostí.%sVyberte Ignorovat k porušení závislostí a pokračování."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "začátky"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Za vztaženými"

#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr ""

#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr ""

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Nejlépe zobrazíte instalací HTML ovládacího prvku jako turbopoweriprodsgn"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Vždy sestavit před spuštěním"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Sestavit povel"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Při sestavení projektu vykonej příkaz Souboru sestavení"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Pro spuštění projektu spusťte příkaz Spustit soubor"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Spustit příkaz"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Když je tento soubor aktivní v editoru"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Pracovní složka (nechejte prázné pro cestu souboru)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Tlustě nevýchozí hodnoty"

#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Okrajový prostor"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Dolní okrajový prostor. Tato hodnota je přidána k základnímu okraji a je použita pro místo pod prvkem."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Dolní ukotvení"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Spodní části"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož spodní straně je ukotvený. Nechte prázdné pro rodiče."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Dolní prostor stejnoměrně"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Přerušit"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Vlastnosti bodů zastavení"

#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Přidat"

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Zavřít"

#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Smazat"

#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr "Přid&at"

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Nahradit..."

#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Povolený"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Najít"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "U&končit"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Odstranit"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Nahradit"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Sestavit"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "sestavit všechny soubory projektu/balíčku/IDE"

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Sestavit"

#: lazarusidestrconsts.lisbuildfollowingmodes
msgid "Build the following modes"
msgstr ""

#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Sestavit IDE"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "sestavit IDE s balíčky"

#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr ""

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Sestavení Lazarusu selhalo"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Rozdíly mezi sestavovacími módy"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Rozdíly s ostatními sestavovacími režimy"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Mód:"

#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr "Titulek v taskbaru ukazuje například: project1.lpi - Release - Lazarus"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Režimy sestavení"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Sestavit nový projekt"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Číslo sestavení"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Sestavit"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Zaneprázdněn"

#: lazarusidestrconsts.lisbyte
msgid "%s byte"
msgstr "%s bajt"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Volání %s k vytvoření Makefile z %s selhalo."

#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Zásobník není vyhodnocen"

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Zrušit"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Zrušit načítání této komponenty"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Zrušit načítání jednotky"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Zrušit přejmenování"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Nelze přeložit projekt"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Nelze zkopírovat komponentu na nejvyšší úrovni."

#: lazarusidestrconsts.liscannotcreatefile
msgid "Cannot create file \"%s\""
msgstr "Nelze vytvořit soubor \"%s\""

#: lazarusidestrconsts.liscannotexecute
#, fuzzy
#| msgid "can not execute \"%s\""
msgid "cannot execute \"%s\""
msgstr "nelze spustit %s"

#: lazarusidestrconsts.liscannotfind
msgid "Cannot find %s"
msgstr "Nelze najít %s"

#: lazarusidestrconsts.liscannotfindexecutable
#, fuzzy
#| msgid "can not find executable \"%s\""
msgid "cannot find executable \"%s\""
msgstr "nelze najít spustitelný %s"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Nelze nalézt spouštěč lazarusu:%s%s"

#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr "Nelze najít unitu %s"

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Nelze testovat kompiler během ladění/kompilace."

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Změnit lze pouze třídu dědící TComponent."

#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr "Nelze najít validní %s.ppu"

#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr ""

#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr "%s (%s souborů)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr "Opravdu smazat %s zdrojových souborů%s%s"

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Změnit třídu %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "žádná třída"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Víceznačný překladač"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Prosím zkontrolujte adresář Test v %sNástroje -> Volbyí -> Soubory -> Adresář pro sestavení testovacích projektů"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Překladač \"%s\" není spustitelný soubor.%sPodrobnosti: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "obsahuje "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Zkopírovat výstup do schránky"

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Datumy .ppu souborů FPC se liší o víc než hodinu.%sTo může znamenat, že jsou z různých instalací.%sSoubor1: %s%sSoubor2: %s"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "CHYBA: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Cesta jednotky FPC obsahuje zdrojový kód: "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "nové řádkové symboly"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "POKYN: "

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Neplatný překladač"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Neplatná hledací cesta"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Neplatný testovací adresář"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Chybějící jednotka"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "nenalezena přeložená FPC jednotka: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "nalezeno více konfigurací překladače: "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "nenalezen žádný fpc.cfg"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "ne ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu existuje dvakrát: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Přeložená jednotka FPC %s.ppu nebyla nalezena.%sTo zpravidla znamená, že fpc.cfg obsahuje chybu nebo je instalace FPC poškozená."

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Existující soubor .ppu je starší než překladač samotný:%s%s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Ve vaší cestě je několik překladačů Free Pascalu.%s%s%sMožná jste zapomněli smazat starý překladač?"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Přeskočit"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "speciální znaky"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Všechny testy se zdařily."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Nelze vytvořit testovací soubor"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Nelze vytvořit Testovací Pascalovský Soubor \"%s\"."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "neobvyklé znaky"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Varování"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "VAROVÁNÍ: "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "špatný oddělovač cest"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Skupiny"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Složitost"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konstanty"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Prázdné bloky"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Prázdné sekce tříd"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Prázdné konstruktory"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Prázdné procedury"

#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(filtr)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Následovat kurzor"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s v %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Je kořenový ovládací prvek"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "Počet parametrů považován za \"příliš\""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Dlouhé procedury"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Počet řádků procedury považován za \"dlouhý\""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Mnoho vnořených procedur"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Mnoho parametrů"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Ukázat kategorie"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Ukázat uzly zdroje"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "Počet vnořených procedur považován za \"příliš\""

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centrovat ztracené okno"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Vystředit prvky vodorovně, relativně k daným sourozencům. BorderSpacing je ignorováno."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Vystředit prvky svisle, relativně k daným sourozencům. BorderSpacing je ignorováno."

#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Vystředit formulář"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Vystředit v okně"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Vystředit"

#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Upřednostněný prezentační režim"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Skupina"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Zdroj"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nikdy, pouze ručně"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Použito pouze v režimu kategorie"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Při nečinnosti"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Obnovit automaticky"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Jiné"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aktualizovat"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Když přepínání souboru v zdrojovém editoru"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedury"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Vlastnosti"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Zveřejněné vlastnosti bez výchozích hodnot"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Ukázat pozorování o"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Styl"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Obklopující"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "K dokončení"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Typy"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Nepojmenované konstanty"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Nesetřídění členové"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Nesetříděná viditelnost"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Použití"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Proměnné"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Nesprávné odsazení"

#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr "Došlo k výjimce během mazání%s\"%s:%s\"%s%s"

#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Zrušit načítání tohoto zdroje"

#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sTřída \"%s\" nenalezena."

#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr "%s%sKomponenta: %s:%s"

#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr "%s%sTřída komponenty: %s"

#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Pokračovat v nahrávání"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Není známo, jak kopírovat upravovací výběr tohoto formuláře"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Není známo, jak vyjmout upravovací výběr tohoto formuláře"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Není známo, jak smazat upravovací výběr tohoto formuláře"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Chyba při vytváření komponenty"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Chyba při vytváření komponenty: %s%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Chyba při rušení komponenty"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Chyba při rušení komponenty typu %s jednotky %s:%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Chyba při rušení prostředníka"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Chyba při rušení prostředníka %s jednotky %s:%s%s"

#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "Chyba čtení %s"

#: lazarusidestrconsts.liscfeinfile
msgid "In file %s"
msgstr "V souboru %s"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Neplatný vlastník komponenty"

#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr "%sKořen=%s:%s"

#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Zastavit všechna nahrávání"

#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr "%sProud=%s"

#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr "%s%sPozice proudu: %s"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm již existuje"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Neznámý typ %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent  Kde je TCustomNonFormDesignerForm? %s"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator již existuje: %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "Editor komponenty třídy \"%s\" vytvořil chybu: %s\"%s\""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Komponentě typu %s se nepodařilo nastavit vlastníka na %s:%s"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr "Nelze vyčistit upravovací výběr formuláře%s%s"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Změnit"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Změnit sestavovací mód"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Změnit třídu"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Změnena souřadnice %s od %s z \"%d\" na \"%d\" uvnitř %s."

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Změnit kódování"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Změnit soubor"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Změnit rodiče"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Změny nebyly uloženy"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Změnit na Unix /"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Změnit na Windows \\"

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Znak"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa znaků"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Vybrat vše"

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
#, fuzzy
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Kontrolovat změny v souborech na disku raději podle obsahu než podle času"

#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Zkontrolujte, jestli balíček %s vytváří %s.ppu, jestli tento soubor nic nemaže a jestli žádné dva balíčky nemají přístup k zdroji unity."

#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Zkostrolujte, jestli je balíček %s v seznamu závislostí"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "zkontrolovat zda další element ve zdrojovém kódu je \"end\". Pokud ne, zapiš konec řádku + \"end;\" + konec řádku"

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Zkontrolovat nastavení"

#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, fuzzy
#| msgid ". Check search path package %s, try a clean rebuild, check implementation uses sections."
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr "Zkontrolujte cestu pro hledání balíčku %s, zkuste čisté sestavení, zkontrolujte sekci 'uses' sekce 'implementation'."

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Ověřte cíl (OS, CPU, typ LCL widgetu). Možná musíte přeložit balíček pro tento cíl, nebo nastavit jiný cíl pro tento projekt."

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Vyberte jiné jméno"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Vyberte soubor s šablonou CodeTools"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Vyberte odkaz FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Vyberte klávesu..."

#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr ""

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Vyberte ukázkový soubor"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Vyberte soubor FPC zpráv"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Vyberte pascalovských soubor pro ukázku odsazení"

#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr ""

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Změnit soubor zpráv překladače"

#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr ""

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Vyberte balíček Delphi (.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Vyberte projekt Delphi (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Vyberte jednotku Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Vyberte adresář"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Vyberte zdrojový adresář FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Vyberte adresář Lazarusu"

#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr ""

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Vyberte jméno"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "K vytvoření nového souboru vyberte jednu z položek"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Vyberte jednu z těchto položek k vytvoření Balíčku"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Vyberte jednu z těchto položek k vytvoření Projektu"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Vyberte jednu z těchto položek k zdědění z existujícího"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Vyberte zdrojový soubor programu (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Vyberte strukturu k obklopení výběru"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Vyberte adresář na zkoušky"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Detekována kruhová závislost"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Dokončení třídy"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Třídy a vlastnosti existují. Hodnoty nebyly zkontrolovány."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Třída \"%s\" není třídou registrované komponenty.%sNelze vložit."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Třída nenalezena"

#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr "Třída %s nenalezena v %s(%s,%s)"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Třída \"%s\" metody \"%s\" nenalezena."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Vyčistit"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Vyčistit adresář"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Vyčistit podadresáře"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Udržovat všechny textové soubory"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Nechat soubory odpovídající filtru"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Odstranit soubory odpovídající filtru"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Jednoduchá syntaxe (např. * namísto .*)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Vyčistit vše"

#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Vyčistit běžné soubory"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Vyčistit zdrojové soubory Lazarusu"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Přepnout po sestavení na automatické"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Vyčistit"

#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Vyčistit a sestavit"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Vyčistit a sestavit projekt"

#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr ""

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Vyčistit cestu jednotky?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Smazat"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Vyprázdnit adresář?"

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Vyčistit filtr pro možnosti"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "K procházení souboru klikněte zde"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Klikněte pro zobrazení možných použití"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Klonovat"

#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Zavřít"

#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Zavřít vše"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Zavřit všechny vybrané"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Zavřít soubory"

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Skrýt okno"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Zavření okna editoru zdrojových kódů. Chcete zavřít všechny soubory nebo schovat okno?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Zavřít okno zdrojového editoru"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Volby rozhraní LCL:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parametr"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponenty"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Dědičnost"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Seznam"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Stránky"

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "Nav&rátit výchozí"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Víceznačný přídavný konfigurační soubor překladače"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Volat při:"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Příkaz:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Kód"

#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Prohlížeč kódu"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Nastavení vytváření kódu"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Přidat cestu"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Procházet"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Potvrdit nahrazení"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Vytvořit položku nápovědy"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Odstranit cestu"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Popis"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Chyby"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Příklad"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Nastavení FPDoc"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Vložit tučnou formátovanou značku"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Vložit formátovací značku kódu"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Vložit značku pro kurzívu"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Vložit značku poznámky"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Vložit značku pro podtržené písmo"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Vložit značku formátování proměnné"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Zděděný"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Vložit odkaz..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Vložit značku formátování odstavce"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenalezen zděděný popis)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<ŽÁDNÝ>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Související informace"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Krátky popis"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Krátký"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorovat konstanty v další funkci"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Hledat bezejmennou znakovou konstantu"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Pozorovatel kódu"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorovat další bezejmennou konstantu"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Přidat šablonu"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Přidat šablonu kódu"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token \"%s\" already exists! "
msgstr " Symbol \"%s\" již existuje! "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Automatické dokončení na"

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Změnit"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentář:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Upravit šablonu kódu"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akce: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůžou mít ručně vytvořené uzly potomků."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automaticky generováno"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Automaticky generované uzly nelze editovat."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor definic CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Cesta překladače"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Převést uzel"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Vytvořit definice pro adresář %s"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Vytvořit definice pro překladač Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Vytvořit definice pro SVN zdroje Free Pascalu"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Vytvořit definice pro projekt %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Vytvořit FPC makra a cesty pro adresář projektu fpc"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definovat"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definovat rekurentně"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Odstranit uzel"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: C:/Programy/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: C:/Programy/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Popis:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s složka"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Jinak"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "JinakPokud"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Ukončit bez uložení"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "SVN zdrojový adresář FPC"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "Pokud"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "PokudDefinováno"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "PokudNedefinováno"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Složka"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Vložit šablonu projektu Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Vložit šablonu projektu Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Vložit šablonu projektu Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Vložit šablonu překladače Free Pascalu"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Vložit šablonu projektu Free Pascalu"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Vložit šablonu zdrojového kódu SVN Free Pascalu"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Vložit šablonu překladače Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Vložit šablonu adresáře Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Vložit šablonu projektu Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Vložit uzel jako potomka"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Vložit uzel pod"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vložit šablonu"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "neplatný rodič"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Neplatný rodičovský uzel"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Neplatný předchozí uzel"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Přesunout uzel dolů"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Přesunout uzel o jednu úroveň dolů"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Přesunout uzel o jednu úroveň nahoru"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Přesunout uzel nahoru"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Jméno:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nový uzel"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Uzel je pouze pro čtení"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "žádné vybrané"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Rodičovský uzel nemůže obsahovat dětské uzly."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Předchozí uzel nemůže obsahovat uzly potomků."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Adresář projektu"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s složka projektu"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Chyba čtení"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Uložit a ukončit"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Vybrat uzel:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "Zdrojový adresář Free Pascal SVN. Nevyžadované, ale zlepšuje hledání deklarací a ladění."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Adresář projektu Free Pascalu."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Zdrojový adresář SVN Free Pascalu"

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Cesta k překladači Free Pascal.%s Například %s/usr/bin/%s -n%s nebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Cesta překladače Free Pascal pro tento projekt. Vyžadováno jen pokud je nastaven FPC SVN zdroj níže. Použito pro automatické vytvoření maker."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Cesta k překladači Free Pascal pro tento zdroj.%sPoužito pro automatické vytvoření maker."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Adresář projektu %s,%skterý obsahuje soubor .dpr, dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Nedefinovat"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Nedefinovat vše"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Nedefinovat rekurentně"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Hodnota jako cesty souboru"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Hodnota jako text"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%shodnota \"%s\" není platná."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Proměnná:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Zavináč"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Závorka"

#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dvojtečka"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Čárka"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Klíčové slovo"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nový řádek"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Žádné"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Číslo"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Tečka"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Středník"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Mezera"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Konstantní řetězec"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"

#: lazarusidestrconsts.liscodetoolstemplatefile
msgid "CodeTools template file"
msgstr "Šablona CodeTools"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Spustit pak"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Spustit před"

#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr "Adresa"

#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr "Třída"

#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Sesunout vše (/)"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Sesunout všechny třídy"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Sesunout všechny balíčky"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Sesunout všechny jednotky"

#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr "Odřádkování"

#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr "Viditelnost"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Příkaz po"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Příkaz po neplatném"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Příkaz po publikování modulu"

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parametry příkazové řádky"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametry příkazového řádku programu"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Přeložit"

#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr ""

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Překladač"

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Překladač \"%s\" nepodporuje cíl %s-%s"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Chyba: neplatný kompilátor: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Jméno souboru překladače"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Tip: cestu překladače můžete nastavit v Nástroje -> Nastavení -> Soubory -> Cesta překaldače"

#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr "Nenalezen soubor zpráv překladače:%s%s"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Poznámka: Nenalezen konfigurační soubor Nástrojů Kódu - použité výchozí"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Poznámka: načítání starého souboru voleb Nástrojů Kódu: "

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Přeložit"

#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
#, fuzzy,badformat
#| msgid "%s -> Compile with -vd for more details. Check for duplicates."
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "%s-> Kompilujte s -vd pro více detailů. Kontrolujte na duplicity."

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (kompilování ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Zobrazit dlouho řádkové tipy"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Rozšířit zcela vlevo"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Rozšířit o něco vlevo"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nikdy"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Rozšířit pouze vpravo"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Jméno komponenty \"%s\" je klíčovým slovem Pascalu."

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name \"%s\" is keyword"
msgstr "Jméno komponenty \"%s\" je klíčové slovo"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name \"%s\" is not a valid identifier"
msgstr "Jméno komponenty \"%s\" není platný identifikátor"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Zobrazit vše"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Otevřít balíček"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Otevřít jednotku"

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Podmínka"

#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Podmíněné"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Konfigurační adresář Lazarusu"

#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr ""

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Nastavit sestavení %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Nastavení \"Sestavení Lazarusu\""

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Nastavit Lazarus IDE"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Potvrdit"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Potvrzení"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus se znovu sestaví s těmito profily:%sPokračovat?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Potvrdit změny"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Potvrzení smazání"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Chcete znovu sestavit Lazarus s profilem: %s ?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Potvrdit novou sadu balíčků pro IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Akce"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nová sada balíčků"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Stará sada balíčků"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Konflikt"

#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Konflikt detekován"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konzolová aplikace"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Free Pascal program příkazové řádky používající TCustomApplication pro snadnou kontrolu parametrů příkazové řádky, zpracování výjimek, atd."

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Kód konstruktoru"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "obsahuje"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Kontextová"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Pokračovat"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Pokračovat a již se znovu neptat"

#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr ""

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Pokračovat bez načtení formuláře"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Přispěvatelé"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Prvek potřebuje rodiče"

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Přidat komentář po nahrazení"

#: lazarusidestrconsts.lisconvaddedunittousessection
msgid "Added unit %s to uses section"
msgstr ""

#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr ""

#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr ""

#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr ""

#: lazarusidestrconsts.lisconvconvertedfrom
msgid " { *Converted from %s* }"
msgstr ""

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Přidá posunutí k hornímu okraji prvků uvnitř vizuálních kontejnerů"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Posunutí okrajů"

#: lazarusidestrconsts.lisconvdeletedfile
msgid "Deleted file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr "Přidán(a/y) definice %s ve vlastních volbách"

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr "Přidán balík %s jako závislost"

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Všechny podadresáře budou prohledány pna soubory jednotek"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools selhalo!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Kategorie:"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr "Kódování změněno z %s na UTF-8"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Převod přerušen."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Převod připraven"

#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr "Konverze zabrala: %s"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Převod balíčku Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Převod projektu Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Převod jednotky Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr "* Převádění souboru %s *"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Převádím soubory unit nalezené během konverze ***"

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Převádím soubory unit patřící projektu/balíku ***"

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Chyba=\"%s\""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Během konverze unity nastala chyba. Pokračuji s formuláři už převedených unit."

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Převod jednotky selhal"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit \"%s\""
msgstr "Selhal převod jednotky \"%s\""

#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Opravena velikost znaků jednotky \"%s\" na \"%s\"."

#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr "* Oprava použitých jednotek souboru %s *"

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Nalezeny všechny soubory unit."

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Funkce Delphi"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) chybějící zahrnuté soubory"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Jméno Delphi"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Jméno balíčku existuje"

#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Balík %s je vyžadování v Lazarusu! Nainstalujte jej později."

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Jednotka %s vypuštěna z projektu"

#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr "Odstraněna jednotka \"%s\" ze sekce použitých jednotek."

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "* Repairing form file %s *"
msgstr "* Oprava formulářového souboru %s *"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Opravování formulářových souborů ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Nahrazena jednotka \"%s\" jednotkou \"%s\" v sekci používaných jednotek."

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Již existuje balíček se jménem \"%s\"%sProsím, zavřete nejdříve tento balíček."

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Jméno unity existuje v LCL"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Jednotky k nahrazení v %s"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL již má unitu s názvem %s. Odstranit lokální soubor %s?"

