Translations: Hungarian translation update by Péter Gábor, bug #26425

git-svn-id: trunk@45744 -
2025-08-27 00:40:18 +02:00 · 2014-07-01 22:59:27 +00:00 · 2014-07-01 22:59:27 +00:00 · 391e3f7bb5
commit 391e3f7bb5
parent 07f3cb99aa
32 changed files with 1961 additions and 1225 deletions
--- a/.gitattributes
+++ b/.gitattributes
@ -249,6 +249,7 @@ components/activex/importtypelib.lfm svneol=native#text/plain
 components/activex/importtypelib.pas svneol=native#text/plain
 components/activex/languages/activexstrconsts.cs.po svneol=native#text/plain
 components/activex/languages/activexstrconsts.fi.po svneol=native#text/plain
+components/activex/languages/activexstrconsts.hu.po svneol=native#text/plain
 components/activex/languages/activexstrconsts.po svneol=native#text/plain
 components/activex/languages/activexstrconsts.ru.po svneol=native#text/plain
 components/activex/lazactivexreg.pas svneol=native#text/plain
@ -1234,6 +1235,7 @@ components/fpcunit/ide/fpcunitlazideintf.pas svneol=native#text/pascal
 components/fpcunit/ide/fpcunitproject1.inc svneol=native#text/plain
 components/fpcunit/ide/fpcunitproject1.pas svneol=native#text/plain
 components/fpcunit/ide/languages/fpcunitlazideintf.cs.po svneol=native#text/plain
+components/fpcunit/ide/languages/fpcunitlazideintf.hu.po svneol=native#text/plain
 components/fpcunit/ide/languages/fpcunitlazideintf.it.po svneol=native#text/plain
 components/fpcunit/ide/languages/fpcunitlazideintf.lt.po svneol=native#text/plain
 components/fpcunit/ide/languages/fpcunitlazideintf.po svneol=native#text/plain
@ -1242,6 +1244,7 @@ components/fpcunit/ide/languages/fpcunitlazideintf.ru.po svneol=native#text/plai
 components/fpcunit/ide/languages/fpcunitlazideintf.uk.po svneol=native#text/plain
 components/fpcunit/ide/languages/strtestcaseopts.cs.po svneol=native#text/plain
 components/fpcunit/ide/languages/strtestcaseopts.de.po svneol=native#text/plain
+components/fpcunit/ide/languages/strtestcaseopts.hu.po svneol=native#text/plain
 components/fpcunit/ide/languages/strtestcaseopts.it.po svneol=native#text/plain
 components/fpcunit/ide/languages/strtestcaseopts.lt.po svneol=native#text/plain
 components/fpcunit/ide/languages/strtestcaseopts.po svneol=native#text/plain
@ -1526,6 +1529,7 @@ components/fpweb/images/tag_u.png -text svneol=unset#image/png
 components/fpweb/images/tag_ul.png -text svneol=unset#image/png
 components/fpweb/languages/fpwebstrconsts.cs.po svneol=native#text/plain
 components/fpweb/languages/fpwebstrconsts.de.po svneol=native#text/plain
+components/fpweb/languages/fpwebstrconsts.hu.po svneol=native#text/plain
 components/fpweb/languages/fpwebstrconsts.it.po svneol=native#text/plain
 components/fpweb/languages/fpwebstrconsts.lt.po svneol=native#text/plain
 components/fpweb/languages/fpwebstrconsts.po svneol=native#text/plain
@ -1534,6 +1538,7 @@ components/fpweb/languages/fpwebstrconsts.ru.po svneol=native#text/plain
 components/fpweb/languages/fpwebstrconsts.uk.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.cs.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.de.po svneol=native#text/plain
+components/fpweb/languages/fpwebtoolsunit.hu.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.it.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.lt.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.po svneol=native#text/plain
@ -1542,6 +1547,7 @@ components/fpweb/languages/fpwebtoolsunit.ru.po svneol=native#text/plain
 components/fpweb/languages/fpwebtoolsunit.uk.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.cs.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.de.po svneol=native#text/plain