#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ""

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Chyba převodu"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Převést"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Převést kódování"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Převést kódování projektů/balíčků"

#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr ""

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Převést projekt nebo balíček"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Cíl"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Multi-platformní"

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Multi-platformní vs. Pouze pro windows"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Převaděč přidá podmíněný překlad k podpoře různých cílů"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Použít stejný formulářový DFM soubor"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Stejný DFM soubor pro Lazarus i Delphi místo kopírování do LFM"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Podporovat Delphi"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Použít podmíněný překlad k podpoře Delphi"

#: lazarusidestrconsts.lisconvfixedunitname
msgid "Fixed unit name from %s to %s."
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Nahrazování funkcí"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Některé funkce Delphi mohou být nahrazeny funkcemi LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funkce / procedury k nahrazení"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Levé posunutí"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nové jméno"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Rodičovský kontejner"

#: lazarusidestrconsts.lisconvproblemsfindingallunits
msgid "Problems when trying to find all units from project file %s"
msgstr ""

#: lazarusidestrconsts.lisconvproblemsfixingincludefile
msgid "Problems when fixing include files in file %s"
msgstr ""

#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr ""

#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr ""

#: lazarusidestrconsts.lisconvreplacedcall
msgid "Replaced call %s with %s"
msgstr ""

#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr ""

#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr ""

#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr ""

#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr ""

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Horní posunutí"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Nahrazení typu"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Neznámé typy v souboru formuláře (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Typy k nahrazení"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Nahrazení jednotky"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Jména jednotek v sekci \"uses\" zdrojové jednotky"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Jednoty k nahrazení"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Neznámé vlastnosti"

#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr ""

#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr ""

#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr ""

#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr ""

#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr ""

#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr ""

#: lazarusidestrconsts.liscoolbarborderstyleitem0
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Žádné"

#: lazarusidestrconsts.liscoolbarborderstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Jednoduchý"

#: lazarusidestrconsts.liscoolbarclearselection
msgid "Clear selection"
msgstr ""

#: lazarusidestrconsts.liscoolbarcodeexplorer
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"

#: lazarusidestrconsts.liscoolbarcodetemplates
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Šablony kódu"

#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr ""

#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr ""

#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr ""

#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr ""

#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyleitem1
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Dvojitý"

#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr ""

#: lazarusidestrconsts.liscoolbargrabstyleitem5
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Tlačítko"

#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr ""

#: lazarusidestrconsts.liscoolbarhelp1
msgid "The \"Add\" button inserts a command before the selected Item of the Toolbar."
msgstr ""

#: lazarusidestrconsts.liscoolbarhelp2
msgid "If none is selected, the Item will be appended at the end of the Toolbar."
msgstr ""

#: lazarusidestrconsts.liscoolbarhelp3
msgid "You may rearrange Toolbar Items with \"Move Up\" and \"Move Down\" buttons."
msgstr ""

#: lazarusidestrconsts.liscoolbarhelp4
msgid "Hint: to append an Item at the end, use \"Clear selection\""
msgstr ""

#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr ""

#: lazarusidestrconsts.liscoolbarmessages
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Zprávy"

#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr ""

#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr ""

#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr ""

#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr ""

#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr ""

#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr ""

#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr ""

#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr ""

#: lazarusidestrconsts.liscoolbarsourceeditor
#, fuzzy
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr ""

#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr ""

#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr ""

#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Kopírovat"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Kopírovat vše"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Kopírovat Všechny Položky Do Schránky"

#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Kopírovat Všechny/Původní Zprávy do Schránky"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Zkopírovat celý výstup do schránky"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Kopírovat Všechny Zobrazené Zprávy do Schránky"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Zkopírovat popis do schránky"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Chyba kopírování"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Chyba kopírování"

#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr ""

#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Kopírovat Cestu Souboru do Schránky"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy \"%s\" to clipboard"
msgstr "Zkopírovat \"%s\" do schránky"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopírování celého formuláře není implementováno."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Zkopírovat položku do schránky"

#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Kopírovat/Přesunout soubor do složky"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Zkopírovat Vybrané Položky do Schránky"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Lopírovat Vybrané Zprávy do Schránky"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Snímat pro zprávy FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Snímat pro zprávy Make"

#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Kontrolovat na zprávy:"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Přeskočit volání překladače"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "Nelze přidat \"{$I %s}\" do hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "Nelze přidat \"{$R %s}\" do hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add \"%s\" to main source!"
msgstr "Nelze přidats \"%s\" do hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove \"%s\" from main source!"
msgstr "Nelze odstranit \"%s\" z hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "Nelze odstranit \"{$I %s}\" z hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "Nelze odstranit \"{$R %s}\" z hlavního zdrojového kódu!"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá Free Pascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Otevřít balíček %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Otevřít jednotku %s"

#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ""

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Vytvořte nejdříve projekt!"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Vytvořit Ladící a Vydávací módy"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Vytvořit adresář?"

#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Vytvořit Filtr"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Vytvořit funkci"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Vytvořit uzel nápovědy"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Vytvořit to"

#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr "Vytvořit lokální proměnnou \"%s\""

#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr ""

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Vytvořit nový balíček)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "(Vytvořit novou komponentu balíčku)"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Vytvořit projekt"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Vytvořit/aktualizovat soubor .po při uložení souboru lfm"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Vytváření indexového souboru zdrojových kódů FPC %s ..."

#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Dolní"

#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Nahoře"

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Vyberte adresář"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Hodnoty adresářů Nástrojů Kódu"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definovat šablony"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<žádná proměnná nevybrána>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Otevřít náhled"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Nástroje"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Proměnná: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Jméno proměnné"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Šablony"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Aktualizovat všechny podpisy metod"

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Aktualizobat vícenásobné podpisy procedur"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "vyberte makro prosím"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Vybrat makro kódu"

#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Aktuální"

#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr ""

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Aktuální stav: "

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Sloupec kurzoru v aktuálním editoru"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Řádek kurzoru v aktuálním editoru"

#: lazarusidestrconsts.liscustomopthint
#, fuzzy
#| msgid "These options are passed to the compiler after comments are deleted and macros are replaced."
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Tyto volby jsou přímo předány překladači jakmile jsou Makra nahrazena a komentáře odstraněny."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "vlastní nastavení"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Vlastní nastavení"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Vlastní program"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Vlastní Free Pascal program."

#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Vyjmout"

#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr "Přiložit"

#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr "Jméno obrázku"

#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr "PID"

#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr "Běžící procesy"

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Datový modul"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Smazat vše"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Smazat vše"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Zakázat vše"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Zakázat vše"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Povolit vše"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Povolit vše"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr "Kopírovat do schránky"

#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Nastavení bodu přerušní ..."

#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "Výraz:"

#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "Nová hodnota:"

#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "Výsledek:"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Vyhodnocení bodu přerušení"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Dosažen bod přerušení"

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Zpráva bodu přerušení"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Výpis zásobníku bodu přerušení"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Přednastavená barva"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Vyvolána výjimka"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Modul nahrán"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Modul odebrán"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Výstupní ladící řetězec"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Ukončení procesu"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Start procesu"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Ukončení vlákna"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Start vlákna"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Poslána zpráva Windows"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Poslána zpráva Windows"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Odstranit"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Zakázat"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Zakázat"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Povolit"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Povolit"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nebyl určen ladící nástroj"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Přesto nastavit bod přerušení"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Není nastaven ladič.%sNastavení bodu přerušení nemá význam, dokud nenastavíte ladič v dialogu Volby ladiče v menu."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Zapnout/Vypnout"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Zakázat/Povolit změny pro celé okno"

#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr ""

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Ladič"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Chyba ladiče%sLadič je v chybovém stavu%sUložte svou práci!%sPoužijte Stop, a doufejte v nejlepší."

#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Chyba ladění"

#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Informace ladění"

#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Varování ladění"

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Neplatný ladič"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (ladění ...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Automatické přetypování objektů"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Přidat výjimku"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Doplňující prohledávací cesty"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Bod přerušení"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Smazat záznam při spuštění"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Ladič"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Obecná nastavení ladícího nástroje"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Speciální nastavení pro ladič (záleží na typu ladiče)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Zdvojený název výjimky"

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Zadejte jméno výjimky"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Záznam událostí"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Obslouženo"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Obslouženo ladícím nástrojem"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Obslouženo programem"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorovat tyto výjimky"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Výjimky jazyku"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Omezit počet řádek na"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Upozornit při výjimce Lazarusu"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Výjimky OS"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Výstup"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Resetovat ladič po každém běhu"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Obnovit"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Obnovit jako obsloužené"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Obnovit jako neobsloužené"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Zobrazit hlášení při zastavení"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signály"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Vlákno"

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Použít barvy v záznamu událostí"

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Okna"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nelze načíst soubor"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file \"%s\"."
msgstr "Nelze načíst soubor \"%s\"."

#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Číselný"

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Výchozí"

#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr ""

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(výchozí)"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Zpoždění pro dlouho řádkové tipy v rámci dokončování"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Zpoždění pro tipy a rámec dokončování"

#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Odstranit"

#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr ""

#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr ""

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Smazat vše"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Smazat všechny body přerušení?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "Smazat všechny body přerušení v souboru \"%s\"?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Smazat vše ve stejném zdroji"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Odebrat všechny vybrané body přerušení?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Odstranit všechny tyto soubory?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Odstranit víceznačný soubor?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Odstranit Bod přerušení"

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Smazat bod přerušení na%s\"%s\"řádku %d?"

#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr "Smazat bod přerušení na adrese %s?"

#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr "Smazat kukátko \"%s\"?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Odstranění souboru selhalo"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro \"%s\"?"
msgstr "Smazat makro \"%s\"?"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Smazat mód \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file \"%s\"?"
msgstr "Odstranit starý soubor \"%s\"?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Smazat starý soubor?"

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Smazat vybrané soubory"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Smazat vybrané makro?"

#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value \"%s\"?"
msgstr "Odstranit hodnotu \"%s\"?"

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Smazat hodnotu %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file \"%s\" failed."
msgstr "Odstranění souboru \"%s\" selhalo."

#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr ""

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr ""

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Balíček Delphi"

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Projekt Delphi"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Jednotka Delphi"

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "\"Návrhové\" balíky přidávají komponenty a položky do menu IDE. Mohou být použity projekty, ale nemohou být kompilovány do projektu. Kompiler nenajde jednotky balíku během kompilace projektu."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cílová složka"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Kód destruktoru"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Nerozlišovat velikost znaků"

#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr ""

#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr ""

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorovat prázdné řádky při přidávání a odstraňování"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorovat rozdílné konce řádků (např. #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorovat množství znaků mezer"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorovat mezery (nezahrnovat znaky nových řádků)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorovat mezery na konci řádku"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorovat mezery na začátku řádku"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Pouze výběr"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
#, fuzzy
#| msgid "Open Diff in editor"
msgid "Open difference in editor"
msgstr "Otevřít Diff v editoru"

#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr "rozdílná jednotka %s nalezena na nové pozici \"%s\""

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Cifry:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Pokyny"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Pokyny pro novou jednotku"

#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr ""

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Adresář: "

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory \"%s\" not found."
msgstr "Adresář \"%s\" nenalezen."

#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "adresář %s nenalezen"

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Adresář není zapisovatelný"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Adresář, do nějž IDE dává soubory .po"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Zakázat vše ve stejném zdroji"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Zakázat Bod přerušení"

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Zakázáno"

#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Zakázat skupiny"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Zakázat I18N pro LFM"

#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr ""

#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr ""

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Jít na adresu"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Jít na adresu"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Jít na aktuální adresu"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Jít na aktuální adresu"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Zahodit změny"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Zahodit všechny změny"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Zahodit změny a otevřít projekt"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Zahodit změny a ukončit"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Zahodit změny, vytvořit nový projekt"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Ke zobrazení rozdílu klikněte na jednu z položek nahoře"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Chyba načítání souboru: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorovat změny na disku"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Znovu načíst z disku"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Některé soubory se na disku změnily:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Rozlišovat velká a malá písmena např. A a a"

#: lazarusidestrconsts.lisdlgadd
#, fuzzy
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Přidat ..."

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Všechny možnosti ..."

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Změnit třídu ..."

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Definice ..."

#: lazarusidestrconsts.lisdlgedit
#, fuzzy
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Upravit ..."

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exportovat ..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importovat ..."

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Otevřít ..."

#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Uložit ..."

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exist: %s"
msgstr "%s neexistuje: %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Neměnit"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Nezavírat projekt"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "nepřekládat závislosti"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Nezobrazovat úvodní obrázek při startu"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Nezobrazovat tento dialog pro tento projekt"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Neukazovat znova tuto zprávu"

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Dolů"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Ponížit"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Ponížit konfiguraci"

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Stále si přejete vytvořit nový projekt?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Stále si přejete otevřít jiný projekt?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Stále si přejete skončit?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Kreslit čáry mřížky"

#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Vykreslit výběr zaměřený, i když okno Zprávy není aktivní. Použijte, pokud vaše téma má těžce viditelné neaktivní vykreslení."

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Zkopírovat vybrané komponenty do schránky"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Vyjmout vybrané komponenty do schránky"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Přesunout komponentu o jedno dozadu"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Přesunout komponentu o jedno dopředu"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Přesunout komponentu dozadu"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Přesunout komponentu dopředu"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Vložit vybrané komponenty ze schránky"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Vybrat rodičovskou komponentu"

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Duplicitní"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Duplikovat záznam"

#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Duplicitní Soubor"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value \"%s\"."
msgstr "Nalezeno zdvojení hodnoty \"%s\"."

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Duplicitní jméno"

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, fuzzy
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Zdvojené jméno: Komponenta pojmenovaná \"%s\" již existuje ve zděděné komponentě %s"

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Duplicitní ppu soubor. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Zdvojit prohledávací cestu"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Duplicitní zdroje. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."

#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Duplicitní Jednotka"

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Upravit"

#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr ""

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Upravit kontextovou nápovědu"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Upravit nápovědu"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Upravit klávesu"

#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Barvy Editoru"

#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr "Typy souborů editoru"

#: lazarusidestrconsts.liseditormacros
msgid "Editor macros"
msgstr "Návrhář maker"

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Nahrát schéma"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Všechny balíčky"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuální projekt"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Všechny projekty"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "nastavit FPC režim na DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "nastavit FPC režim na FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "nastavit FPC režim na GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "nastavit FPC režim na MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "nastavit FPC režim na TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "nastavit IOCHECKS na"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "nastavit OVERFLOWCHECKS na"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "nastavit RANGECHECKS na"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "použít jednotku HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "použít jednotku LineInfo"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Nástroj pro úpravy"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Skrýt hlavní formulář"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Klávesa"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makra"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametry:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Jméno souboru programu:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Hledat zprávy FPC ve výstupu"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Hledat zprávy make ve výstupu"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Požadováno název a jméno souboru"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Pracovní složka:"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Všechno"

#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Prázdné metody"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Nalezeny prázdné metody:"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Žádná třída"

#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Žádná třída v %s(%s,%s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Pouze zveřejněné"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Veřejný"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Zveřejněné"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Odstranit metody"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Hledat v těchto sekcích tříd:"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Nelze zobrazit prázdné metody aktuální třídy, protože%s%s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Prázdné"

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Editovat vše"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Povolit vše ve stejném zdroji"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Povolit Bod přerušení"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Povoleno"

#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr ""

#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Aktivní příznak \"Use Unit\" jednotky %s v balíčku %s"

#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Povolit skupiny"

#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Zapnout I18N pro LFM"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Povolit internacionalizaci a podporu překladů"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Povolit makra"

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = replace whole identifier, Disable = replace prefix"
msgstr "Povolit = nahrazení celého identifikátoru, Zakázat = nahrazení prefixu"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Ohraničit"

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Uzavřít do $IFDEF"

#: lazarusidestrconsts.lisencodingnumberoffilesfailed
msgid "Number of files failed to convert: %d"
msgstr ""

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Kódování souboru \"%s\"%sna disku je %s. Nové kódování je %s."

#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Nekonečná smyčka v makrech"

#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr "Zadejte nové jméno makra \"%s\""

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Proměnná prostředí, jméno jako parametr"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Složka nenalezena"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Neplatný název souboru ladiče"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Soubor ladiče \"%s\" není spustitelný."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testovací složka \"%s\" nenalezena."

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Nesprávná volba na pozici %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Volba na pozici %d nepovoluje argument: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Volba na pozici %d potřebuje argument : %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Chyba: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Chyba vytváření souboru"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Chyba mazání souboru"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Chyba v %s"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Chyba ve jméně souboru překladače:"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Chyba ve vlastních nastaveních překladače (Ostatní):"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
#, fuzzy
#| msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Chyba ve vlastních nastaveních spojovače (Spojování / Předat volby spojovači):"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Chyba v \"Přidané cesty Ladiče\":"

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Chyba v prohledávaných cestách pro \"Zahrnuté souboru\":"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Chyba v prohledávaných cestách pro \"Knihovny\":"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Chyba v prohledávaných cestách pro \"Soubory objektů\":"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Chyba v prohledávaných cestách pro \"Ostatní zdroje\":"

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Chyba v prohledávaných cestách pro \"Ostatní soubory jednotek\":"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Chyba v \"výstupní adresář jednotek\":"

#: lazarusidestrconsts.liserrorinvalidbuildmode
#, fuzzy
#| msgid "ERROR: invalid build mode \"%s\""
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr "CHYBA: neplatný sestavovací mód \"%s\""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Chyba načítání souboru"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":"
msgstr "Chyba načítání souboru \"%s\":"

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Chyba načítání %s z%s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Chyba přesunu komponenty"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Chyba přesunu komponenty %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Chyba pojmenování komponenty"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Chyba otevírání komponenty"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Chyba analýzy komponentového proudu lfm."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Chyba načítání seznamu balíčků ze souboru%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Chyba načítání XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Chyba čtení XML souboru \"%s\"%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Chyba přejmenování souboru"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Chyby"

#: lazarusidestrconsts.liserrors2
#, fuzzy
#| msgid ", Errors:%s"
msgid ", Errors: %s"
msgstr ", Chyby:%s"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Chyba ukládání %s do %s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Chyba nastavení jména komponenty %s na %s"

#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Chyba zápisu do souboru \"%s\""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Chyba zápisu seznamu balíčků do souboru%s%s%s%s"

#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Vyhodnotit výraz"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "&Vyhodnocení"

#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "Vyhodnotit/Změnit"

#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Vyčistit události"

#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Volby záznamu událoastí ..."

#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Uložit události do souboru"

#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Přidat komentář ..."

#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Přidat komentář"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Každé n-té číslo řádku"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Ukázkový soubor:"

#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Sestavit všechny vybrané"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Příklady:%sIdentifikátor%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"

#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Otevřít první vybraný"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Upozornění výjimky Ladiče"

#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr "%s vyjmuto za běhu"

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude filter"
msgstr "Filtr vyřazení"

#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr "Spustitelný"

#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr "spustitelný soubor \"%s\" je složka"

#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr "spustitelný soubor \"%s\" postrádá oprávnění ke spuštění"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Vykonávání příkazu po"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Vykonávání příkazu před"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Vykonání zastaveno"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programy"

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Ukončit"

#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr "Exit kód %s"

#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Rozevřít vše (*)"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Rozevřít všechny třídy"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Rozevřít všechny balíčky"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Rozevřít všechny jednotky"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Úplné souborové jméno aktuálního souboru v editoru"

#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exportovat"

#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr ""

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exportovat jako HTML"

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportovat seznam"

#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Exportovat seznam balíčků (*.xml)"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Výraz:"

#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
#, fuzzy,badformat
#| msgid "Extend include file search path of package \"%s\" with\"%s\"?"
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr "Rozšiřit cestu pro hledání includů balíčku \"%s\" s \"%s\"?"

#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr "Rozšířit prohledávanou cestu include projektu s%s\"%s\"?"

#: lazarusidestrconsts.lisextendincludepath
#, fuzzy
#| msgid "Extend Include Path?"
msgid "Extend include path?"
msgstr "Rozšířit cestu pro hledání includů?"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Rozšířit cestu jednotky?"

#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
#, fuzzy,badformat
#| msgid "Extend unit search path of package \"%s\" with\"%s\"?"
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr "Rozšířit cestu pro hledání unit balíčku \"%s\" s \"%s\"?"

#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr "Rozšířit prohledávanou cestu jednotek projektu s%s\"%s\"?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Rozbalit"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Rozbalit proceduru"

#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Extrémně výřečný"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Vnější nástroje"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Dosažen max. počet nástrojů"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Toto je maximální počet nástrojů %s."

#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
msgid "Failed to add %d not unique resource(s)"
msgstr ""

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Selhalo vytváření Aplikačního balíku pro \"%s\""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Načtení stavu složení selhalo"

#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "selhalo řešení maker"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Uložení souboru selhalo."

#: lazarusidestrconsts.lisfatal
msgid "Fatal"
msgstr "Fatální"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Redukovat vykreslování návrháře"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
#, fuzzy
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Vykreslovat prvky návrháře pouze při nečinnosti (snižuje zatížení u pomalých počítačů)"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Soubor"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Soubor: "

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Soubor \"%s\"%snevypadá jako textový soubor.%sPřesto otevřít?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Přípona souboru programu"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtr souboru"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Souborové filtry"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Přidat řádek"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Smazat řádek"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Vložit řádek"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Maska souboru"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Nastavit předvolené"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Toto jsou souborové filtry, které se zobrazí v dialogu Otevřít souobor"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File \"%s\" has changed. Save?"
msgstr "Soubor \"%s\" byl pozměněn. Uložit?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Soubor nemá projekt"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Soubor je adresářem"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Soubor není spustitelný"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Soubor není zapisovatelný"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Soubor je symbolický odkaz"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File \"%s\" is virtual."
msgstr "Soubor \"%s\" je virtuální."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Chyba vazby souboru"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Jméno souboru/Adresa"

#: lazarusidestrconsts.lisfilenamestyle
#, fuzzy
#| msgid "Filename Style ..."
msgid "Filename Style"
msgstr "Styl Cest k Souborům ...."

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Soubor nenalezen"

#: lazarusidestrconsts.lisfilenotfound2
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "Soubor \"%s\" nenalezen."

#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "soubor %s nenalezen"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "soubor nenalezen"

#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr "Soubor nenalezen:%s%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Soubor \"%s\" nenalezen.%sChcete jej vytvořit?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Soubor není s malými písmeny"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Soubor není textový"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Nastavení souboru"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr "Soubor %s má neplatnou syntax."

#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Soubor: %s má proceduru Register: %s v sekci uses balíčku: %s"

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Všechny nalezené soubory již mají správné kódování ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Soubory v ASCII nebo v kódování UTF-8"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr "Soubor %s je převeden do textového formátu."

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Soubor, které nejsou v ASCII ani kódování UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "soubor, kam je zapisován ladící výstup. Pokud není uveden, ladící výstup je vypisován do konzoly."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtr"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtr: %s"

#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr ""

#: lazarusidestrconsts.lisfilterallmessagesoftype
msgid "Filter all messages of type %s"
msgstr "Filtrovat všechny zprávy typu %s"

#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Filtr už existuje"

#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtrovat zprávy 'debug' a níže"

#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtrovat zprávy 'hint' a níže"

#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Filtrovat zprávy 'Hint' bez polohy v kódu "

#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Nefiltrovat podle důležitosti"

#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Filtrovat nedůležité zprávy"

#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Filtrovat zprávy 'note' a níže"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Sady filtrů"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Filtrovat seznam dostupných možností."

#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Filtrovat zprávy 'verbose' a níže"

#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtrovat zprávy 'warning' a níže"

#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Hledat ..."

#: lazarusidestrconsts.lisfinddeclarationof
msgid "Find Declaration of %s"
msgstr ""

#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr ""

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Souborová maska"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Zahrnout podadresáře"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Víceřádkový vzor"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Pouze textové soubory"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "hledat všechny soubory v &projektu"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "hledat všechny &otevřené soubory"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr "hledat v aktivním souboru"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "hledat v &adresářích"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Kde"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Najít kombinaci kláves"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Hledat scházející jednotku"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "První"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Opravit LFM soubor"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Plovoucí čárka"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Tip při fokusu"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Vynutit přejmenování"

#: lazarusidestrconsts.lisfordarwin
msgid "For Darwin"
msgstr ""

#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr ""

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Formulář"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Chyba formátování"

#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr ""

#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Nalezena verze %s, očekávána %s"

#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr "chybí fpc.cfg"

#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr ""

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake selhal"

#: lazarusidestrconsts.lisfpcmessagefile
msgid "FPC message file"
msgstr "Soubor FPC zpráv"

#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr ""

#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr ""

#: lazarusidestrconsts.lisfpcresources
#, fuzzy
#| msgid "FPC resources"
msgid "FPC resources (.res)"
msgstr "Zdroje FPC"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Zdroje FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "Příliš staré FPC"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Verze FPC: "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Verze FPC (např. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Chyba zápisu \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Syntaktická chyba FPDoc"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Jméno balíčku FPDoc:"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Jméno balíčku FPDoc. Výchozí je jméno souboru projektu."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Syntaktická chyba v fpdoc elementu \"%s\":%s%s"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Rámec"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Hledat pozpátku"

#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr "uvolňování řádků zásobníku: %s"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Zprávy Free Pascal Compileru"

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Zdrojový adresář Free Pascalu"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Hleda&t dopředu"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Doplňující soubory k vyhledání (např. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Najít nebo přejmenovat identifikátor"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Najít odkazy"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifikátor: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "ve všech otevřených balíčcích a projektech"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "v aktuální jednotce"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "v hlavním projektu"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "v projektu/balíčku vlastnícím aktuální jednotku"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Neplatný identifikátor"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Přejmenovat všechny výskyty"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Přejmenovat na"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Hledat také v příkazech"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Kde hledat"

#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Celá cesta"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Funkce"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Obecné"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "získat slovo na aktuální pozici"

#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr ""

#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Přejít na řádek"

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Přejít na vybraný zdrojový řádek"

#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgstr ""
"<description>\n"
"Copyright (C) <rok> <jméno autora> <kontakt>\n"
"Tento zdrojový kód je svobodný program; můžete ho rozšiřovat a/nebo upravovat podle podmínek GNU Všeobecné veřejné licence, tak jak je zveřejněná Nadací Free Software; verze 2 licence nebo (podle svého rozhodnutí) jakékoliv pozdější verze.\n"
"Tento zdrojový kód je šířen v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez zahrnuté záruky PRODEJNOSTI nebo VHODNOSTI NA PŘÍSLUŠNÝ ÚČEL. Další detaily získáte v GNU Všeobecné veřejné licenci.\n"
"Kopie GNU Všeobecné Veřejné Licence je dostupná přes World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Můžete ji získat také napsáním do Nadace Free Software, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Skupina"

#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr "Přiřadit k existující skupině \"%s\"?"

#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "Žádné další body přerušení nejsou přiřazeny ke skupině \"%s\", má se smazat?"

#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr "%sExistuje %d dalších prázdných skupin, smazat všechny?"

#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "Jméno skupiny nemůže být prázdné. Vyčistit skupiny bodu přerušení?"

#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Jméno skupiny:"

#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "Jméno skupiny bodu přerušení musí být platný identifikátor Pascalu."

#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Nastavit novou skupinu ..."

#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Vyčistit skupiny"

#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Povolit nebo zakázat skupiny v ladicím výstupu. Platné volby jsou:"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Narůst na největší"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Má nápovědu"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Hlavičkový komentář pro třídu"

#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Nápověda"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Položky nápovědy"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Výběr nápovědy"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Šestnáctkový"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Nápověda pro zprávy překladače Free Pascalu"

#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Skrýt všechny 'hint' a 'warning' vložením IDE direktivy {%H-}"

#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Skrýt zprávu na %s vložením IDE direktivy {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Skrýt zprávu vložením IDE direktivy {%H-}"

#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Skrýt hledání"

#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr "Skrýt volbou balíčku (-vm%s)"

#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr "Skrýt volbou projektu (-vm%s)"

#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr "Tip"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Tip: přednastavená hodnota může být definována v podmíněných."

#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr ""

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Tip: Zkontrolujte, zda dva balíčky neobsahují jednotku se stejným jménem."

#: lazarusidestrconsts.lishints
#, fuzzy
#| msgid ", Hints:%s"
msgid ", Hints: %s"
msgstr ",Hintů:%s"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Uložit vše"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Vejít do"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Spustit do návratu z funkce"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Přejít přes"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Tip: Funkce \"Vytvořit Řetězec Zdrojů\" očekává řetězcovou konstantu.%sProsím vyberte výraz a zkuste znova."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Přepni Formulář/Jednotka"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Zobrazit formuláře"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Zobrazit jednotky"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Čítač"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databáze"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Volby nápovědy"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Vlastnosti:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Zobrazovače"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Cesta FPC Doc HTML"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontální"

#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr ""

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisidcadd
#, fuzzy
msgctxt "lazarusidestrconsts.lisidcadd"
msgid "Add"
msgstr "Přidat"

#: lazarusidestrconsts.lisidcopen
#, fuzzy
msgctxt "lazarusidestrconsts.lisidcopen"
msgid "Open"
msgstr "Otevřít"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Volby sestavení IDE"

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "IDE bude rekompilováno a restartováno během instalace/odinstalace balíčků."

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Vítejte v Lazarusu.%0:sNalezená Konfigurace IDE  byla dříve použita jinou instalací Lazarusu.%0:sPokud máte dvě a více oddělených instalací Lazarusu, tyto instalace by neměly sdílet stejnou konfiguraci. To by mohlo véct ke konfliktům a Vaše instalace Lazarusu by se mohly stát nestabilní.%0:s%0:sPokud máte pouze jednu instalaci a zkopírovanoý/přesunutý spustitelný soubor Lazarusu, můžet aktualizovat tuto konfiguraci.%0:s%1:s%0:s%0:sVyberte:%0:s%:s* Informace o aktualizaci: Použijte tuto konfiguraci a aktualizujte jipro budoucí použití s Lazarusem. Stará instalace ji nebude více používat.%0:s* Ignorovat: Použít tuto konfiguraci, ale ponechat upozornění. Toto může véct ke konfliktům s ostatními instalacemi.%0:s* Zrušit: Ukončit právě teď. Můžete potom vyřešit problém spuštěním Lazarusu se správnou konfigurací.%0:s%0:sDalší informace:%0:sTato konfigurace je pro: %2:s%0:sPatří instalaci Lazarusu v %3:s%0:s.Aktuální IDE bylo spuštěno z: %4:s%0:s"

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Vytvořit Makefile pro balíček %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Chyba: spuštění nástroje 'přeložit po' selhalo pro balíček %s"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informace o IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "VAROVÁNÍ: neplatné jméno jednotky %s, balíček=%s"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Makra IDE"

#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr ""

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identifikátor začíná s..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identifikátor obsahuje..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Volby IDE:"

#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr "Titulek IDE zobrazuje vybraný mód sestavení"

#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr "Titulek IDE zobrazuje složku projektu"

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Titulek IDE začíná názvem projektu"

#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Všechny režimy sestavení"

#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Volby překladače pro"

#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Aktuální režim sestavení"

#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Chyba při otevírání XML"

#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Chyba při otevírání XML souboru \"%s\":%s%s"

#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Exportovat Volby Překladače"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Exportovaný soubor existuje"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, fuzzy
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Exportovaný soubor \"%s\" existuje.%sOtevřít soubor a nahradit jen volby překladače?%s(Ostatní nastavení zůstanou zachována.)"

#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importovat Volby Překladače"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Načíst ze souboru"

#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr "Soubor \"%s\" neobsahuje volby překladače."

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Nedávné soubory"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Uložit soubor"

#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Pokud není zaškrtnuto:"

#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr ""

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, fuzzy
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Pokud chcete používat dvě rozdílné verze Lazarusu, musíte spustit druhou verzi s parametrem příkazové řádky primary-config-path nebo pcp. %sNapříklad:"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorovat vše"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorovat a pokračovat"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorovat binární"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorovat tento typ výjimky"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorovat, použít TForm jako předka"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Přizpůsobit odsazení aktuální jednotce, projektu nebo balíčku"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Komentář provedení pro třídu"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importovat"

#: lazarusidestrconsts.lisimportant
msgid "Important"
msgstr "Důležité"

#: lazarusidestrconsts.lisimportexport
msgid "Import / Export"
msgstr ""

#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr ""

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importovat seznam"

#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Importovat seznam balíčků (*.xml)"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Nemožné"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "Ve zdrojovém adresáři balíčku \"%s\"."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "Ve zdrojovém adresáři projektu. Ověřte duplicity."

#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr "Včetně všech podsložek"

#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr "Filtr zahrnutí"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "Cesta zahrnutí"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Cesty pro začleněné soubory"

#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr "Včetně podsložek"

#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ", nekompatibilní ppu=%s"

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Neplatná složka konfigurace nalezena"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Odsazení pro zdrojové texty pascalu"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Index"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informace"

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informace o %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informace o použitém FPC"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "V prohledávané cestě jednotek FPC. Zřejmě instalováno balíčkem FPC. Ověřte, zda překladač a soubory ppu jsou ze stejné instalace."

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Před související"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Zděděná položka"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Zděděné parametry"

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Zděděné komponenty projektu"

#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr ""

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, fuzzy
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Před vytvořením čisté kopie projektu/balíčku budou smazané všechny soubory v následujícím adresáři a veškerý jejich obsah bude ztracen.%sSmazat všechny soubory v \"%s\"?"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Vložit"

#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr ""

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "vložit datum"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "vložit datum a čas"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Vložit datum a čas. Volitelně: formátovací řetězec"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Vložit datum. Volitelně: formátovací řetězec"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "vložit konec pokud je třeba"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Vložit makro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Vložit jméno aktuální procedury"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Vložit značku PrintShort"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Vložit značku printshort"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "vložit hlavičku procedury"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "vložit jméno procedury"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "vložit čas"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Vložit čas, Volitelné: formátovaný řetězec"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Vložit značku url"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "V sezení"

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Zkoumat"

#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s : Class %s inherits from %s"
msgstr "%s: Třída %s dědí z %s"

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Data"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Prohlížeč ladění"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Metody"

#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr "Ukazatel na %s"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Vlastnosti"

#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr "Zobrazit sloupeček třídy"

#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr "Zobrazit sloupeček typu"

#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr "Zobrazit sloupeček viditelnosti"

#: lazarusidestrconsts.lisinspectunavailable
msgid "%s : unavailable"
msgstr "%s: nedostupné"

#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr "Instance"

#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr "Použít třídu instance"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Instalace selhala"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "nainstalováno"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Nainstalovat jej, mám to rád tučné"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Instalovat výběr"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Instalovat/Odinstalovat balíčky"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Místo překladu balíčku vytvořte jednoduchý Makefile."

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interaktivní"

#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr "vnitřní chyba: %s"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Neplatný povel"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Neplatné odebrání"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Neplatný výraz:%s%s%s%s"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Neplatný výraz.%sTip: Funkce \"Vytvořit Řetězce Zdrojů\" očekává řetězcovou konstantu v jediném souboru. Prosím vyberte výraz a zkuste znova."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Neplatný filtr"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Chybný řádek, sloupec ve zprávě%s%s"

#: lazarusidestrconsts.lisinvalidmacrosin
msgid "Invalid macros in \"%s\""
msgstr "Neplatná makra v \"%s\""

#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Neplatná makra \"%s\" v externím nástroji \"%s\""

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Neplatné makro \"%s\". Jméno makra musí být identifikátor pascalu."

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Neplatné jméno makra \"%s\". Jméno je klíčovým slovem."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Neplatná maska"

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Neplatný mód %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Neplatný vícenásobný výběr"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Neplatný (Vypnuto)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Neplatný (Zapnuto)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Neplatný Pascalovský identifikátor"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid Pascal identifier."
msgstr "Jméno \"%s\" není platný pascalovský identifikátor."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Neplatný název procedury"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Neplatné jméno projektu"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Neplatný adresář pro zveřejňování"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Neplatný výběr"

#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr "Neplatná verze v %s"

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s už je částí projektu."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, fuzzy
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" je chybné jméno projektu.%sProsím vyberte jiné (např. project1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s je %s.%sTato kruhová závislost není povolena."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "adresář nenalezen"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Záležitosti"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Jak se to mohlo stát? Chyba v %s:"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Jak se to mohlo stát? Chyba v hlavním adresáři:"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Historie skoků"

#: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s"
msgstr ""

#: lazarusidestrconsts.liskb
msgid "%s KB"
msgstr "%s KB"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Uchovat"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Uchovat převedené soubory otevřené v editoru"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Všechny soubory projektu budou po převodu otevřeny v editoru"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Uchovat v seznamu instalovaných"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Zachovat jméno"

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Zachovat relativní odsazení víceřádkové šablony"

#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Zachovat odsazení"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ponechat je a pokračovat"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Klávesa"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Vlastní příkazy"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Povely návrháře"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Příkazy inspektoru objektů"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Klávesa (nebo pořadí dvou kláves)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Přerušit sestavování"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Přidat adresu bodu přerušení"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Přidat zdroj bodu přerušení"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Přidat data/kukátko"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Přidat sledování"

#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr ""

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Sestavit projekt/program"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Vyberte schéma mapování kláves"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Vzor"

#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Vyčistit a sestavit"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Zavřít projekt"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor definic CodeTools"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Přeložit projekt/program"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Konfigurace \"Soubor sestavení\""

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Konfigurovat vlastní komponenty"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextová nápověda"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Převést Delphi balíček na Lazarus balíček"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Převést Delphi projekt na Lazarus projekt"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Převést Delphi jednotku na Lazarus jednotku"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Převést DFM soubor na LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Zkopírovat vybrané komponenty do schránky"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Vyjmout vybrané komponenty do schránky"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Odstranit poslední znak"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Rozdíl editovaných souborů"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Upravit šablony kódů"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Upravit kontextově citlivou nápovědu"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Zabalit výběr do bloku kódu"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Vyhodnocení/Upravení"

#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Ukázkový projekt"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Nastavení vnějších nástrojů"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Dopředné hledání"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Jít na značku 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Jít na značku 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Jít na značku 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Jít na značku 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Jít na značku 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Jít na značku 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Jít na značku 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Jít na značku 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Jít na značku 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Jít na značku 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Jít na editor zdroje 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Přejít na zdrojový editor 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Jít na editor zdroje 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Jít na editor zdroje 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Jít na editor zdroje 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Jít na editor zdroje 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Jít na editor zdroje 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Jít na editor zdroje 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Jít na editor zdroje 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Jít na editor zdroje 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Vložit datum a čas"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Vložte uživatelské jméno"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Zkoumat"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schéma mapování kláves"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (výchozí)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Max OS X(styl Apple)"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Max OS X (styl Lazarus)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nový balíček"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nový projekt"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nový projekt ze souboru"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nová jednotka"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Poznámka: Všechny klávesy budou nastaveny na hodnoty vybraného schéma."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Otevřít soubor balíčku"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Vložit komponenty ze schránky"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pozastavit program"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Zveřejnit projekt"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Rychlý překlad, bez spojování"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Odstranit aktivní soubory z projektu"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Spustit program"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "UložitVše"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "UložitJako"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Uložit projekt"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Uložit projekt jako"

#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Vybrat ke konci řádku"

#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Vybrat k začátku řádku"

#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Vybrat po konec stránky"

#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Vybrat po začátek stránky"

#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Vybrat slovo nalevo"

#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Vybrat slovo napravo"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Nastavit volnou záložku"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Nastavit značku 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Nastavit značku 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Nastavit značku 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Nastavit značku 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Nastavit značku 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Nastavit značku 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Nastavit značku 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Nastavit značku 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Nastavit značku 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Nastavit značku 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Zastavit program"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Přepnout mezi Jednotkou a Formulářem"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Přepnout značkovač 0"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Přepnout značkovač 1"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Přepnout značkovač 2"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Přepnout značkovač 3"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Přepnout značkovač 4"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Přepnout značkovač 5"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Přepnout značkovač 6"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Přepnout značkovač 7"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Přepnout značkovač 8"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Přepnout značkovač 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Zobrazit Assembler"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Zobrazit body přerušení"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Zobrazit Zásobník volání"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Přepnout zobrazení Prohlížeče kódu"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Přepnout zobrazení Průzkumníku kódu"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Přepnout zobrazení palety komponent"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Zobrazit Záznam událostí ladiče"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Zobrazit Ladící výstup"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Přepnout zobrazení Editoru dokumentace"

#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Zobrazit historii"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Přepnout zobrazení Rychlých tlačítek IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Zobrazit Místní proměnné"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Přepnout zobrazení Zpráv"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Přepnout zobrazení Inspektoru objektů"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Terminal Output"
msgstr "Zobrazit výstup terminálu"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Zobrazit Registry"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Přepnout zobrazení Výsledků hledání"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Přepnout zobrazení Zdrojového editoru"

#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Zobrazit vlákna"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Zobrazit Sledování"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Zobrazit historii skoků"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Zobrazit nastavení projektu"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Zobrazit zdroj projektu"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Zobrazit informace o jednotce"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Neplatné spouštění aplikace"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Spouštění cílové příkazové řádky"

#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus Výchoí"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Nastavení plochy Lazarusu"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Složka Lazarusu"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "adresář, který bude použit jako základový"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus file"
msgstr "Soubor Lazarusu"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Formulář Lazarusu"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Zahrnutý soubor Lazarusu"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID jazyka Lazarusu (např. en, de, br, cz)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Jméno jazyka Lazarusu (např. angličtina, čeština)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [volby] <jméno-projektu>"

#: lazarusidestrconsts.lislazarusotherfile
msgid "Lazarus other file"
msgstr "Jiný soubor Lazarusu"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Balíček Lazarusu"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Projekt Lazarusu"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Informační soubor projektu Lazarusu"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Zdrojový soubor Lazarusu"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Jednotka Lazarusu"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Akce"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Vybrat výstupní adresář spustitelných souborů IDE "

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Jste si jisti smazáním tohoto sestavovacího profilu?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Sestavit více"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Společná nastavení"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Potvrdit před sestavením"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Potvrdit smazání"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Ladit IDE"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definice"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definice bez -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Upravit definice"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Upravit seznam definic použitelných libovolným profilem"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisování souboru"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild není interaktivní, nyní přerušuji."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Úprava sestavovacích profilů"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Upravit profily"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Jméno aktivního profilu"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Přidat nový profil"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Současné sestavovací volby budou spojeny s:"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Normální IDE"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Optimalizované IDE"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Nastavení:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Volby předané překladači"

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Profil k sestavení"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Přejmenovat profil"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nové jméno profilu:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Restartovat po sestavení IDE"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Automaticky restartovat Lazarus po sestavení IDE (nemá vliv na sestavení jiných částí)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Vybrat profily k sestavení"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Zobrazit potvrzovací dialog při sestavování přímo z menu Nástroje"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Zobrazit volby a definice pro příkazový řádek"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cílové CPU"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cílový adresář:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Cílový OS:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Nelze zapisovat do souboru \"%s\":%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aktualizovat revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Aktualizovat informace o revizi v dialogu \"O Lazarusu\""

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Vyčistit + Sestavit vše"

#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Verze Lazarusu (př. 1.2.4)"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Typ LCL Widgetu"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Přidat odkaz ke zděděnému"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Kopírovat ze zděděného"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s nemá platnou cestu FPDoc.%sNelze vytvořit fpdoc soubor pro %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Přesunout položky do zděděného"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Neplatná cesta FPDoc"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Jednotka %s není vlastněna žádným balíčkem nebo projektem.%sProsím přidejte jednotku do balíčku nebo projektu.%sNelze vytvořit soubor fpdoc."