+components/fpweb/languages/frmrpcmoduleoptions.hu.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.it.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.lt.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.po svneol=native#text/plain
@ -1549,6 +1555,7 @@ components/fpweb/languages/frmrpcmoduleoptions.pt_BR.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.ru.po svneol=native#text/plain
 components/fpweb/languages/frmrpcmoduleoptions.uk.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.cs.po svneol=native#text/plain
+components/fpweb/languages/reglazwebextra.hu.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.it.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.lt.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.po svneol=native#text/plain
@ -1556,6 +1563,7 @@ components/fpweb/languages/reglazwebextra.pt_BR.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.ru.po svneol=native#text/plain
 components/fpweb/languages/reglazwebextra.uk.po svneol=native#text/plain
 components/fpweb/languages/weblazideintf.cs.po svneol=native#text/plain
+components/fpweb/languages/weblazideintf.hu.po svneol=native#text/plain
 components/fpweb/languages/weblazideintf.it.po svneol=native#text/plain
 components/fpweb/languages/weblazideintf.lt.po svneol=native#text/plain
 components/fpweb/languages/weblazideintf.po svneol=native#text/plain
@ -2703,6 +2711,7 @@ components/macroscript/emsideoptions.lfm svneol=native#text/pascal
 components/macroscript/emsideoptions.pas svneol=native#text/pascal
 components/macroscript/emsselftest.pas svneol=native#text/pascal
 components/macroscript/emsstrings.pas svneol=native#text/pascal
+components/macroscript/languages/emsstrings.hu.po svneol=native#text/plain
 components/macroscript/languages/emsstrings.po svneol=native#text/plain
 components/macroscript/languages/emsstrings.ru.po svneol=native#text/plain
 components/macroscript/registerems.pas svneol=native#text/pascal
--- a/components/activex/languages/activexstrconsts.hu.po
+++ b/components/activex/languages/activexstrconsts.hu.po
@ -0,0 +1,49 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"Language: hu\n"
+"X-Generator: Poedit 1.5.4\n"
+
+#: activexstrconsts.axconvertdependanttypelibs
+msgid "Convert dependant typelibs"
+msgstr "Alárendelt típustárak átalakítása"
+
+#: activexstrconsts.axcreatepackage
+msgid "Create package"
+msgstr "Csomag létrehozása"
+
+#: activexstrconsts.axcreatevisualcomponenttactivexcontainerdescendant
+msgid "Create visual component (TActiveXContainer descendant)"
+msgstr "Vizuális komponens létrehozása (TActiveXContainer leszármazott)"
+
+#: activexstrconsts.axfilecontainingtypelibrary
+msgid "File containing type library:"
+msgstr "Típustárat tartalmazó fájl:"
+
+#: activexstrconsts.aximporttypelibrary
+msgid "Import Type Library"
+msgstr "Típustár importálása"
+
+#: activexstrconsts.aximporttypelibrarymenu
+msgid "Import Type Library ..."
+msgstr "Típustár importálása ..."
+
+#: activexstrconsts.axselectdirectorytostorepackageplpk
+msgid "Select directory to store package %sP.lpk"
+msgstr "Könyvtár választása a(z) %sP.lpk csomag tárolásához"
+
+#: activexstrconsts.axtypelibraryfilestlbdllexeocxolbtlbdllexeocxolballf
+msgid ""
+"Type library files (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;*.ocx;*."
+"olb|All Files (*.*)|*.*"
+msgstr ""
+"Típustár fájlok (*.tlb;*.dll;*.exe;*.ocx;*.olb)|*.tlb;*.dll;*.exe;*.ocx;*."
+"olb|Minden fájl (*.*)|*.*"
--- a/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po
+++ b/components/chmhelp/packages/idehelp/languages/lazchmhelp.hu.po
@ -28,8 +28,10 @@ msgid "Missing lhelp"
 msgstr "Hiányzó lhelp"