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Vlevo"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Levý okraj. Tato hodnota je přidaná k základnímu okraji a použitá pro mezeru vlevo od prvku."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Levé ukotvení"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož levé straně je ukotvený. Ponechte prázdné pro rodiče."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Levé strany"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Shodná levá vzdálenost"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Méně"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Úrovně"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Soubor LFM"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "LFM soubor obsahuje neznámé vlastnosti/třídy které neexistují v LCL. Mohou být nahrazeny nebo smazány."

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Poškozený soubor LFM"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM je v pořádku"

#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgstr ""
"<popis>\n"
"Copyright (C) <rok> <jméno autora> <kontakt>	Tato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat za podmínek GNU Library General Public License, tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze.\n"
"Tento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOIV ZÁRUKY; dokonce i bez záruky PRODEJNOSTI anebo PRO PŘÍŠLUŠNÝ ÚČEL. Další podrobnosti najdete v GNU Library General Public License.\n"
"Kopii GNU Library General Public License by jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "cesta knihovny"

#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr "Sdílená knihovna Free Pascalu (.dll ve Windows, .so v Linuxu, .dylib v MacOS X)."

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Řádek:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Řádek/Délka"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Odkaz:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "volby spojovače"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Cíl odkazu"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "seznam všech případných hodnot"

#: lazarusidestrconsts.lisloadedsuccessfully
msgid "Loaded successfully"
msgstr "Úspěšně nahráno"

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Načítání %s selhalo."

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Nahrát makro z"

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Místní"

#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "Kopírovat jméno"

#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "Kopírovat hodnotu"

#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Lokální nejsou vyhodnoceny"

#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Zaznamenat volání zásobníku"

#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(limit rámců, 0 - bez limitu)"

#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Vyhodnotit výraz"

#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Zpráva záznamu"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "řetězec malými písmeny"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Řetězec malými písmeny daný jako parametr"

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk zmizel z disku. Použiji alternativu %s"

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk chybí"

#: lazarusidestrconsts.lislrsincludefiles
#, fuzzy
#| msgid "lrs include files"
msgid "Lazarus resources (.lrs) include files"
msgstr "zahrnuté soubory lrs"

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Makro %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Zadejte údaje"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Zadejte spouštěcí parametry"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main unit has Application.CreateForm statements"
msgstr "Hlavní jednotka obsahuje Application.CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main unit has Application.Title statements"
msgstr "Hlavní jednotka obsahuje Application.Title"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Hlavní jednotka má v sekci Uses všechny jednotky projektu"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Hlavní jednotka je Zdrojový kód Pascalu"

#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr ""

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Vytvořit spustitelný"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Nenalezen Make"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Vytvořit ResourceString"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Doplnit k sekci"

#: lazarusidestrconsts.lismakeresstrchooseanothername
#, fuzzy
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring \"%s\" již existuje.%sProsím vyberte jiný název.%sPoužijte Ignorovat pokud chcete i tak přidat."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Volby převodu"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Vlastní identifikátor"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Délka identifikátoru:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Předpona identifikátoru:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Vlož podle abecedy"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Vložit závislé na kontextu"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Neplatná sekce Resourcestring"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Prosím vyberte sekci resourcestring ze seznamu."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring již existuje"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sekce zdrojových řetězců:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Náhled zdroje"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Konstantní řetězec ve zdroji"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Řetězec se stejnou hodnotou:"

#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr ""

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Spravovat editory zdrojových kódů ..."

#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
msgstr ""

#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr ""

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Max %d"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Možná musíte znovu přeložit balíček."

#: lazarusidestrconsts.lismb
msgid "%s MB"
msgstr "%s MB"

#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Akce"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Výpis paměti"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Přerušit sestavení"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "O FPC"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Přidat bod přerušení"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Přidat aktivní soubor do balíčku ..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Přidat bod skoku do historie"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Přidat editovaný soubor do projektu"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Přidat sledování ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Zalomit řádky ve výběru"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Sestavit soubor"

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Sestavit Lazarus s aktuálním profilem"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr "Sestavit Lazarus s profilem: %s"

#: lazarusidestrconsts.lismenubuildmanymodes
msgid "Build many Modes ..."
msgstr ""

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Zkontrolovat soubor LFM v editoru"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Vyčistit adresář ..."

#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr ""

#: lazarusidestrconsts.lismenucloseall
msgid "Close A&ll"
msgstr "Zavřít &vše"

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "Zavřít soubor editoru"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Zavřít projekt"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Editor definic pro CodeTools ..."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Zakomentovat výběr"

#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr ""

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Dokončení kódu"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Nastavit soubor pro Sestavení+Spuštění ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Konfigurovat vlastní komponenty ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Nastavit vnější nástroje ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Nastavení \"Sestavení Lazarusu\" ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextová nápověda"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Převést Delphi balíček na Lazarus balíček ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Převést Delphi projekt na Lazarus projekt ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Převést Delphi jednotku na Lazarus jednotku ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Převést binární DFM na textový LFM + zkontrolovat syntaxi ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Převést kódování projektů/balíčků ..."

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Ladící okna"

#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Delphi Konverze:"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editace"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Šablony kódu..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Upravit kontextově citlivou nápovědu"

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Instalovat/Odinstalovat balíčky ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor ..."
msgstr "Editor menu ..."

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Vytvořit podmenu"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template ..."
msgstr "Odstranit ze šablony ..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Odstranit položku"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Obsloužit událost OnClick"

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template ..."
msgstr "Vložit z šablony ..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Vložit novou položku (za)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Vložit novou položku (před)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Posunout dolů (nebo vpravo)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Posunout nahoru (nebo vlevo)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description ..."
msgstr "Nový popis šablony ..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template ..."
msgstr "Uložit jako šablonu ..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Vyberte menu:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Vyberte šablonu:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Náhled šablony"

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Uzavřít v $IFDEF ..."

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Obklopit výběr ..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Vyhodnocení/Upravení ..."

#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Ukázkové projkety ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Vyjmout proceduru ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Soubor"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Najít"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Hledat ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Najít odpovídající konec bloku kódu"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Najít začátek bloku kódu"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Najít deklaraci na pozici kurzoru"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Najít odkazy na identifikátor ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Najít &v souborech ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Najít &Další"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Najít &Předchozí"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Najít Reference Použité Unity"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Nastavení ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Jít na směrnici pro zahrnutí souboru"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Přejít na řádek ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Odhadnout chybně umístěný IFDEF/ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Odhadnout neuzavřený blok"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Nápověda"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Vnitřek IDE"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Přírůstkové hledání"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Odsadit výběr"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Položka Poznámek k vydání"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Vložit z mapy znaků ..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Vložit klíčové slovo CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Datum a čas"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Vložit plné jméno souboru ..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Vložit obecné"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "GPL Poznámka"

#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "GPL Poznámka (přeloženo)"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "LGPL Poznámka"

#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "LGPL Poznámka (přeloženo)"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "MIT Poznámka"

#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "MIT Poznámka (přeloženo)"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Upravená LGPL Poznámka"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Upravená LGPL Poznámka (přeloženo)"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Uživatelské jméno"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Zkoumat ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump Back"
msgstr "Skočit zpět"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump Forward"
msgstr "Skočit vpřed"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Skočit na"

#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Skočit na implementaci"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Skočit na další značku"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Skočit na následující chybu"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Skočit na předchozí značku"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Skočit na předchozí chybu"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Změnit výběr na malá písmena"

#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr "Návrhář maker ..."

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Vytvořit zdrojový řetězec ..."

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nová komponenta"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nový formulář"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nový ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Nový balíček ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nový projekt ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Nový projekt ze souboru ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nová jednotka"

#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&OK"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online nápověda"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Otevřít ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Otevřít jméno souboru na pozici kurzoru"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Otevřít načtený balíček ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Otevřít soubor balíčku (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Otevřít balíček aktuální jednotky"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Otevřít projekt ..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Otevřít &nedávné"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Otevřít nedávný balíček"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Otevřít nedávný projekt"

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "&Balíček"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Graf balíčku"

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Odkazy balíčku ..."

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Nová komponenta balíčku"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Seznam procedur..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor projektu"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Volby projektu ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Spustit"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Vydat projekt..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Rychlý překlad"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Rychlá kontrola syntaxe"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Rychlá kontrola syntaxe OK"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Odebrat z projektu..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Přejmenovat identifikátor"

#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Nahlásit chybu"

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Znovu projít zdrojový adresář FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Resetovat ladící nástroj"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Navrátit"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Spustit"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Spustit soubor"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Spustit s parametry ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Step over to &Cursor"
msgstr "Spustit po ukazatel"

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Uložit"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Uložit &jako..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Uložit projekt"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Uložit projekt jako..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Hledat"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Vybrat"

#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Vybrat vše"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Vybrat blok kódu"

#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Vybrat řádek"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Vybrat odstavec"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Vybrat po závorku"

#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Vybrat slovo"

#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Nastavit volnou záložku"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Ukázat bod vykonávání"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Seřadit výběr ..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "Zdroje"

#: lazarusidestrconsts.lismenustepinto
msgid "Step In&to"
msgstr "Vejít do"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr "Krok dovnitř (Kontext)"

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Krok do instrukce"

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Krok do instrukce"

#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr "Vyjít ven"

#: lazarusidestrconsts.lismenustepover
msgid "&Step Over"
msgstr "Přejít přes"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr "Krok přes (Kontext)"

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Krok přes instrukci"

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Krok přes instrukci"

#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Zaměnit velikost znaků ve výběru"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Tabulátory na mezery ve výběru"

#: lazarusidestrconsts.lismenutemplateabout
#, fuzzy
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "O aplikaci"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Obsah"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Normální menu Editace"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Normální menu Soubor"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Normální menu Nápověda"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Najít"

#: lazarusidestrconsts.lismenutemplatefindnext
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
msgid "Find Next"
msgstr "Najít další"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Otevřít nedávné"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Cvičení"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Zakomentovat / odkomentovat výběr"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Nástroje"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Odkomentovat výběr"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Zrušit odsazení výběru"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Změnit výběr na velká písmena"

#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Přidat jednotku do sekce uses ..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Zobrazení"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Editor kotev"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Body přerušení"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Zásobník volání"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Prohlížeč kódu"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Paleta komponent"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenty"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Záznam událostí"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Ladící výstup"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Formuláře ..."

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Historie"

#: lazarusidestrconsts.lismenuviewidespeedbuttons
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE Speed Buttons"
msgstr "Rychlá tlačítka IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Historie skoků"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Místní proměnné"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Zprávy"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspektor objektů"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "Zobrazit zdroj projektu"

#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr "Výstup terminálu"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registry"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Prohlížeč omezení"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Výsledky hledání"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Pořadí záložek"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Vlákna"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Přepnout zobrazení formulář/jednotka"

#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Závislosti jednotky ..."

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Informace jednotky ..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Jednotky ..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Sledování"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Co vyžaduje sestavení"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Okno"

#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Jiný list"

#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Projekty"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor zpráv"

#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Okno zpráv"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Třída metody nenalezena"

#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr "chybějící složka \"%s\""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Chybějící události"

#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr "chybějící spustitelný soubor \"%s\""

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Chybějící identifikátory"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Chybějící balíčky"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Vaše volby jsou:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Zakomentovat"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Pouze pro Delphi"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Zakomentovat vybrané jednotky"

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Použít jednotky pouze pro Delphi."

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Vyhledat jednotky. Nalezené cesty přidat do nastavení projektu."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Nyní přerušit, instalovat balíčky nebo opravit cesty a pokusit se znova."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Cesta jednotek projektu"

#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Přeskočit tuto jednotku"

#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""
"<description>\n"
"Copyright (c) <year> <copyright holders>\n"
"Tímto je zde deklarováno povolení, bezplatně a jakékoli osobě zaopatřit si kopii tohoto software a asociované dokumentace (dále \"Software\"), využívat Software bez omezení, včetně neomezenosti práv k užívání, kopírování, úpravám, slučování, publikování, distribuování, sublicencování a/nebo k prodeji kopií Software. Software je předmětem následujících podmínek:\n"
"Předcházející oznámení o copyrightu a toto oznámení o povolení musí být přítomny ve všech kopiích nebo podstatných částech Software.\n"
"SOFTWARE JE POSKYTOVÁN \"JAK JE\", BEZ JAKÉKOLI ZÁRUKY, PŘÍMÉ ČI ODVOZENÉ, VČETNĚ, ALE BEZ OMEZENÍ NA ZÁRUKY PRODEJNOSTI, VHODNOSTI PRO PŘÍSLUŠNÝ ÚČEL A NEPORUŠENÍ DUŠEVNÍHO VLASTNICTVÍ. V ŽÁDNÉM PŘÍPADĚ NENESOU AUTOŘI NEBO DRŽITELÉ OPRÁVNĚNÍ ZODPOVĚDNOST ZA JAKÉKOLI NÁROKY. ŠKODY NEBO JINÉ ZÁVAZKY, AŤ JIŽ NA ZÁKLADĚ SMLOUVY, PORUŠENÍ NEBO JINAK, VYPLÍVAJÍCÍ ZE SPOJITOSTI SE SOFTWAREM, JEHO POUŽÍVÁNÍM NEBO JINÝM NAKLÁDÁNÍM S NÍM.\n"
"(poznámka překladatele: tento překlad je nezávázný, závazný je anglický originál!)\n"

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Přídavky a přepisy"

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Přídává vlastní možnosti:"

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Připojit volitelné volby fpc, například: -O1 -ghtl -dFlag."

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Aplikovat na všechny balíky."

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Aplikovat na všechny balíky a projekty."

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr "Aplikovat na všechny balíky odpovídající názvu \"%s\""

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Aplikovat na projekt."

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Vytvořit novou skupinu voleb."

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Vlastní volba"

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Odstranit vybraný cíl nebo možnost."

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Nepřidávat vlastní možnosti:"

#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr "Nemá IDE Makro %s:=%s"

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Nepřepisovat OutDir (-FU)"

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr "Vyloučit všechny balíky odpovídající názvu \"%s\""

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name, but found \"%s\""
msgstr "očekáváno \":=\" po jménu makra, nalezeno \"%s\""

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name, but found \"%s\""
msgstr "očekáváno jméno makra,  nalezeno \"%s\""

#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr "Z %s na %s"

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "IDE Makro"

#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr "IDE Makro %s:=%s"

#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr "neplatný znak \"%s\" @ %s"

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr "neplatný znak v hodnotě makra \"%s\""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "chybějící jméno makra"

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgid "Move selected item down"
msgstr "Posunout vybranou položku dolů"

#: lazarusidestrconsts.lismmmoveselecteditemup
msgid "Move selected item up"
msgstr "Posunout vybranou položku nahodu"

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Nový cíl"

#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr "Přepsat OutDir (-FU): %s"

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Přepsat výstupni složku (-FU)"

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Přepsat výstupní složku -FU cíle"

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Odvolat poslední <Zpět> této tabulky"

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Nastavit IDE Makro, např.: LCLWidgetType:=win32"

#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr "Nastavit \"%s\""

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Uloženo v IDE (environmentoptions.xml)"

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Uloženo v projektu (.lpi)"

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Uloženo v sezení projektu (.lps)"

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Cíle:"

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Vrátit poslední změnu této tabulky"

#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr "Hodnota \"%s\""

#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr "(byl \"%s\")"

#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ""

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
msgstr ""
"<popis>\n"
"Copyright (C) <rok> <jméno autora> <kontakt>\n"
"Tato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat podle ustanovení GNU Library General Public License tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze s následujícími úpravami:\n"
"Jako speciální výjimka, vlastníci autorského práva této knihovny Vám dovolují připojit tuto knihovnu s nezávislými moduly, za účelem vytvoření programů, pričemž nezávisí na licenci těchto nezávislých modulů, kopírovat a distribuovat výsledné programy za podmínek poskytnutých podle Vašeho rozhodnutí, které se můžou líšit pro každý nezávislý modul. Nezávislý modul je modul, který není odvozený nebo založený na této knihovně. Pokud upravujete tuto knihovnu, můžete rozšířit tuto výjimku pro svojí verzi knihovny, ale není to Vaše povinnost. Pokud to nechcete udělat, smažte tuto výjimku ze své verze.\n"
"Tento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez záruky PRODEJNOSTI nebo VHODNOSTI PRO PŘÍSLUŠNÝ ÚČEL. Další podrobnosti najdete v GNU Library General Public License.\n"
"Kopi GNU Library General Public License by jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Pozměnit"

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Více"

#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More >>"
msgstr "Více >>"

#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Přesunout"

#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Přesunout Soubory"

#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Přesunout soubory?"

#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, fuzzy
#| msgid "Move %s file(s) from %s to the directory%s%s%sof %s."
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Přesun %s soubor(ů) z %s  do složky%s%s%sz %s"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Posunout \"%s\" o jednu pozici dolu"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Posunout \"%s\" o jednu pozici nahoru"

#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Přesunout nebo Kopírovat soubory?"

#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, fuzzy
#| msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s."
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Přesun nebo kopírování %s soubor(ů) z %s do složky%s%s%sz %s"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Přesunout stránku"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Přesunout vybranou položku dolu (Ctrl+Dolu)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Přesunout vybranou položku nahoru (Ctrl+Nahoru)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Přesunout do: "

#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Přesunt těchto unit rozbije jejich sekce uses. Podívej se do okna Zprávy pro více informací."

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"

#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr ""

#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ""

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Uložit zprávy do souboru (*.txt)"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Jméno"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Konflikt jmen"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Jméno aktivního režimu sestavení"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Jméno nové procedury"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nikdy"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nový"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nová třída"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nová konzolová aplikace"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Vytvořit nový editovaný soubor.%sVyberte typ."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Vytvořit prázdný textový soubor."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Vytvořit nový projekt.%sVyberte typ."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Vytvořit nový vzorový balíček.%sBalíček je sada jednotek a komponent."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Vytvořit novou jednotku s datovým modulem."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Vytvořit novou jednotku s rámcem."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Vytvořit novou jednotku s formulářem LCL."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Zdědit z formuláře projektu nebo komponenty"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nevybrány žádné položky"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Prosíme nejdříve vyberte položku."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nové kódování:"

#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr "Makro %d"

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Nové jméno makra"

#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr ""

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nový projekt)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Nově nahrané makro. Nebude uloženo"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Nové jednotky jsou přidány do sekcí uses"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Ne"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Nezálohovat soubory"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Není zvolen žádný profil k sestavení."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Žádné změny"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nevybraný žádný kód"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nezděděny žádné volby překladače."

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "žádný tip"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nevybráno žádné okno IDE"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Žádný soubor LFM"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Žádné vybrané makro"

#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr ""

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "bezejmenný"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sžádný"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "žádný, klikněte pro výběr jednoho"

#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "žádný uzel nevybrán"

#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Žádný pascalovský soubor"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file \"%s\" found."
msgstr "Nenalezen žádný programový soubor \"%s\"."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nenalezen žádný výběr ResourceStringu"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Obyčejně je filtr regulární výraz. V jednoduché syntaxi je . obyčejný znak, * znamená cokoliv, ? znamená jakýkoliv znak a čárka a středník oddělují varianty. Např. Jednoduché syntaxi *.pas;*.pp odpovídá ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenalezeny žádné konstantní řetězce."

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Není balíčkem doby návrhu"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Není instalovatelný balíček"

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr "Neplatný pascalovský identifikátor"

#: lazarusidestrconsts.lisnote
msgid "Note"
msgstr "Poznámka"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Dolní"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Vlevo"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Vpravo"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Nahoře"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Free Pascalu"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Lazarusu"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "není vybrána žádné šablona"

#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr "%s nenalezen v %s na řádku %s, sloupec %s.%sMožná je zpráva neaktuální."

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Doposud neimplementováno"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Zatím neimplementováno:%s%s"

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "nenainstalováno"

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nyní ne"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Nyní nahráváno: "

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Vytvořit"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Vytvořit nový projekt"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Počet souborů k převodu: %s"

#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr ""

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - výchozí"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "cesta objektu"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Přepnout na záložku Oblíbené v Inspektoru Objektů"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Vypnuto)"

#: lazarusidestrconsts.lisofpackage
msgid " of package %s"
msgstr "balíčku %s"

#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr "Průzkumníka Projektu"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Přidat k oblíbeným vlastnostem"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Zvolte základní třídu oblíbených vlastností \"%s\"."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class \"%s\" not found."
msgstr "Třída \"%s\" nenalezena,"

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Odebrat z oblíbených vlastností"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automaticky instaluj dynamické"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "automaticky instaluj statické"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Popis:  "

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sPopis:  %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Jméno souboru: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "instalováno dynamicky"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "instalováno staticky"

#: lazarusidestrconsts.lisoiplicenselicense
msgid "%sLicense:  %s"
msgstr "%sLicence: %s"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "chybějící"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "změněný"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Otevřít načtený balíček"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Jméno balíčku"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Prosím vyberte balíček"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "pouze pro čtení"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Stav"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen"

#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Stará třída"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Zapnuto)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Při zalomení řádku (tj. klávesa Enter)"

#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr ""

#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr ""

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hledat pouze celá slova"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Při vložení ze schránky"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Otevřít"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Otevřít jako XML soubor"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Otevřít návrháře při otevření jednotky"

#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr ""

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Otevřít existující soubor"

#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Otevřít soubor"

#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Otevřít soubor"

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Otevřít %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Otevřít balíček?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Otevřít balíček %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Otevřít soubor projektu"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Otevřít projekt?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Otevřít projekt"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Otevřít projekt znovu"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Otevřít soubor projektu"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Otevřít symbolický odkaz"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Otevřít cíl"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Otevřít soubor jako normální zdrojový soubor"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Otevřít balíček %s?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Otevřít projekt %s?"

#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr ""

#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr ""

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Otevřít XML"

#: lazarusidestrconsts.lisoptions
#, fuzzy
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Volby"

#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Volby změněny, čisté překládání s -B"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "nebo"

#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ""

#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgstr "jiná zdrojová cesta balíčku \"%s\" obsahuje složku \"%s\", která je už v cestě pro hledání unit. "

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varianty se podívejte na soubory ve složce jazyků."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%spřepíše výchozí překladač. např. ppc386 ppcx64 ppcppc aj. výchozí je uložen v environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr "%spřepíše sestavovací mód projektu nebo IDE."

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%spřepíše cpu projektu. např. i386 x86_64 powerpc powerpc_64 aj. výchozí: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%spřepíše operační systém projektu. např. win32 linux. výchozí: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%spřepíše sadu widgetů projektu. např. gtk gtk2 qt win32 carbon. výchozí: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Přepsat soubor?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Přepsat soubor na disku"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' je již použit v TReader/TWriter. Prosím, zvolte jiné jméno"

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Balíček"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "balíček %s"

#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ", balíček %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Informace balíčku"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Jméno balíčku začíná s..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Jméno balíčku obsahuje..."

#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr ""

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Balíček vyžaduje instalaci"

#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr "Balíček \"%s\" Volba"

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Výstupní adresář balíčků"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Zdrojový adresář balíčků"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "jednotka balíčku"

#: lazarusidestrconsts.lispage
msgid "Page"
msgstr "Strana"

#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr ""

#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr ""

#: lazarusidestrconsts.lispanic
msgid "Panic"
msgstr "Panika"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", zanalyzovný "

#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr "parser \"%s\":%s"

#: lazarusidestrconsts.lispascalfile
msgid "Pascal file"
msgstr "Soubor Pascalu"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Počet průchodů"

#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Vložit"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "vložit schránku"

#: lazarusidestrconsts.lispastefromclipboard
msgid "Paste from clipboard"
msgstr ""

#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr ""

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Cesta"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Procházet"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Smazat neplatné cesty"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Posunout cestu dolů (Ctrl+Dolů)"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Posunout cestu nahoru (Ctrl+Nahoru)"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Přidat novou cestu do seznamu"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Smazat vybranou cestu"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Odstranit neexistující (šedé) cesty ze seznamu"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Nahradit vybranou cestu novou cestou"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Přidat šablonu do seznamu"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Šablony cest"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Hledat cesty:"

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "cesta instantfpc cache"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Cesta nástroje make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Cesta ke špatné instanci:"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pozastavit"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Vyčistit pro použití jména balíčku"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Zakázat I18N v lfm"

#: lazarusidestrconsts.lispckeditaddfiles
msgid "Add files from the file system"
msgstr ""

#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr ""

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Přidat do projektu"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Použít změny"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Volání %sRegistr%s procedura vybrané jednotky"

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Vyčistit závislosti ..."

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Vyčistit přednastavené/preferované jméno souboru závislosti"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Přeložit vše?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompilovat balíček"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Volby překladače pro balíček %s"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Vytvořit fpmake.pp"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Vytvořit Makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, standardně: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Vlastnosti závislosti"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Upravit obecné nastavení"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Vlastnosti souboru"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalovat"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Instalovat balíček do IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Neplatná maximální verze"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Neplatná minimální verze"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximální verze:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimální verze:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Změněný: %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Posunout závislost dolů"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Posunout závislost nahoru"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Balíček %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Balíček \"%s\" byl změněn.%sUložit balíček?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "balíček %s nenalezen"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s,Stránka: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Znovu přidat závislost"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Znovu přidat soubor"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Pouze pro čtení: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Znovu přeložit vše potřebné"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Znovu přeložit načisto"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Znovu přeložit tento a všechny požadované balíčky?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrované zásuvné moduly"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registrovat jednotku"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Odstranit závislost"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Odstranit závislost?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Odstranit závislost \"%s\"%sz balíčku \"%s\"?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Odstraněné soubory"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Odstranit požadované balíčky"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Odstranit soubor"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Odstranit soubor?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Odstranit soubor \"%s\"%sz balíčku \"%s\"?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Odstranit vybrané položky"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Požadované balíčky"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Uložit balíček"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Uchovat jméno souboru jako předvolené pro tuto závislost"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Uchovat jméno souboru jako preferované pro tuto závislost"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, fuzzy
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maximální verze \"%s\" není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, fuzzy
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimální verze \"%s\" není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Odinstalovat"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Zobrazit zdroj balíčku"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Základní, nelze odinstalovat"

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Instalováno"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalovat při dalším spuštění"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStav: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Odinstalovat při dalším spuštění (pokud není vyžadován  instalovaným balíčkem)"

#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Odinstalovat balíček %s"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Přidat volby do závislých balíčků a projektů"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Přidat cesty do závislých balíčků/projektů"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Autor"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automaticky znovu sestavit podle potřeby"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automaticky znovu sestav pokud znovu sestavení všeho"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Vlastní"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Popis / obsah"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Čas návrhu"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Doba návrhu a doba běhu"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrace IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Zahrnout"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Neplatný typ balíčku"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Knihovna"

#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licence"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Spojovací program"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Hlavní"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ruční překlad (nikdy automaticky)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minoritní"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objekt"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Nastavení balíčku"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Typ balíčku"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Poskytuje"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Uvolnění"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Čas běhu"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, fuzzy
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Balíček \"%s\" má příznak autoinstalace.%sTo znamená, že bude instalován do IDE. Instalované balíčky%smusí být návrhové."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Tento balíček poskytuje to samé jako následující balíčky:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Aktualizovat / Znovu sestavit"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Použití"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Balíček:"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Prohledávané cesty XML souborů pro fpdoc. Více cest musí být odděleno středníkem."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Zobrazit neukončené závislosti"

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Když je formulář uložen, IDE může uložit všechny vlastnosti TTranslateString do \"po\" souboru balíčku. K tomu je nutné povolit I18N pro tento balíček, zadat výstupní adresář \"po\" souboru a ponechat tuto volbu nezatrženou."

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Přerušit"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Průběh"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Sbalit adresář"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Nalezen konflikt"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Upravit virtuální jednotku"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Rozbalit adresář"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Jméno souboru:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Opravit velikost písmen souborů"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Neplatné jméno souboru jednotky"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Neplatné jméno jednotky"

#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Chybějící soubory balíčku %s"

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Nový soubor není v zahrnované cestě"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Žádné chybějící soubory. Všechny soubory existují."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Odstranit soubory"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Vrátit balíček"

#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Uložit balíček jako ..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Zobrazit adresářovou strukturu"

#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Zobrazit chybějící soubory"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Řadit soubory trvale"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Řadit soubory abecedně"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Soubor \"%s\" není v současnosti v zahrnované cestě balíčku.%sPřidat \"%s\" do zahrnuté cesty?"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Jméno jednotky:"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Použít všechny jednotky v adresáři"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Nepoužít žádné jednotky v adresáři"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Vyčistit závislosti balíku"

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Vyčistit výběr"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Doplněk CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Výstupní adresář"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Značka zdrojového adresáře balíčku"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Cesta jednotky"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Odstranit závislosti"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nová jednotka není v cestě jednotek"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Vydat balíček"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Navrátit balíček?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, fuzzy
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Soubor \"%s\"%snení aktuálně v cestě jednotek balíčku.%sPřidat \"%s\" do cesty jednotek?"

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "V roletovém menu je více funkcí"

#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binární"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Zahrnout soubor"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Vyvolání souboru XML"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Text formuláře Lazarusu"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Zdrojový soubor Lazarusu"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Hlavní jednotka"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuální jednotka"

#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr "Adresář balíčku. Parametr je ID balíčku"

#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr "Zahrnutá prohledávaná cestu souborů balíčku. Parametr je ID balíčku"

#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr "Prohledávaná cesta zdrojových souborů balíčku. Parametr je ID balíčku"

#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr "Prohledávaná cesta jednotek balíčku. Parametr je ID balíčku"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Přidat jednotku do sekce uses v balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Víceznačné jednotky nalezeny"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaticky instalované balíčky"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Porušená závislost"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Nalezeny kruhové závislosti"

#: lazarusidestrconsts.lispkgmangcompilepackage
msgid "Compile package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Odstranění selhalo"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Smazat starý soubor balíčku?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file \"%s\"?"
msgstr "Odstranit starý soubor balíčku \"%s\"?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Závislost bez vlastníka: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Chyba načítání souboru"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Chyba načítání balíčku"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Chyba: změna souboru po selhala pro balíček %s"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisování souboru"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Chyba zapisování balíčku"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Soubor je již obsažen v balíčku"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Soubor je projekt"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Jméno souboru se liší od jména balíčku"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Jméno souboru je použito jiným balíčkem"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Jméno souboru je použito projektem"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Soubor \"%s\" nenalezen."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Soubor není uložený"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Instalace balíčku %s automaticky nainstaluje balíček:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Instalace balíčku %s automaticky nainstaluje balíčky:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Neplatné jméno překladače"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Neplatná přípona souboru"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Neplatná přípona balíčku"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Neplatné jméno souboru balíčku"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Neplatné jméno balíčku"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Neplatné jméno balíčku"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, fuzzy
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nový balíček"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Balík: %s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Konflikt balíčků"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Balíček není návrhový balíček"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Balíček je vyžadován"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "hlavní zdrojový soubor balíčku"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Jméno balíčku již existuje"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Balíček musí mít příponu .lpk"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Nejdříve, prosím, přeložte balíček."

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Prosíme uložte soubor před jeho přidáním do balíčku."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Přestavět Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Přejmenovat soubor na malé písmena?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file \"%s\"?"
msgstr "Nahradit existující soubor \"%s\"?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Nahradit soubor"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Jeden nebo více vyžadovaných balíčků nebylo nalezeno. Viz graf balíčků pro více detailů."

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Uložit balíček?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Uložit balíček %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Mohu soubor přejmenovat na malé znaky na %s\"%s\"?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Přeskočit tento balíček"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "konfigurační soubor statického balíčku"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Soubor překladače pro balíček %s není platný spustitelný soubor:%s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Soubor \"%s\"%s je již v balíčku %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Soubor \"%s\" není balíček Lazarusu."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, fuzzy
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Jméno souboru \"%s\" nesouhlasí se jménem balíčku \"%s\" v souboru.%sZměnit jméno balíčku na \"%s\"?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, fuzzy
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Jméno souboru \"%s\" je částí aktuálního projektu.%sProjekty a balíčky nemůžou sdílet soubory."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Jméno souboru \"%s\" je použité %sbalíčkem \"%s\"%sv souboru \"%s\"."

#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr "Soubor \"%s\" balíčku %s nebyl nalezen."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Následující balíček se nepodařilo načíst:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Následující balíčky se nepodařilo načíst:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, fuzzy
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sNásledující jednotky budou přidány do sekce uses jednotky %s%s:%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
#, fuzzy
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Selhal překlad balíčku \"%s\".%sOdstranit jej z instalačního seznamu?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, fuzzy
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Jméno souboru balíčku \"%s\" v%s\"%s\" není platné jméno balíčku Lazarusu."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Balíček %s je balíčkem běhovým. %sBěhové balíčky  nelze instalovat do IDE."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, fuzzy
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "Balíček \"%s\" je překládán automaticky a jeho výstupní adresář je \"%s\", což je přednastavená cesta hledání jednotek překladače. Balíček používá jiné balíčky, které rovněž používají přednastavenou prohledávanou cestu jednotek překladače. To vytváří nekonečnou smyčku.%sTento problém můžete opravit odstraněním cesty z Vaší konfigurace překladače (např.: fpc.cfg)%snebo zakázáním automatické změny tohoto balíčku nebo odstraněním závislostí."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Balíček \"%s\" je označen k instalaci, ale nedá se najít.%sOdstranit závislost ze seznamu instalovaných balíčků?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Balíček %s je vyžadován balíčkem %s, který je označen k instalaci.%sViz. graf balíčků."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, fuzzy
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Jméno balíčku \"%s\" není platným jménem balíčku%sProsím, zvolte jiné jméno (např. balicek1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Jméno balíčku \"%s\" %ssouboru \"%s\" je neplatné."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Balíček \"%s\" byl označen.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečné odinstalování vyžaduje znovu sestavení a restartování lazarusu.%sChcete teď znovu sestavit Lazarus?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Balíček \"%s\" byl označen pro instalaci.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečná instalace vyžaduje znovu sestavení a restart lazarusu.%sChcete teď znovu sestavit Lazarus?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, fuzzy
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt vyžaduje balíček \"%s\".%sAle tento nebyl nalezen. Viz Projekt -> Inspektor projektu."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, fuzzy
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Dvě jednotky mají stejné jméno:%s1. \"%s\" z %s%s2. \"%s\" z %s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "Kruhová závislost v balíčcích. Viz graf balíčků."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Existuje jednotka FPC se stejným jménem jako balíček:%s\"%s\""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Existuje jednotka FPC se stejným jménem jako %s\"%s\" z %s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, fuzzy
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Balíček se zvoleným jménem \"%s\" už existuje. %sKonfliktní balíček:\"%s\"%sSoubor: \"%s\"."

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Už máme balíček \"%s\" načtený %sze souboru \"%s\".%sViz Balíček -> Graf balíčku.%sNahrazení není možné."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Mezi vyžadovanými balíčky jsou některé neuložené. Viz graf balíčků."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, fuzzy
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Již existuje jednotka se stejným jménem jako balíček: %s1. \"%s\" z %s%s2. \"%s\""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Toto je virtuální balíček. Zatím nemá zdrojový kód. Prosím uložte nejdříve balíček."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nelze vytvořit adresář"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "Nelze vytvořit výstupní adresář \"%s\"%sbalíčku %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "Nelze vytvořit zdrojový adresář \"%s\"%sbalíčku %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Nelze vytvořit cílový adresář Lazarusu:%s\"%s\".%sTento adresář je nutný pro nové, změněné Lazarus IDE s vlastními balíčky."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file \"%s\"."
msgstr "Nelze smazat soubor \"%s\"."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nelze smazat soubor"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "Nelze smazat starý stavový soubor \"%s\"%sbalíčku %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Nelze načíst balíček"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
#, fuzzy
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "Nelze otevřít balíček \"%s\".%sTento balíček byl označen k instalaci."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "Nelze číst stavový soubor \"%s\"%sbalíčku %s.%sChyba: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Nelze zapsat balíček \"%s\"%sdo souboru \"%s\".%sChyba: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "Nelze zapsat stavový soubor \"%s\"%sbalíčku %s.%sChyba: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Odinstalovat balíček?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Odinstalovat balíček %s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Neuložený balíček"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Požít jednotku"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Varování: Soubor \"%s\"%spatří k aktuálnímu projektu."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "udržovat"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nový"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "odstranit"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Vybrat balíček"

#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Instalováno"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr "Nelze registrovat komponenty bez jednotky"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class \"%s\" already defined"
msgstr "Třída komponenty \"%s\" je již definována."

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: \"%s\""
msgstr "%s%sJméno souboru: \"%s\""

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Neplatná třída komponenty"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Neplatné jméno jednotky: %s"

#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: \"%s\""
msgstr "%s%ssoubor lpk: \"%s\""

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Soubor balíčku nenalezen"

#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Chyba registrace balíčku"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Registrační procedura je nil"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Bylo voláno RegisterUnit, ale žádný balíček není registrován."

#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr "%s%sSoubor lpk nebyl nalezen."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
#, fuzzy
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Balíček \"%s\" je instalován, ale nebyl nalezen platný soubor (.lpk).%sByl vytvořen rozbitý prázdný balíček."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Toto je přednastavený balíček určený jen pro komponenty bez balíčků. Tyto komponenty jsou zastaralé."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Tento balíček je nainstalován, ale soubor lpk nebyl nalezen. Všechny jeho komponenty jsou deaktivované. Prosím, opravte to."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: \"%s\""
msgstr "%s%sJméno jednotky: \"%s\""

#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Jednotka \"%s\" nebyla nalezena v souboru lpk.%sPravděpodobně tento lpk soubor nebyl použit k sestavení tohoto IDE. Nebo tento balíček nevhodně používá proceduru RegisterUnit."

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Jednotka \"%s\" byla odstraněna z balíčku (lpk)"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgstr "Následující závislosti nejsou nutné kvůli automatické přechodnosti závislostí mezi balíčky."

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, fuzzy
#| msgid "The project overrides the output directory of the following packages.%sSee Project / Compiler Options / Additions and Overrides%s%s"
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "Přojekt přepisuje výstupní složku následných balíčků.%sViz Projekt / Volby projektu / Přídavky a Přepisy%s%s"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Soubor není v žádném načteném balíčku."

#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr "Přechodnost"

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Nelze číst soubor balíčku \"%s\".%sChyba: %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Přehrát"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Celkový"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Odkazy balíčku"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Ukázat celkové odkazy"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Ukázat uživatelské odkazy"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Uživatel"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr "Prosím, opravte chybu zobrazenou v okně zpráv, které je zpravidla pod editorem zdrojů."

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Prosím otevřete jednotku před spuštěním."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Prosíme vyberte nějaký kód k vytažení nové procedury/metody."

#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Všechno>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Změnit písmo"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Zkopírovat jméno metody do schránky"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrovat podle jakékoliv odpovídající části metody"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrovat podle začátku metody"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Skoč na výběr"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<žádný>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objekty"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Seznam procedur"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Vyberte adresář .po souborů"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "neukládat"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Ukazatel"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
#, fuzzy
#| msgid "Save in IDE config directory"
msgid "Save in .lps file in IDE config directory"
msgstr "v konfiguračním adresáři IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "v souboru .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "v souboru .lps v adresáři projektu"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Uložit informace o sezení"

#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ""

#: lazarusidestrconsts.lispositionoutsideofsource
#, fuzzy
#| msgid "%s (position outside of source"
msgid "%s (position outside of source)"
msgstr "%s (pozice vně zdroje"

#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr ""

#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr ""

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Předcházející slovo"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "hlavní konfigurační složka, kde Lazarus uchovává své konfigurační soubory. Implicitní je "

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Primární konfigurační cesta"

#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr "před %s"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Soukromý"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Soukromá metoda"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Před pokračováním asi bude nutné nainstalovat některé balíčky .%sVarování:%sProjekt používá následující návrhové balíčky,  které mohou být nezbytné k otevření formuláře v návrháři. Pokud budete pokračovat, můžete obdržet chyby o chybějících komponentách a načítání formuláře pravděpodobně způsobí nechtěné výsledky.%sJe doporučeno zrušit akci a nejdříve nainstalovat tyto balíčky."

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedura"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedura s rozhraním"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Zjištěn program"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Free Pascal program příkazové řádky s několika přidanými užitečnými nastaveními."

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Zdrojový soubor programu musí mít pascalovkou příponu jako .pas, .pp nebo .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add Files to Project"
msgstr "Přidat soubory do projektu"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Závislost již existuje"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Přidat editované soubory"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Neplatná verze Min-Max"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Neplatné jméno balíčku"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid Pascal unit name"
msgstr "Neplatné jméno pascalovské jednotky"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Neplatná verze"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximální verze (nepovinné):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimální verze (nepovinné):"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nové požadavky"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Jméno balíčku:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Balíček nenalezen"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, fuzzy
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Závislost \"%s\" nebyla nalezena.%sProsím zvolte existující balíček."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, fuzzy
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximální verze \"%s\" je neplatná.%sProsím použite formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximální verze je menší než Minimální verze."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, fuzzy
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimální verze \"%s\" je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
#, fuzzy
msgid "The package name \"%s\" is invalid.%sPlase choose an existing package."
msgstr "Jméno balíčku \"%s\" není platné.%sProsím použijte existující balíček."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Projekt již je závislý na balíčku \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, fuzzy
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Jméno jednotky \"%s\" už v projektu%sexistuje se souborem: \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, fuzzy
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Jméno jednotky \"%s\" už existuje ve výběru%sse souborem: \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "Jméno jednotky \"%s\" není platný pascalovský identifikátor."