 #: lazchmhelp.help_unabletofindthelhelpviewerpleasecompilethelhelppro
-#, fuzzy
-#| msgid "Unable to find the lhelp viewer:%s%s%s%sPlease compile the lhelp project:%s%s"
-msgid "Unable to find the lhelp viewer:%s%s%sPlease compile the lhelp project:%s%s"
-msgstr "Az lhelp megjelenítő nem található:%s%s%s%sFordítsa le az lhelp projektet:%s%s"
-
+#| msgid ""
+#| "Unable to find the lhelp viewer:%s%s%s%sPlease compile the lhelp project:"
+#| "%s%s"
+msgid ""
+"Unable to find the lhelp viewer:%s%s%sPlease compile the lhelp project:%s%s"
+msgstr ""
+"Az lhelp megjelenítő nem található:%s%s%sFordítsa le az lhelp projektet:%s%s"
--- a/components/education/languages/eduoptions.hu.po
+++ b/components/education/languages/eduoptions.hu.po
@ -18,15 +18,15 @@ msgstr "Oktatás"

 #: eduoptions.ersaddanentrytothenewdialogtocreateanewprogram
 msgid "Add an entry to the %sNew ...%s dialog to create a new program"
-msgstr ""
+msgstr "Elem hozzáadása az %sÚj ...%s párbeszédhez új program létrehozására"

 #: eduoptions.ersaddanidemenuitemtocreateanewprogram
 msgid "Add an IDE menu item to create a new program"
-msgstr ""
+msgstr "IDE menüelem hozzáadása új program létrehozására"

 #: eduoptions.ersaddaspeedbuttontotheidetoolbartocreateanewprogram
 msgid "Add a speed button to the IDE toolbar to create a new program"
-msgstr ""
+msgstr "Gyorsgomb hozzáadása az IDE eszköztárához új program létrehozására "

 #: eduoptions.ersaddicon
 msgid "Add icon"
@ -38,7 +38,7 @@ msgstr "Menüelem hozzáadása"

 #: eduoptions.ersaddtonewdialog
 msgid "Add to %sNew ...%s dialog"
-msgstr ""
+msgstr "Hozzáadás az %sÚj ...%s párbeszédhez"

 #: eduoptions.ersasimpleprogramonlyonefileiscreatedandaddedtothecur
 msgid ""
@ -175,7 +175,7 @@ msgstr "Objektumfelügyelő-lapok megjelenítése"

 #: eduoptions.ersshowselection
 msgid "Show Selection"
-msgstr ""
+msgstr "Kijelölés megjelenítése"