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to Project"
msgstr "Přidat do projektu"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Jméno jednotky již existuje"

#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr "Projekt %s"

#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Projekt:"

#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr ""

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt změněn"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projekt změněn na disku"

#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr "%d projektů"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Adresář projektu"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Titulek panelu úloh zobrazuje také adresářovou cestu projektu"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Jméno souboru projektu"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Cesta začleněných souborů projektu"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Zjištěn informační soubor projektu"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project information"
msgstr "Informace projektu"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt je spustitelný"

#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr ""

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Vlastnosti makra projektu"

#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Volva Projektu"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Výstupní adresář projektu (např. ppu adresář)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Výstupní adresář projektu"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Adresář, v němž musí být hlavní soubor projektu"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Sezení Projektu"

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Sezení projektu se změnilo"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Zdrojový adresář projektu"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s na adrese %1:x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Projekt %s vyvolal výjimku třídy '%s'."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projekt %s vyvolal výjimku třídy '%s' se zprávou:%s%s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s v souboru '%1:s' na adrese %2:x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s v souboru '%1:s' na řádce %2:d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s v souboru '%1:s' na řádce %2:d:%0:s%3:s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Zdrojová cesta projektu"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "jednotka projektu"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Cesta jednotek projektu"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Průvodce projektu"

#: lazarusidestrconsts.lisprojfiles
msgid "Files:"
msgstr "Soubory:"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potvrdit odstranění závislostí"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Potvrdit odstranění souboru"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Odstranit závislost pro %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspektor projektu - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Odstranit požadované balíčky"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Odstranit soubor %s z projektu?"

#: lazarusidestrconsts.lisprojinspremoveitemsf
msgid "Remove %s items from project?"
msgstr ""

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Nelze načíst soubor %s projektu %s%sChyba: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Nelze zapsat stavový soubor projektu %s%sChyba: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Vždy sestavit (i pokud se nic nezmění)"

#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr ""

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Nelze změnit seznam automaticky vytvářených formulářů ve zdrojovém kódu programu.%sNejdříve opravte chyby."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Značka zdrojového adresáře projektu"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Dotázat se na hodnotu"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Vlastnosti (nahradit nebo odstranit)"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Chráněné"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Chráněné metody"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Veřejná metoda"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Zveřejněné metody"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Zveřejni adresář projektu"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Zveřejnit projekt"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid exclude filter"
msgstr "Neplatný vylučovací filtr"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid include filter"
msgstr "Neplatný filtr zahrnutí"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Uložit .lrs soubory ve výstupním adresáři"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr ""

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Upravit virtuální jednotku"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Již existuje jednotka s tímto jménem.%sSoubor: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Jméno jednotky není platný pascalovský identifikátor."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "Jméno jednotky je použito, když IDE rozšiřuje definici uses"

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Převést Delphi projekt"

#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "Nový projekt"

#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "Otevřít projekt"

#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Otevřít nedávný projekt"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Prohlížet ukázkové projekty"

#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Rychle Opravit chybu"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Rychlé opravy"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Rychlá oprava: Odstranit jednotku"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Hledat identifikátor"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Ukončit"

#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "Ukončit Lazarus"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Chyba čtení"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Opravdu odstranit?"

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Poslední listy"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Zaznamenáno"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Záznam/Struktura"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Opakovat změnu"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registry"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Regulární výrazy"

#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relativní"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relativní cesty"

#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Odstranit"

#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Odstranit?"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Odstranit všechny neplatné vlastnosti"

#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Odstranit všechny filtry zpráv podle typu"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Odebrat všechny jednotky"

#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Odstranit Volbu Překladače Skrýt Zprávu"

#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Odstranit %s závislostí z balíčku \"%s\"?"

#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr "Odstraněna vlastnost \"%s\"."

#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr "Odstranit %s souborů z balíčku \"%s\"?"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Odestranit ze seznamu instalovaných"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Odstranit z projektu"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Odstranit z vyhledávací cesty"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Odstranit zahrnutou cestu?"

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Odstranit lokální proměnnou %s"

#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr "Odsranit lokální proměnnou \"%s\""

#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Odstranit Filtr Typu Zprávy"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Odstranit neexistující soubory"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Odstranit vybrané jednotky"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Odstranit je"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Odstranit cesty z \"Ostatní zdroje\""

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Odstranit cestu jednotek?"

#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr "Odstranit uses \"%s\""

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Přejmenování"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Přejmenovat ..."

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Přejmenovat soubor?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Přejmenování souboru selhalo"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Ukázat seznam přejmenovaných identifikátorů"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Přejmenovat na %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Přejmenovat na malá písmena"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Znovuotevřít projekt"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Znovuotevřít s jiným kódováním"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Počet opakování:"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Nahradit"

#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Nahrazena vlastnost \"%s\" s \"%s\"."

#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Nahrazen typ \"%s\" s \"%s\"."

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Nahrazení"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Náhrazující funkce"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Náhrady"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Opravit neznámé vlastnosti a typy"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Nahradit celý identifikátor"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Nahrazení výběru selhalo."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Přeskenovat"

#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr "Reset"

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Nastavit všechny souborové filtry na předvolené"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Resetovat vlastnosti Left, Top, Width, Height vybraných komponent na vlastnosti předků?"

#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr ""

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Chyba uložení zdroje"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Typ zdroje projektu"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Restartovat"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Výsledek:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "vrací seznam všech hodnot podmínkové proměnné před proměnnou"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Vrácení selhalo"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Vpravo"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Pravé ukotvení"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Pravý okraj. Tato hodnota je přidána k základnímu okraji a použitá pro odsazení vpravo od prvku."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož pravé straně je ukotven. Ponechte prázdné pro rodiče."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Pravé strany"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Stejná pravá vzdálenost"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Kořen"

#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr "Kořenová složka"

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Spustit"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "\"Běhové a Designové\" balíčky nemají omezení."

#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Spustit"

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (běžící ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Soubor není spustitelný"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application \"%s\" is not executable."
msgstr "Hostitelská aplikace \"%s\" není spustitelná."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Spustit"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Pouze běhové, nelze instalovat v IDE"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "\"Pouze běhové\" balíčky pouze pro projekty. Nemohou být instalovány v IDE, ani nepřímo."

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgstr "\"Běhové\" balíčky mohou být užity v projektech. Nemohou být instalovány v IDE, dokud je nevyžaduje nějaký Designový balíček."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Spustit-po selhalo"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Abstraktní metody - doposud nepředefinováno"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Abstraktní metody %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Ukazatel není v deklaraci třídy"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE je zaneprázdněno"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s je abstraktní třída, protože má abstraktní metody %s."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nenalezeny abstraktní metody"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Přepsat celý výběr"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Přepsat první vybraný"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Vybrat žádný"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existuje %s abstraktních metod, které lze implementovat.%sZvolte metody, pro které chcete vytvořit kostry:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Neexistují žádné abstraktní metody k přetížení."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Tuto metodu nelze přetížit, protože je definována v aktuální třídě"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nelze zobrazit abstraktní metody této třídy, protože"

#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Uložit"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Uložit vše"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Uložit všechny zvolené"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Uložit všechny upravené soubory"

#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Uložit Všechny/Původní Zprávy do Souboru..."

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Uložit a ukončovací dialog"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Uložit a znovu sestavit IDE"

#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Uložit jako"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Uložit změněné soubory?"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Uložit změny?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Uložit změny projektu %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Uložit aktuální editovaný soubor"

#: lazarusidestrconsts.lissavedsuccessfully
msgid "Saved successfully"
msgstr "Úspěšně uloženo"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Uloženo s nastavením IDE"

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Uloženo se sezením projektu"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Uložit informace editoru neprojektových souborů"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Uložit soubor jako"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Uložit soubor \"%s\"%spřed zavřením formuláře \"%s\"?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Uložit informace zavřených souborů editoru"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Uložit makro jako"

#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Uložit zprávy"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Uložit projekt %s (*%s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr "Uložit změny sezení do projektu %s?"

#: lazarusidestrconsts.lissavesessionfoldstate
#, fuzzy
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Uložit informaci o skládání"

#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr ""

#: lazarusidestrconsts.lissavesessionjumphistory
#, fuzzy
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Uložit historii skoků"

#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr ""

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Uložit nastavení"

#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Uložit Zobrazené Zprávy do Souboru..."

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Uložit "

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Činitel zvětšení:"

#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr ""

#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr ""

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Prohledávání"

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Prohledávání nadřazeného adresáře"

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Prohledávané cesty"

#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr ""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "druhotná konfigurační složka, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je "

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Druhotná konfigurační cesta"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Podívat se na hlášení."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sPodívejte se na Projekt -> Inspektor projektu"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Vybrat položku nápovědy:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Vybrat uzel"

#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr ""

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Vybrat soubor formuláře Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Vybrané"

#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr ""

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Vybrané a potomci"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(vybraný dolní soused)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Vybrané mapování příkazů"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "vybrané pro instalaci"

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "vybrané pro odinstalaci"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(vybraný levý soused)"

#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr ""

#: lazarusidestrconsts.lisselectedmodeswerebuilt
msgid "Selected %d modes were successfully built."
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(vybraný pravý soused)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(vybraný horní soused)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Vybrat soubor"

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Vybrat zdrojový adresář FPC"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Výběr přesahuje řetězcovou konstantu"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Nástroj výběru"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Vybrat zdrojový adresář Lazarusu"

#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr "Vybrat cestu k %s"

#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Vybrat cílovou složku"

#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Nastavit všechny barvy:"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Nastavit výchozí"

#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Toto nastavte k překládání zpráv překladače do jiného jazyka (mimo Angličtinu). Například: Němčina: $(FPCSrcDir)/compiler/msg/errordu.msg."

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Nastavení výchozího odsazování)"

#: lazarusidestrconsts.lissetutf8inrtl
msgid "Set UTF-8 in RTL"
msgstr ""

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Krátky:"

#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Krátké, bez cesty"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Ukázat"

#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr "Ukázat abstraktní metody \"%s\""

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Zobrazit strom komponent"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Ukázat pokyny deklarace"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Ukázat rozdíly mezi módy ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Ukázat prázdné jednotky/balíčky"

#: lazarusidestrconsts.lisshowglyphsfor
#, fuzzy
#| msgid "Show Glyphs for:"
msgid "Show Glyphs for"
msgstr "Zobrazit ikony pro:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Ukázat žlábek"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Ukázat nápovědu"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Ukázat pokyny"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Ukázat identifikátory"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Ukázat informační rámeček"

#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Ukázat Typové ID Zprávy"

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Zobrazit pouze změněné"

#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Zobrazit pouze jedno tlačítko v liště pro celé IDE, namísto jednoho tlačítka pro každé okno. Někteří Linuxoví Správci Oken jako Cinnamon toto nepodporují a vždy ukazují jedno tlačítko pro každé okno."

#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview Gutter"
msgstr "Zobrazit přehledovou lištu"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Ukázat balíčky"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Ukázat pozici v zdrojovém editoru"

#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr ""

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Zobrazit relativní cesty"

#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr ""

#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr ""

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Ukázat dialog nastavení nejdůležitějších nastavení"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Ukázat speciální znaky"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
#, fuzzy
#| msgid "Show status bar"
msgid "Show statusbar"
msgstr "Ukázat stavový pruh"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Ukázat jednotky"

#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr ""

#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr ""

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Zobrazit nepoužité unity ..."

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Ukázat pokyny hodnot během ladění"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "ukázat verzi a odejít"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Zúžit na nejmenší"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Sourozenec"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Jednoduchý program"

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Nejjednodušší Free Pascal program příkazové řádky."

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Jednoduchá syntaxe"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Přeskočit chyby"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Přeskočit soubor"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Přeskočit soubor a pokračovat v načítání"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Přeskočit načtení posledního projektu"

#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr ""

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Menší, ale pomalejší"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Odpovídá"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Omlouváme se, tento typ ještě nebyl implementován."

#: lazarusidestrconsts.lissort
msgid "Sort"
msgstr ""

#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr ""

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Vzestupný"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Rozlišovat velikost znaků"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Vzestupný"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Doména"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorovat mezery"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Řádky"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Volby"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Odstavce"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Náhled"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Přijmout"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Seřadit výběr"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Slova"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Zdroj a cíl jsou stejné:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "&Zdrojový bod přerušení ..."

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
#, fuzzy
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
msgstr "Zdrojový adresář \"%s\"%sa cílový adresář \"%s\"%sjsou stejné.Možná jste špatně pochopili tuto funkci.%sFunkce vyčistí/znovuvytvoří cílový adresář a zkopíruje do něj balíček/projekt."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory \"%s\" does not exist."
msgstr "Zdrojový adresář \"%s\" neexistuje."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Správce Oken Editoru Zdrojáku"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Zdroj upraven"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Zdroj stránky \"%s\" změněn. Uložit?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Zdoje stránek se změnily. Uložit stránku \"%s\"? (%d další)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Zdrojové cesty"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Mezery stejně"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Zdroj. OS"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Hledání"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Hledat text"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Začátek převodu"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Spustit IDE"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Začít s novým projektem"

#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr ""

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Zastavit"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Zastavit aktuální ladění a znovu sestavit projekt?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zastavit ladění?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Zastavit ladění?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Zastavit při výjimce"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zastavit ladění?"

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Uložit oddělovače cesty \\ a / jako"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Divný soubor lpi"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Chyba proudového zpracování"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Řetězec"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Styl"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Podprocedure"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Vnořená procedura na stejné úrovni"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Úspěch"

#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuccessfullyimported
msgid "Successfully imported from \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
msgid "Successfully imported compiler options from \"%s\"."
msgstr ""

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Navrhnout přednastavené jméno nového souboru malými písmeny"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Podezřelá cesta zahrnovaných"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Podezřelá cesta jednotek"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revize SVN: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Neplatné jméno proměnné"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" není platný identifikátor."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Přepsat systémovou proměnou"

#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Přepnout Nastavení Filtru"

#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr ""

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Režim syntaxe"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu nenalezen. Zkontrolujte Váš fpc.cfg"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Setřídit pořadí záložek všch dceřinných prvků \"%s\" podle jejich pozice?"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Přesunout vybraný prvek dolů v pořadí záložek"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of %s"
msgstr "Pořadí záložek %s"

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Vypočítat pořadí záložek prvků podle jejich X a Y souřadnic"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Přesunout vybraný prvek nahoru v pořadí záložek"

#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr "Listy pro %s"

#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Vytvoř snímek"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Cíl:"

#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ""

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Cílový CPU"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Jméno cílového souboru (prázdné = použít výstupní adresář jednotek):"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Jméno cílového souboru (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Cílové jméno souboru projektu"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Cílové jméno souboru + parametry"

#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "Cíl je pouze ke čtení. "

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Cílový OS"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Upravitelná buňka"

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgstr "Vloží upravitelné buňky. Mezi buňkami můžete přecházet klávesou Tab.%0:sMakro \"param\" přijímá seznam argumentů oddělených čárkou.%0:sPrvním argumentem je výchozí hodnota.%0:sDruhý argument (nepovinný) může být použit k propojení buňky s jinou buňkou (synchronní úprava)%0:s%0:s  while param(\"foo\") do param(foo);%0:sVloží dvě nezávislé buňky, obě s výchozím textem \"foo\"%0:sUvozovky nejsou povinné%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sVloží dvě propojené buňky. Úprava jedné z nich se promítne i do druhé%0:sHodnota \"1\" odkazuje na pozici dalšího \"param()\", takže pokud je více parametrů:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sDruhá a třetí jsou propojené (třetí odkazuje na \"2\") %0:s%0:s\"sync\" může být zkráceno na \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sDruhá a třetí jsou propojené.%0:sPoznámka: Pokud \"sync\" namá uvedeno \"=\" a pozici, propojí se k předchozí buňce se stejnou výchozí hodnotou (v tomto případě \"foo\")"

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Soubor šablony"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testovací složka"

#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr ""

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Aplikační balík byl vytvořen pro \"%s\""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Třída \"%s\" je TControl a nemůže být vložena na neovládací prvek.%sNelze vložit."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s"
msgstr "CodeTools našly chybu:%s%s"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after \"%s\" is not executable."
msgstr "Příkaz po \"%s\" není spustitelný."

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s\"%s\""
msgstr "Příkaz za publikováním je neplatný:%s\"%s\""

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Soubor překladače \"%s\" nevypadá v pořádku:%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Komponenta %s nemůže být smazána, protože není vlastněna %s."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "Editor komponenty třídy \"%s\" vytvořil chybu:%s\"%s\""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, fuzzy
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "Třída editoru komponent \"%s\"%svyvolaná slovesem #%s \"%s\"%svytvořila chybu:%s\"%s\""

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Komponenta %s je zděděná z %s.%sKe smazání zděděné komponenty otevřete předka a smažte ji tam."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Komponenta %s je zděděná z %s.%sKe přejmenování zděděné komponenty otevřete předka a přejmenujte jij tam."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Jméno komponenty musí být jedinečné ve všech komponentách na formuláři/datovém modulu. Jméno je porovnáváno bez citlivosti na velikost písmen jako normální identifikátor pascalu."

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Konfigurace bude ponížena/překonvertována"

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "%s obsahuje neexistující adresář:%s%s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s obsahuje znak hvězdičky *.%sLazarus to považuje za běžný znak a neprovádí rozšíření jako souborová maska."

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Aktuální FPC nemá žádný konfigurační soubor. Pravděpodobně budou chybět některé jednotky. Zkontrolujte svou instalaci FPC."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Ladič \"%s\"%sneexistuje, nebo není spustitelný.%sZkontrolujte Nástroje -> Nastavení -> Volby ladiče"

#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr "Spouštěcí program ladiče se obvykle jmenuje \"%s\". Prosím, zadejte celou cestu souboru."

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Výchozí režim musí být uložen v projektu, ne v sezení."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Cílový adresář%s\"%s\" neexistuje."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
#, fuzzy
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Cílový adresář \"%s\" neexistuje.%sProsím, zkontrolujte cílové jméno souboru projektu v menu Projekt -> Volby projektu."

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Adresář \"%s\" již neobsahuje žádné zahrnované soubory projektu. Odstranit tento adresář z projektové cesty zahrnovaných cest?"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Adresář \"%s\" již neobsahuje žádné projektové jednotky. Odstranit tento adresář z projektové cesty jednotek?"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, fuzzy
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Adresář \"%s\" nadále není potřeba v cestě jednotek.%sOdstranit jej?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory \"%s\" is not writable."
msgstr "Adresář \"%s\" není zapisovatelný."

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
msgstr "Adresář \"%s\" ještě není v cestě jednotek.%sPřidat jej?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Adresář %s nebyl nalezen."

#: lazarusidestrconsts.listhefile
msgid "The file \"%s\""
msgstr "Soubor \"%s\""

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Soubor %s nevypadá jako soubor lpi."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Indexový soubor je nutný pro funkce jako hledání deklarací. Během vytváření můžete upravovat zdrojové kódy a překládat, ale funkce jako hledání deklarací zobrazí chyby o nenalezených jednotkách. Může to trvat několik minut."

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "Soubor \"%s\" je symbolický odkaz.%sOtevřít místo něj \"%s\"?"

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, fuzzy
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Soubor \"%s\" není projekt lazarusu.%sVytvořit nový projekt pro \"%s\"?"

#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr "Maska souboru \"%s\" je neplatná."

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Maska souboru \"%s\" není platný regulární výraz."

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Soubor \"%s\" vypadá jako program. %sZavřít aktuální projekt a vytvořit nový projekt Lazarusu pro tento program?%s\"Ne\" načte soubor jako normální zdroj."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Soubor %s vypadá, že je programový soubor existujícího projektu Lazarusu."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
#, fuzzy
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr "Soubor \"%s\"%sbyl nalezen v jednom ze zdrojových adresářů balíčku %s a vypadá jako přeložená jednotka. Přeložené jednotky musí být ve výstupním adresáři balíčku, jinak můžou mít jiné balíčky problémy s použitím tohoto balíčku.%sSmazat tento soubor?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, fuzzy
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Soubor \"%s\" nebyl nalezen.%sChcete ho najít sami?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, fuzzy
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Soubor \"%s\" nebyl nalezen.%sZvolte Ignorovat pro pokračování v načítání projektu,%szvolte Zrušit pro zastavení načítání."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, fuzzy
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Následující metody použité v %s nejsou v zdrojovém kódu%s%s%s%s%sOdstranit tyto odkazy?"

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Zdrojový adresář FPC \"%s\" nevypadá v pořádku:%s%s"

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Spustitelný soubor Free Pascal překladače má obvykle jméno \"%s\". Můžete rovněž použít překladač specifický pro cílovou platformu jako \"%s\". Zadejte, prosím, kompletní souborovou cestu."

#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr ""

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Identifikátor je jednotkou. Použijte funkci Soubor->Uložit jako k přejmenování jednotky."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, fuzzy
msgid "The key %s%sis already assigned to %s.%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Klávesa %s%sje již přiřazena k %s.%sOdstranit staré přiřazení a přiřadit klávese novou funkci%s%s?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, fuzzy
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "Program %s%snutný ke spuštění neexistuje, nebo není spustitelný.%sChcete jej vytvořit?%sViz. nastavení v Projekt -> Volby projektu -> Aplikace"

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, fuzzy
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Spouštěcí aplikace \"%s\"%sneexistuje, nebo není spustitelná.%sViz. Spustit -> Parametry spouštění -> Lokální"

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Adresář Lazarusu obsahuje zdrojové kódy IDE a soubory balíčků LCL a mnoha standardních balíčků. Obsahuje například soubor \"ide%slazarus.lpi\". Soubory překladů jsou umístěny také tam."

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "Adresář Lazarusu \"%s\" nevypadá v pořádku:%s%s"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Soubor LFM (formulář Lazarusu) obsahuje neplatné vlastnosti. To například znamená, že obsahuje nějaké vlastnosti/třídy, které neexistují v aktuálním LCL. Obvyklá oprava je odstranit tyto vlastnosti z lfm a ručně opravit kód Pascalu."

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "Makro \"%s\" nezačíná na \"%s\"."

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "Spouštěcí soubor \"make\" má obvykle jméno \"%s\". Je potřeba pro sestavení IDE. Prosím, zadejte celou cestu souboru."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, fuzzy
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Nový include soubor ještě není v cestě hledání.%sPřidat adresář %s?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, fuzzy
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Nová jednotka zatím není v cestě hledání.%sPřidat adresář %s?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Stará konfigurace bude povýšena."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Ostatní zdroje\" obsahuje adresář, který je již v \"Ostatní soubory jednotek\".%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory \"%s\" is missing."
msgstr "Výstupní adresář \"%s\" chybí."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Výstupní adresář %s je v seznamu cest hledání include %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Výstupní adresář %s je v zděděném seznamu cest hledání include %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Výstupní adresář %s je v seznamu zděděných cest hledání jednotek %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Výstupní adresář %s je v seznamu cest hledání jednotek%s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "Výstupní adresář by měl být samostatný adresář a neměl by obsahovat žádné zdrojové soubory."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Vlastnící třída má toto jméno"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Vlastník má toto jméno"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Balíček %s přidává cestu \"%s\" do zahrnované cesty IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Balíček %s přidává cestu \"%s\" do cesty jednotek IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Balíček již obsahuje jednotku s tímto jménem."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgstr "Balíček %s nelze nainstalovat, protože vyžaduje balíček \"%s\", který je balíčkem běhovým."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Balíček %s nemůže být odinstalován, protože jej potřebuje samo IDE."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, fuzzy
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Balíček %s nemá proceduru \"Register\", což typicky znamená, že neposkytuje žádný přídavek pro IDE. Jeho instalací se pravděpodobně pouze zvětší velikost IDE a může dokonce způsobit jeho nestabilitu.%sTip: Pokud chcete použít balíček v projektu, použijte položku menu \"Přidat do projektu\"."

#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr "Balíček %s je již v seznamu"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Balíček %s není balíčkem designovým. Nelze jej nainstalovat v IDE"

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Cesta \"make\" není správná: \"%s\""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Program \"make\" nenalezen.%sTento nástroj je nutný k sestavení Lazarusu."

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Volby překladače projektu a příkazy v hlavním zdroji se liší. Nové jednotky použijí mód a řetězcový typ z voleb projektu:"

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Projekt nepoužívá rozhraní jednotek LCL, které jsou vyžadovány LCLBase.%sDostanete různé chyby při linkování, pokud použijete LCL bez rozhraní."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Projekt nemá hlavní soubor zdrojového kódu."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, fuzzy
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Informační soubor projektu \"%s\"%sje shodný s hlavním souborem zdrojového kódu!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Informační soubor projektu \"%s\"%sse změnil na disku."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Před sestavením musíte projekt uložit%sPokud jste nastavili testovací adresář v nastavení IDE,%smůžete nový projekt zároveň vytvořit i sestavit.%sUložit projekt?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, fuzzy
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Projekt používá nové zdroje FPC, což vyžaduje alespoň FPC 2.4"

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr ""

#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
msgid "%sThere are additional notes for this message on%s"
msgstr ""

#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr ""

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "V adresáři jsou další soubory se stejným jménem, %skteré se liší pouze ve velikosti písmen:%s%s%sSmazat je?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, fuzzy
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Na disku už je soubor se stejným jménem a podobnou koncovkou%sSoubor: %s%sNeplatný soubor: %s%sSmazat neplatný soubor?"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Už existuje režim sestavení s tímto názvem."

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr "Už existuje třída komponenty s názvem %s."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Již existuje komponenta se tímto jménem"

#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr "Už existuje soubor%s%s%s v %s"

#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Už existuje soubor \"%s\" v %s%sStarý: %s%sNový: %s%s%sPokračovat?"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name \"%s\""
msgstr "Již existuje formulář se jménem \"%s\""

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr "Makro se jménem \"%s\" již existuje."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "IDE makro se jménem \"%s\" již existuje"

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr "Balíček %s je již v seznamu"

#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Už existuje unita \"%s\" v %s%sStará: %s%sNová: %s%sMěli by jste se přesvědčit že v cestě pro hledání unit je pouze jedna z nich.%s%sPokračovat?"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, fuzzy
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Jednotka se jménem \"%s\" již existuje. Identifikátory Pascalu musí být unikátní."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, fuzzy
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Jednotka se jménem \"%s\" již v projektu existuje.%sZvolte, prosím, jiné jméno"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "V adresáři %s není fpc.exe. Obvykle je spouštěcí make soubor instalován společně s překladačem FPC."

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Musí existovat alespoň jeden sestavovací mód."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, fuzzy
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Zdrojová třída \"%s\" dědí z \"%s\". Pravděpodobně je to překlep pro TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Při zápisu zvolené komponenty nastala chyba %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Při převodu binárního proudu zvolené komponenty nastala chyba %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Při kopírování proudu komponenty do schránky nastala chyba:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Kořenovou komponentu nelze smazat."

#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Tyto soubory budou smazány"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Tyto nastavení jsou uloženy v projektu"

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Tyto jednotky nebyly nalezeny:"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Zdrojové kódy balíčků Free Pascalu jsou nutné pro prohlížení a doplňování kódu. Například obsahuje soubor \"%s\"."

#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr "Cíl %s není zapisovatelný."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "Adresář testů nelze nalézt:%s\"%s\"%s(viz volby IDE)"

#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr "Jednotka \"%s\" již existuje."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Jednotka patří balíčku %s."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Jednotka %s existuje dvakrát v cestě jednotek %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Jednotka má toto jméno"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Jméno souboru jednotky \"%s\" není malými písmeny.%sPřekladač Free Pascal nehledá všechny velikosti. Je lepší použít jména souborů s malými písmeny.%sPřejmenovat soubor malými písmeny?"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "Jednotka %s je součastí zdrojů FPC, ale odpovídající XML soubor fpdoc nebyl nalezen.%sBuď jste dosud nepřidali adresář fpdoc do prohledávané cesty, nebo jednotka ještě není dokumentovaná.%sSoubory fpdoc pro FPC můžete stáhnout z: %s%sPřidejte, prosím, adresář do voleb editoru fpdoc.%sPro vytvoření nového souboru musí být adresář zapisovatelný."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Jednotka %s je používaná jinými soubory.%sAktualizovat automaticky odkazy?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, fuzzy
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Jednotka samotná už má jméno \"%s\". Identifikátory Pascalu musí být unikátní."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, fuzzy
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Cesta hledání jednotek \"%s\" obsahuje zdrojový adresář \"%s\" balíčku %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, fuzzy
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Pracovní adresář \"%s\" neexistuje.%sProsím, zkontrolujte pracovní adresář v Spustit -> Parametry spuštění."

#: lazarusidestrconsts.listhisbuildmodenowsetsutf8inthertlflagsareinpagesoth
msgid "This build mode now sets UTF-8 in the RTL.%s Flags are in pages \"Other\" and \"Additions and Overrides\"."
msgstr ""

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr "Tato komponenta už obsahuje třídu s názvem %s."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Tato funkce vyžaduje otevřený .lfm soubor v editoru zdrojového kódu."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "tato zpráva nápovědy"

#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr ""

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Vypadá to jako pascalovský soubor.%sDoporučujeme ve jméně použít malá písmena, aby jste předešli problémům na některých souborových systémech a různých překladačích.%sPřejmenovat na malá písmena?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Tento projekt nemá hlavní zdrojový soubor"

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Tento projekt ma pouze výchozí sestavovací mód."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, fuzzy
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Tato kombinace voleb sestavení Lazarusu není podporována touto instalací.%sAdresář \"%s\" není zapisovatelný.%sViz. webové stránky Lazarusu pro jiné způsoby instalace Lazarusu."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tento příkaz nelze vyjmout.%sProsím, vyberte nějaký kód pro vyjmutí procedury/metody."

#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr ""

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Toto vytvoří kruhovou závislost."

#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Toto vloži hodně textu (%s) do schránky.%sPokračovat?"

#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Vlákna"

#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Aktuální"

#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Funkce"

#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "Jít na"

#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Řádek"

#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Vlákna nejsou vyhodnocena"

#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Zdroj"

#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Stav"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titulek"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Titulek v panelu úloh zobrazí například: projekt1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Název (nechejte prázdné pro výchozí)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkce: připojit oddělovač cesty"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr "Funkce: odstranit oddělovač cesty na konci"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkce: vytáhnout příponu souboru"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkce: vytáhnout jméno souboru + příponu"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkce: vytáhnout pouze jméno souboru"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkce: vytáhnout cestu"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(neznámé makro: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Cesta:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Přepnout zobrazení názvů souborů s plnou cestou nebo s relativní cestou"

#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr ""

#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr ""

#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr ""

#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr ""

#: lazarusidestrconsts.listoolbaroptionsstandardvisible
msgid "Standard toolbar visible"
msgstr ""

#: lazarusidestrconsts.listoolbaroptionstoolbarsvisible
msgid "Toolbars visible"
msgstr ""

#: lazarusidestrconsts.listoolbaroptionsviewdebugvisible
msgid "Debug toolbar visible"
msgstr ""

#: lazarusidestrconsts.listoolhasnoexecutable
msgid "tool \"%s\" has no executable"
msgstr "nástroj \"%s\" nemá spustitelný soubor"

#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Hlavička Nástroje: Selhalo"

#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Hlavička Nástroje: Běží"

#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Hlavička Nástroje: Odscrollováno"

#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Hlavička Nástroje: Úspěch"

#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "nástro skončil s kódem %s. Použijte kontextové menu pro více informací."

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Přichycení nahoru"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Horní okrajový prostor. Tato hodnota je přidána jako základ okrajového prostoru a použita pro prostor nad prvkem."

#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Proc Hint"
msgstr "Zobrazit tipy tříd/procedur"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Vrcholky"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož horní straně je ukotvený. Ponechte prázdné pro rodiče."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Horní mezery stejně"

#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Přeložit Anglické Zprávy"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Strom potřebuje obnovení"

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Dva přesunované soubory budou mát stejný název:%s%s%s%s%sv %s"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Typy (neodstraňovat pokud není náhrada)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Přídavné složky:"

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Všechny unity balíčku"

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Všechny unity v editoru zdrojáků"

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Všechny unity"

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Defaultně jsou prohledány pouze otevřené unity a unity projektu. Přidejte sem seznam složek k prohledání oddělený středníkem."

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Složit všechny uzly"

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Rozbalit všechny uzly"

#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr "Soubor: %s"

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtrovat)"

#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr "Implementation Uses: %s"

#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr "implementation uses: %s"

#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr "Interface Uses: %s"

#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr "interface uses: %s"

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projekt a balíčky"

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Skenování ..."

#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr "Skenování: %s unit(y) ..."

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Hledat)"

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Najít další výskyt této fráze"

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Najít další unitu s touto frází"

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Najít předchozí výskyt této fráze"

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Najít předchozí unitu s touto frází"

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Vybrané unity"

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Zobrazit uzly pro složky"

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Zobrazit uzly pro projekt a balíčky"

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unity"

#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr "Unity: %s"

#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr "Použito v Implementacích: %s"

#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr "použito v implementacích: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr "Použito v Rozhratních: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr "použito v rozhraních: %s"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Neukazovat znova tuto zprávu."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Chyba v regulárním výrazu"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Písmo bez UTF-8"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Přejít na řádek:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nenalezeno"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Nahradit výskyty \"%s\"%s s \"%s\"?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Hledání: %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Pokračovat v hledání od začátku?"

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Pokračovat v hledání od konce?"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Hledaný řetězec '%s' nenalezen!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Aktuální písmo editoru nepodporuje UTF-8, ale váš sytém vypadá, že ho používá.%sTo znamená, že ne-ASCII budou pravděpodobně zobrazeny nekorektně.%sMůžete vybrat jiný font v nastavení editoru."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Smazat vyrovnávací paměť pro include"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bajtů"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Zahrnut tímto:"

#: lazarusidestrconsts.lisuidinproject
#, fuzzy
#| msgid "in Project:"
msgid "In project:"
msgstr "v projektu:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Řádky:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Jméno:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "ne"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Velikost:"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "ano"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Ukázat hodnoty CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Nelze převést binární proud na text"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Nelze zkopírovat komponenty do schránky"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, fuzzy
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Nelze přidat zdrojovou hlavičku do souboru zdrojů %s\"%s\".%sNejspíše chyba syntaxe."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, fuzzy
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Nelze přidat zdroj T%s:FORMDATA do souboru zdrojů %s\"%s\".%sPravděpodobně syntaktická chyba."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgstr "Nelze přidat závislost %s, neboť balíček %s má již závislost %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgstr "Nelze přidat závislost %s, protože by vznikla kruhová závislost. Závislost %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Do projektu nelze přidat %s, přestože projekt už obsahuje jednotku se stejným jménem."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Nelze zálohovat soubor \"%s\" do \"%s\"!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNelze změnit jméno třídy %s na %s"

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "Nelze změnit titulek projektu ve zdrojích.%s%s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nelze vyčistit cílový adresář"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Nelze vyčistit \"%s\".%sProsím, zkontrolujte přístupová práva."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Nelze převést text komponenty do binárního formátu:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Nelze převést soubor \"%s\"%sChyba: %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, fuzzy
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Nelze převést textová data formuláře souboru %s\"%s\"%sdo binárního proudu. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Soubor nelze zkopírovat"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "Nelze zkopírovat soubor \"%s\"%sna \"%s\""

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory \"%s\"."
msgstr "Nelze vytvořit záložní adresář \"%s\"."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory \"%s\"."
msgstr "Nelze vytvořit adresář \"%s\"."

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nelze vytvořit soubor"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file \"%s\""
msgstr "Nelze vytvořit soubor \"%s\""

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s\"%s\""
msgstr "Nelze vytvořit soubor %s\"%s\""

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "Nelze vytvořit odkaz \"%s\" s cílem \"%s\""

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file, because there is already a directory with this name."
msgstr "Nelze vytvořit nový soubor, jelikož již existuje adresář stejného jména."

#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Nelze vytvořit novou metodu."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Nelze vytvořit dočasnou paměť pro lfm."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Nelze smazat"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Nelze odstranit mnohoznačný soubor \"%s\""

#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr "nemožno spustit: %s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Nelze najít sekci ResourceString v této nebo některé z použitých jednotek."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in \"%s\""
msgstr "Nelze najít platné jméno třídy v \"%s\""

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file \"%s\"."
msgstr "Nelze nalézt soubor \"%s\"."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Nelze najít soubor \"%s\".%sPokud patří do Vašeho projektu, zkontrolujte cestu hledání v %sProjekt -> Volby překladače -> Prohledávané cesty -> Ostatní soubory jednotek. Pokud tento soubor patří do balíčku, zkontrolujte příslušné volby překladače balíčku. Pokud tento soubor patří do Lazarusu, ujistěte se čistým přeložením. Pokud soubor patří do FPC, zkontrolujte fpc.cfg. Pokud si nejste jistí, použijte Projekt -> Volby překladače -> Test"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Nelze najít %s v proudu LFM."

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Nelze najít metodu."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Nelze najít pascalovskou jednotku (.pas,.pp) pro soubor .lfm %s\"%s\""

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Nelze najít komponentu třídy \"%s\".%sNení registrována pomocí RegisterClass a nebyl nalezen žádný lfm soubor.%sJe vyžadována jednotkou:%s%s"

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Nelze získat změny v editoru."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Nelze získat zdroj pro návrhář."

#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr "Nelze nahrát soubor %s: %s"

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package \"%s\""
msgstr "Nelze přečíst balíček \"%s\""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, fuzzy
msgid "Unable to load the component class \"%s\", because it depends on itself."
msgstr "Nelze načíst třídu komponenty \"%s\", protože závisí na sobě samé."

#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr "Nemožno otevřít \"%s\""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Nelze otevřít komponentu předka"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Nelze přečíst %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nelze přečíst soubor"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file \"%s\"."
msgstr "Nelze přečíst soubor \"%s\"!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "Nelze číst soubor \"%s\"%sChyba: %s"

#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "Nelze číst lpi"

#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "Selhalo čtení Exit Kódu procesu"

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "Nelze číst informační soubor projektu%s\"%s\"."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Nelze odstranit starý záložní soubor \"%s\"!"

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Nelze odstranit titulek projektu ze zdrojů.%s%s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Nelze přejmenovat víceznačný soubor \"%s\"%sna \"%s\""

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Soubor nelze přejmenovat"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "Nelze přejmenovat soubor \"%s\" na \"%s\"!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "Nelze přejmenovat soubor \"%s\"%sna \"%s\"."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nelze přejmenovat formulář ve zdrojovém souboru."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nelze přejmenovat metodu. Prosím vyřešte chybu ukázanou v okně zpráv."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nelze přejmenovat proměnnou ve zdrojovém souboru."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Nelze spustit"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Nelze nastavit AnchorSide Control"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Nelze zobrazit metodu."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Nelze zřetězit vybranou komponenty"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Nelze zřetězit vybrané komponenty."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nelze zřetězit %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nelze převést komponentu v binárním proudu %s:T%s na text."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nelze zaktualizovat příkaz CreateForm v zdrojovém souboru projektu"

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write \"%s\""
msgstr "Nelze zapisovat do \"%s\""

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Nelze zapsat soubor"

#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr "Nemožný zápis do souboru \"%s\"."

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "Nelze zapisovat do souboru \"%s\"%sChyba: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "Nelze zapisovat do informačního souboru projektu %s\"%s\".%sChyba: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Nelze zapsat soubor sezení projektu%s\"%s\".%sChyba: %s"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Nelze zapsat do souboru \"%s\"."

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Nelze zapsat xml proud do %s%sChyba: %s"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Zruš výběr všech"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Vrátit zpět"

#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr "Odinstalovat %s"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Odinstalování není možné"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Odinstalovat vybrané?"

#: lazarusidestrconsts.lisunit
#, fuzzy
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit \"%s\" has changed. Save?"
msgstr "Jednotka \"%s\" byla změněna. Uložit?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identifikátor jednotky již existuje"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s"
msgstr "%s jednotka %s v balíčku %s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Jméno jednotky je už v projektu"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Jméno jednotky začíná s..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Jméno jednotky obsahuje..."

#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr "unita %s nenalezena"

#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr "unita %s nenalezena na místě \"%s\""

#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr "Jednotka nenalezena v projektu %s"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Výstupní adresář jednotky"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "cesta jednotky"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Cesty jednotky"

#: lazarusidestrconsts.lisunitrequirespackage
msgid "unit %s requires package %s"
msgstr "unita %s vyžaduje balíček %s"

#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr "Jednotky nenalezeny v projektu %s"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Bez znaménka"

#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr "Nepoužité unity z %s"

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Neobvyklé jméno překladače. Obvykle začíná fpc, ppc nebo ppcross."

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Nahoru"

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Aktualitovat info"

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Aktualizovat ostatní podpisy procedur když se změnila pouze velikost písmen"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Aktualizovat odkazy?"

#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr ""

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Povýšit"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Povýšit konfiguraci"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "řetězec velkými písmeny"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Řetězec velkými písmeny předán jako parametr"

#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr ""

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Zpráva o použití (volba -h)"

#: lazarusidestrconsts.lisuseandclose
msgid "Use and close"
msgstr "Použít a zavřít"

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Použít Ansi řetězce"

#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr ""

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Použít komentáře ve vlastních volbách"

#: lazarusidestrconsts.lisusedby
msgid " used by %s"
msgstr "užito %s"

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Použít balíčky návrhu"

#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr ""

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use exclude filter"
msgstr "Použít filtr vyřazení"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Použít identifikátor"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Použít identifikátor %s v %s na %s"

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use include filter"
msgstr "Použít filtr zahrnutí"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Spouštím aplikaci"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Použít balíček %s v balíčku %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Použít balíček v balíčku"

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Použít balíček %s v projektu"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Použít balíček v projektu"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr "Přidat na seznam \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Uživatelem definované značkování v textu"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr "Odebrat ze seznamu \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr "Přepnout na seznamu \"%s\""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Uživatelský domovský adresář"

#: lazarusidestrconsts.lisusesub
msgctxt "lazarusidestrconsts.lisusesub"
msgid "Use >>"
msgstr "Použít >>"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Přidat jednotku do sekce použitých jednotek"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Použít jednotku %s v jednotce %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 s BOM"

#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Hodnota%s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Hodnota: "

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Hodnoty"

#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr ""

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Proměnná"

#: lazarusidestrconsts.lisverbose
msgid "Verbose"
msgstr "Výřečný"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Ověřit volání metod"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Verze"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Konflikt verzí"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Svislý"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Zkopírovat informace o verzi do schránky"

#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Velmi Výřečný"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Vlastnosti Bodu přerušení ..."

#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Zobrazit zdroje"

#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Zobrazit assembler"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Zobrazit zdroj (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Varování: "

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Varování: víceznačný soubor nalezen: \"%s\". Zdrojový soubor je: \"%s\""

#: lazarusidestrconsts.liswarnings
#, fuzzy
#| msgid ", Warnings:%s"
msgid ", Warnings: %s"
msgstr "Varování:%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sVarování: Toto je hlavní jednotka. Nová hlavní jednotka bude %s.pas"

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Sledování"

#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "Kukátko:"

#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Akce kukátka"

#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Čtení"

#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Čtení/Zápis"

#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Zápis"

#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "Data/Sledovat bod přerušení ..."

#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "Data/Sledovat bod přerušení ..."

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Vlastnosti sledování"

#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Rozsah sledování"

#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Celkový"

#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Deklarace"

#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Vytvořit data/Sledovat bod přerušení ..."

#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Vítejte v Lazarus IDE %s"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, fuzzy
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Vítejte v Lazarusu %s%sJiž existuje konfigurace z verze %s v %s%s"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Co potřebuje sestavit"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Aktualizuj odkazy, pokud je jednotka přejmenována"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "pokud je povoleno, aktuální nastavení jsou uloženy do šablony, která je použita při vytváření projektů"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Ukázat aktuální uzel v průzkumníku kódu při pohybu kurzoru v editoru zdrojového kódu"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Menu okna zobrazuje jméno navrhovaného formuláře namísto jeho popisku"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Užitečné zejména když je titulek (Caption) okna prázdný"

#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Okno Zůstává Vždy Nahoře"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", se zahrnutými "

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Bez správného překladače nebude procházení kódu a překlad dokonalé."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Bez správného ladiče bude ladění neuspokojivé."

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Bez správného adresáře Lazarusu dostanete mnoho varování."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Bez správného spustitelného \"make\" není možný překlad IDE."

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Bez příslušných zdrojů FPC bude procházení a doplňování kódu velmi omezené."

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "S požadovanými balíčky"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Sma&zat vše"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Z&akázat vše"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "&Povolit vše"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Výraz"

#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr "Okno průzkumníka"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Vlastnosti"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch List"
msgstr "Seznam sledování"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Slovo na pozici kurzoru v aktuálním editoru"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Pracovní složka pro sestavení"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Pracovní složka pro spuštění"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Chyba zápisu: %s%sSoubor: %s%s%s"

#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr "špatná verze v %s: %s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Chyba XML"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "XML soubory"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Chyba XML analyzátoru v souboru %s%sChyba: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Toto můžete zakázat pro jednotlivé formuláře v editoru balíčku"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Můžete to vypnout pro jednotlivé formuláře pomocí kontextového menu v Inspektoru projektu"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "Můžete stáhnout FPC a zdroje FPC z http://sourceforge.net/projects/lazarus/?source=directory"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Nemůžete sestavit lazarus v průběhu ladění nebo překládání."

#: lazarusidestrconsts.lis_all_
#, fuzzy
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Všechno>"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Odstranit vybrané"

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "neplatný"

#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr "neplatný lpk soubor (%s)"

#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr "platný lpk soubor (%s)"

#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr "Nebylo možné odstanit soubor \"%s\""

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "platný"

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Přeskenovat lpl soubory"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Přidat jednotku balíčku do sekce uses"

#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binární"

#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Číselný"

#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Zobraz typ vybraných registrů"

#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr "Formát"

#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Šestnáctkově"

#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Osmičkově"

#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Beze změny"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Přidat inverzi"

#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr "Připojit k"

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Atributy"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Automaticky zvyšovat číslo sestavení"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr ""

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Sestavení:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Mapa znaků:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Zavřít aktuální složku"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Podmíněné definice"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Vytvořit novou definici"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Povolit i18n"

#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr "Zadejte PID"

#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Filtrovat řádky v seznamu s řetězcem"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Datový soubor formuláře (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Nalezeno, ale zde nevypsáno: "

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Nastavení i18n"

#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr ""

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Zahrnout informaci o verzi ve spustitelném souboru"

#: lazarusidestrconsts.rsiwpcolumnnameshint
msgid "Column Names"
msgstr "Názvy Sloupců"

#: lazarusidestrconsts.rsiwpcolumnstrategyhint
msgid "Strategy for saving Columns"
msgstr "Strategie pro ukládání Sloupců"

#: lazarusidestrconsts.rsiwpcolumnwidthhint
msgid "Column Width"
msgstr "Šířka Sloupce"

#: lazarusidestrconsts.rsiwpcustomgeometry
msgid "Custom geometry"
msgstr "Vlastní geometrie"

#: lazarusidestrconsts.rsiwpcustomgeometryhint
msgid "User can define window's position and size"
msgstr "Uživatel může definovat rozměry a pozici okna"

#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
msgid "Fixed default geometry"
msgstr "Fixní výchozí geometrie"

#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
msgid "Always the same fixed position and size"
msgstr "Vždy stejná fixovaná velikost a pozice"

#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
msgid "Let windowmanager decide"
msgstr "Nechat správce oken rozhodnout"

#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
msgid "System windowmanagers have different strategies for positioning windows"
msgstr "Systémoví správci oken mají různé strategie pro pozicování oken"

#: lazarusidestrconsts.rsiwppositionwindowlisthint
msgid "Windows that have been open. They may be closed now."
msgstr "Okna, která byla otevřena. Měla by být zavřena teď."

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Obnovit rozměry okna"

#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
msgid "Use previous position and size"
msgstr "Použít předchozí velikost a pozici"

#: lazarusidestrconsts.rsiwpsplittercustomposition
msgid "Custom Size"
msgstr "Vlastní velikost"

#: lazarusidestrconsts.rsiwpsplitterdefault
msgid "Default Size"
msgstr "Přednastavená velikost"

#: lazarusidestrconsts.rsiwpsplitterfollowwindow
msgid "Restore with window"
msgstr "Obnovit s oknem"

#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
msgid "Restore Size"
msgstr "Obnovit velikost"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikánština"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabština"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr "Automaticky (nebo Angličtina)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Katalánština"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Čínština"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Čeština"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandština"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Angličtina"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finština"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francouzsština"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Němčina"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebrejština"

#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr "Maďarština"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonésština"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italština"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonština"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litevština"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Nastavení jazyka"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polština"

#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Portugalština"

#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Brazilská portugalština"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Ruština"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Výběr jazyka:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovenština"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Španělština"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turečtina"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrajinština"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Hlavní verze:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Ve&dlejší verze:"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Jiné informace"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Výstupní adresář pro PO:"

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Zdroj"

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Vymazat všechny zdroje?"

#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr "Jméno souboru"

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revize:"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Vybrat zděděnou položku"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Začít nové hledání"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Číslování verze"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Příkazy menu Nápověda"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Příkazové příkazy"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Příkazy CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Příkazy výběru textových sloupců"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Příkazy přesunu ukazatele"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Příkazy editace textu"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Příkazy menu Soubor"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Příkazy skládání textu"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makra"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Příkazy označení textu"

#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr ""

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Příkazy menu Balíček"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Příkazy menu Projekt"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Spustit příkazy menu"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Příkazy hledání a nahrazení textu"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Příkazy výběru textu"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Příkazy zdrojového zápisníku"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Editování Syncron"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Úpravy Syncron (ne v buňce)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Úpravy Syncron (při výběru)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Editování šablony"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Úprava šablony (ne v buňce)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Příkazy menu Nástroje"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Zobrazit příkazy menu"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Příkaz:"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "přerušit sestavení"

#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Abstraktní metody ..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "přidat adresu bodu přerušení"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "přidat zdroj bodu přerušení"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "přidat data/kukátko"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Přidat bod skoku"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "přidat sledování"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Připojit k programu"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Dokončování šablon kódu"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Kopírovat blok"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Vymazat blok"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Jdi na začátek bloku"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Jít na konec bloku"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Skrýt blok"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Odsadit blok"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Přesunout blok"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Nastavit začátek bloku"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Nastavit konec bloku"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Ukázat blok"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Přepnout blok"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Vrátit odsazení bloku"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Sestavit program/projekt"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "sestavit soubor"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Sestavit lazarus"

#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr ""

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Znak"

#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr ""

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Odstranit celý text"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Vyčistit všechny záložky"

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Vyčistit záložky pro aktuální soubor"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Sloupec Vybrat dolů"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Sloupcový výběr do úplného konce"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Sloupcový výběr do úplného začátku"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Sloupec Vybrat vlevo"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Sloupec Vybrat ke konci řádku"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Sloupce Vybrat k začátku řádku"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Sloupce Vybrat k začátku v řádku"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Sloupec Vybrat k spodku stránky"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Sloupec Vybrat spodek stránky"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Sloupec Vybrat vrch stránky"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Sloupec Vybrat stránku nahoru"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Sloupec Vybrat vpravo"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Sloupec Vybrat nahoru"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Sloupec Vybrat slovo vlevo"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Sloupec Vybrat slovo vpravo"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Režim výběru sloupce"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "přeložit program/projekt"

#: lazarusidestrconsts.srkmeccompletecode
msgctxt "lazarusidestrconsts.srkmeccompletecode"
msgid "Complete Code"
msgstr "Dokončení kódu"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "konfigurační soubor sestavení"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Zkopírovat výběr do schránky"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Kopírovat editor do nového okna"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Kopírovat editor do dalšího volného okna"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Kopírovat editor do předešlého volného okna"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Vyjmout výběr do schránky"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Odstranit k začátek řádku"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Odstranit znak na pozici kurzoru"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Smazat ke konci řádku"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Odstranit poslední znak"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Odstranit k začátku slova"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Odstranit aktuální řádek"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Odstranit ke konci slova"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Odpojit od programu"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Rozdíl"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Přesunout kurzor dolů"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Přesunout ukazatel na úplný konec"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Přesunout ukazatel na úplný začátek"

#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Prázdné metody ..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Volby IDE"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "vyhodnocení/upravení"

#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Rozbalit proceduru"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Vnější nástroj %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Nastavení vnějších nástrojů"

#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Najít text"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Najít další konec bloku"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Najít začátek bloku"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Najít deklaraci"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Najít použití identifikátoru"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Najít v souborech"

#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Najít další"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Najít další výskyt slova"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Najít přetížené"

#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Najít přetížené ..."

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Najít předchozí"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Najít předchozí výskyt slova"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Najít definic procedury"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Najít metodu procedury"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Svinout na pozici ukazatele"

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Svinout do úrovně %d"

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Jít na editor %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Jít na direktivu include aktuálního vloženého souboru"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Jít na číslo řádku"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Jít na značku %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Jít na XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Hádat chybně umístěné $IFDEF"

#: lazarusidestrconsts.srkmechalfwordleft
#, fuzzy
#| msgid "Move cursor half-word left"
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Posunout kurzor půl slova vlevo"

#: lazarusidestrconsts.srkmechalfwordright
#, fuzzy
#| msgid "Move cursor half-word right"
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Posunout kurzor půl slova vpravo"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Vložit položku ZáznamZměn"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Vložit z mapy znaků"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Vložit klíčové slovo CVS Autor"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Vložit klíčové slovo CVS Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Vložit klíčové slovo CVS Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Vložit klíčové slovo CVS ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Vložit klíčové slovo CVS Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Vložit klíčové slovo CVS Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Vložit klíčové slovo CVS Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Vložit klíčové slovo CVS Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Vložit aktuální datum a čas"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Vložit plné jméno souboru"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Vložit GPL poznámku"

#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Vložit GPL poznámku (přeloženo)"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Vložit GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Vložit LGPL poznámku"

#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Vložit LGPL  poznámku (přeloženo)"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Ukončit řádek a nechat kurzor"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Vložit MIT poznámku"

#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Vložit MIT poznámku (přeloženo)"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Režim vkládání"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Vložit upravenou LGPL poznámku"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Vložit upravenou LGPL poznámku (přeloženo)"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Vložit aktuální jméno uživatele"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "zkoumat"

#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Převrátit přiřazení"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Přesunout kurzor vlevo"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Ukončit řádek a přesunout kurzor"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Přesunout ukazatel na konec řádku"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Režim výběru řádku"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Přesunout ukazatel na začátek řádku"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Přesunout ukazatel na začátek textu v řádku"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Uzamknout editor"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Vytvořit zdrojový řetězec"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Přejít na odpovídající závorku"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Přesunout editor doleva"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Přesunout editor zcela vlevo"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Přesunout editor do nového okna"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Přesunout editor do dalšího prázdného okna"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Přesunout editor do předešlého volného okna"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Přesunout editor doprava"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Přesunout editor zcela vpravo"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Další značka"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Přejít na další editor"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Jít na další editor se stejným Zdrojem"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Jít na další okno"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Režim normálního výběru"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Otevřít soubor na pozici kurzoru"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Režim přepisu"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Přesunout ukazatel na spodek stránky"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Přesunout ukazatel o stránku níže"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Přesunout kurzor o stranu vlevo"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Přesunout kurzor o stranu vpravo"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Přesunout ukazatel o začátek stránky"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Přesunout ukazatel o jednu stránku výše"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Vložit schránku na aktuální pozici"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pozastavit program"

#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr ""

#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr ""

#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr ""

#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr ""

#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr ""

#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr ""

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Předchozí značka"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Přejít na předchozí editor"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Jít na předchozí editor se stejným Zdrojem"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Jít na předchozí okno"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "rychlý překlad, bez spojení"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "odebrat bod přerušení"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Odebrat prázdné metody"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Odebrat nepoužívané jednotky"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Přejmenovat identifikátor"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Nahradit text"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Hlášení závady"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "resetovat ladič"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Přesunout kurzor vpravo"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "spustit program"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "spustit soubor"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "spustit s parametry"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolovat dolů o jeden řádek"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolovat vlevo o jeden znak"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolovat vpravo o jeden znak"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolovat nahoru o jeden řádek"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Vybrat dolní"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Vybrat vše"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Převést ve výběru tabulátory na mezery"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Vybrat po úplný konec"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Vybrat po úplný začátek"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Vybrat Goto XY"

#: lazarusidestrconsts.srkmecselhalfwordleft
#, fuzzy
#| msgid "Select half-word left"
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Vybrat půl slova vlevo"

#: lazarusidestrconsts.srkmecselhalfwordright
#, fuzzy
#| msgid "Select half-word right"
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Vybrat půl slova vpravo"

#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Vybrat vlevo"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Vybrat konec řádku"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Vybrat začátek řádku"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Vybrat k začátku text v řádku"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Vybrat spodek stránky"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Vybrat stránku dole"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Vybrat stránku vlevo"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Vybrat stránku vpravo"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Vybrat vrch stránky"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Vybrat stránku nahoře"

#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Vybrat vpravo"

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Začít lepicí výběr"

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Začít lepicí výběr (sloupcový)"

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Začít lepicí výběr (řádkový)"

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Ukončit lepicí výběr"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Vybrat nahoru"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Vybrat do konce slova vlevo"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Vybrat do konce slova vpravo"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Vybrat slovo nalevo"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Vybrat slovo napravo"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastavit volnou Záložku"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Nastavit značku %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Ukázat abstraktní metody"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Ukázat obsah kódu"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "ukázat bod vykonávání"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "zastavit program"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Přehrát makro"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Nahrát makro"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Jít na poslední pozici v buňce"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Jít na první pozici v buňce"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Vybrat buňku"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Odejít"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Další buňka"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Další buňka (všechny vybrané)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Další buňka (pouze první)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Další buňka (všechny vybrané / pouze první)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Předchozí buňka"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Předchozí buňka (všechny vybrané)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Předchozí buňka (pouze první)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Předchozí buňka (všechny vybrané / pouze první)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Spustit editor Syncro"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Přejít na poslední pozici v buňce"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Přejít na první pozici v buňce"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Vybrat buňku"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Odejít"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Dokončit"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Další buňka"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Další buňka (rotace)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Další buňka (všechny vybrané)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Další buňka (rotace / všechny vybrané)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Další buňka (pouze první)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Další buňka (kruhově / pouze první)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Další buňka (všechny vybrané / pouze první)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Další buňka (kruhově / všechny vybrané / pouze první)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Předchozí buňka"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Předchozí buňka (všechny vybrané)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Předchozí buňka (pouze první)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Předchozí buňka (všechny vybrané / pouze první)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Kontrola syntaxe"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Zobrazit assembler"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "prohodit bod přerušení"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Zobrazit body zastavení"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Zobrazit volací zásobník"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Zobrazit prohlížeč kódu"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Zobrazit průzkumník kódu"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Zobrazit sadu komponent"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Zobrazit výstup ladícího nástroje"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Přepnout mezi formulářem a jednotkou"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Zobrazit editor dokumentace"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Zobrazit rychlá tlačítka IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Zobrazit místní proměnné"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Prohodit Značkovač %d"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Prohodit zvýraznění aktuálního slova"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Zobrazit hlášení"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Přepnout režim"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Zobrazit inspektor objektů"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Zobrazit registry"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Zobrazit prohlížeč omezení"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Zobrazit výsledky hledání"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Zobrazit editor zdrojů"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Zobrazit sledovače"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Rozevřít vše"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Rozevřít na pozici ukazatele"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "neznámý příkaz editoru"

#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Nepoužité jednotky ..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Přesunout kurzor nahoru"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Zobrazit editor kotev"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Zobrazit komponenty"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Zobrazit makra editoru"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Zobrazit formuláře"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Ukázat historii"

#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View Terminal Output"
msgstr "Ukázat výstup terminálu"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Ukázat pořadí záložek"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Ukázat vlákna"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Zobrazit závislosti jednotky"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Zobrazit informace o jednotkách"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Zobrazit jednotky"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Doplnění slova"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Posunout kurzor na konec slova vlevo"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Posunout kurzor na konec slova vpravo"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Přesunout ukazatel o slovo doleva"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Přesunout ukazatel o slovo doprava"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Upravit klávesy povelů"

#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr ""

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Složit komentáře"

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Zabalit komentáře ve výběru"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Složit neaktivní Ifdef"

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Složit neaktivní Ifdef (vyloučit smíšený stav)"

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Složit neaktivní Ifdef ve výběru"

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Složit neaktivní IfDef ve výběru (vyloučit smíšený stav) "

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Skrýt komentáře"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Skrýt komentáře ve výběru"

#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr ""

#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr ""

#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr ""

#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr ""

#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr ""

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Rozložit aktivní IfDef"

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Rozložit aktivní Ifdef ve výběru"

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Rozevřít vše"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Rozložit všechny Ifdef"

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Rozložit všechny Ifdef ve výběru"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Rozbalit všechny komentáře ve výběru"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Rozložit komentáře"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Rozbalit komentáře ve výběru"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Rozložit neaktivní Ifdef"

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Rozložit neaktivní Ifdef ve výběru"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Soubor je pouze ke čtení"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Soubor \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" není zapisovatelný."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Zamknutý"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Nahrávání"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Pozastavit"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Přidat &Sledování v místě kurzoru"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Přidat kukátko na kurzor"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Značka"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Zavřít všechny &ostatní stránky"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Zavřít stránku"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Zkopírovat název souboru"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Klonovat do nového okna"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Klonovat do jiného Okna"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nové okno"

#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Ladění"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kódování"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Vyhodnocení/Upravení ..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Najít deklaraci"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Najít v ostatních oknech"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Skok na značku"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Zvýrazňovač"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Zkoumat ..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Převrátit přiřazení"

#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Konec řádku"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Uzamknout stránku"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Přesunout stránku doleva"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Přesunout stránku nejvíce doleva"

#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Přesunout stránku doprava"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Přesunout stránku nejvíce doprava"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Přesunout do nového Okna"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Přesunout do jiného Okna"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nové okno"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Přejít na další záložku"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Změněný"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Otevřít soubor na pozici kurzoru"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Přejít na předchozí záložku"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Skok procedury"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Pouze pro čtení"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Spustit po kurzor"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Nastavit volnou Záložku"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zobrazovat čísla řádků"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Zdroj"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Přepnout záložku"

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Přepnout záložku"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Zobrazit volací zásobník"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Doposud neimplementováno"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "VLO"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "PŘE"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Pouze pro čtení"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informace o verzi"