 #: eduoptions.erssinglefileprogram
 msgid "Single file program"
--- a/components/fpcunit/ide/languages/fpcunitlazideintf.hu.po
+++ b/components/fpcunit/ide/languages/fpcunitlazideintf.hu.po
@ -0,0 +1,51 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: fpcunitlazideintf.sfpcunconsoletestapp
+msgid "FPCUnit Console Test Application"
+msgstr "FPCUnit Parancssoros Teszt Alkalmazás"
+
+#: fpcunitlazideintf.sfpcunconsoletestdesc
+msgid ""
+"FPCUnit Console Test Application%sAn application to run FPCUnit test cases "
+"in console mode.%sThe application source is automatically maintained by "
+"Lazarus."
+msgstr ""
+"FPCUnit Parancssoros Teszt Alkalmazás%sEgy alkalmazás FPCUnit tesztek "
+"futtatására parancssoros módban.%sAz alkalmazás forráskódját a Lazarus "
+"automatikusan karbantartja."
+
+#: fpcunitlazideintf.sfpcuntestapp
+msgid "FPCUnit Test Application"
+msgstr "FPCUnit Teszt Alkalmazás"
+
+#: fpcunitlazideintf.sfpcuntestappdesc
+msgid ""
+"FPCUnit Test Application%sAn application to run FPCUnit test cases.%sThe "
+"application source is automatically maintained by Lazarus."
+msgstr ""
+"FPCUnit Teszt Alkalmazás%sEgy alkalmazás FPCUnit tesztek futtatására.%sAz "
+"alkalmazás forráskódját a Lazarus automatikusan karbantartja."
+
+#: fpcunitlazideintf.sfpcuntestcase
+msgid "FPCUnit Test Case"
+msgstr "FPCUnit Teszt"
+
+#: fpcunitlazideintf.sfpcuntestcasedesc
+msgid "FPCUnit Test Case%sA unit containing a FPCUnit Test Case."
+msgstr "FPCUnit Teszt%sEgy unit, amely FPCUnit tesztet tartalmaz."
+
+#: fpcunitlazideintf.swriteyourowntest
+msgid "Write your own test"
+msgstr "Saját teszt írása"
--- a/components/fpcunit/ide/languages/strtestcaseopts.hu.po
+++ b/components/fpcunit/ide/languages/strtestcaseopts.hu.po
@ -0,0 +1,42 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: strtestcaseopts.sbtncreate
+msgid "Create unit"
+msgstr "Unit létrehozása"
+
+# (értsd: teszt felépítése)
+#: strtestcaseopts.schksetup
+msgid "Create Setup Method"
+msgstr "Felépítési eljárás létrehozása"
+
+#: strtestcaseopts.schktear
+msgid "Create TearDown method"
+msgstr "Bontási eljárás létrehozása"
+
+#: strtestcaseopts.sfrmtest
+msgid "TestCase Options"
+msgstr "Teszt beállítások"
+
+#: strtestcaseopts.sgrpfixture
+msgid "Fixture"
+msgstr "Kellékek"
+
+#: strtestcaseopts.sgrpnames
+msgid "Names"
+msgstr "Nevek"
+
+#: strtestcaseopts.slbldefault
+msgid "Default Test Name"
+msgstr "Alapértelmezett teszt neve"
--- a/components/fpweb/languages/fpwebstrconsts.hu.po
+++ b/components/fpweb/languages/fpwebstrconsts.hu.po
@ -0,0 +1,397 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"Language: hu\n"
+"X-Generator: Poedit 1.5.4\n"
+
+#: fpwebstrconsts.scssfile
+msgid "CSS file"
+msgstr "CSS fájl"
+
+#: fpwebstrconsts.scssfiledesc
+msgid "Create new CSS file ..."
+msgstr "Új CSS fájl létrehozása ..."
+
+#: fpwebstrconsts.scsssource
+msgid "Enter your classes/style definitions here"
+msgstr "Írja ide az osztály/stílus meghatározásokat"
+
+#: fpwebstrconsts.sdocumentlocation
+msgid "&Location"
+msgstr "&Hely"
+
+#: fpwebstrconsts.sdocumentroot
+msgid "&Directory"
+msgstr "&Könyvtár"
+
+#: fpwebstrconsts.senteryoutext
+msgid "Enter your text ..."
+msgstr "Írja be a szöveget ..."
+
+#: fpwebstrconsts.shtmlautor
+msgid "Html &author - <meta name=\"author\">"
+msgstr "HTML &szerző - <meta name=\"author\">"
+
+#: fpwebstrconsts.shtmlcharset
+msgid "HTML chars&et"
+msgstr "HTML &karakterkészlet"
+
+#: fpwebstrconsts.shtmlcopyright
+msgid "Html cop&yright - meta name=\"copyright\">"
+msgstr "HTML sze&rzői jog - meta name=\"copyright\">"
+
+#: fpwebstrconsts.shtmlcssfile
+msgid "&CSS file"
+msgstr "&CSS fájl"
+
+#: fpwebstrconsts.shtmldesign
+msgid "HTML design"
+msgstr "HTML tervezés"
+
+#: fpwebstrconsts.shtmlfile
+msgid "HTML file"
+msgstr "HTML fájl"
+
+#: fpwebstrconsts.shtmlfiledesc
+msgid "Create new HTML file ..."
+msgstr "Új HTML fájl létrehozása ..."
+
+#: fpwebstrconsts.shtmlinputformaccesskey
+msgid "Access key"
+msgstr "Hozzáférési billentyű"
+
+#: fpwebstrconsts.shtmlinputformalign
+msgid "Align"
+msgstr "Igazítás"
+
+#: fpwebstrconsts.shtmlinputformalt
+msgid "Alt"
+msgstr "Alt"
+
+#: fpwebstrconsts.shtmlinputformcaption
+msgid "Tag property: INPUT"
+msgstr "Cimke tulajdonság: INPUT"
+
+#: fpwebstrconsts.shtmlinputformimagesrc
+msgid "Image src"
+msgstr "Kép forrás"
+
+#: fpwebstrconsts.shtmlinputformmaxlen
+msgid "Max length"
+msgstr "Maximális hossz"
+
+#: fpwebstrconsts.shtmlinputformname
+msgid "Name"
+msgstr "Név"
+
+#: fpwebstrconsts.shtmlinputformsize
+msgid "Size"
+msgstr "Méret"
+
+#: fpwebstrconsts.shtmlinputformtabindex
+msgid "Tab Index"
+msgstr "Tab sorszám"
+
+#: fpwebstrconsts.shtmlinputformtype
+msgid "Type"
+msgstr "Típus"
+
+#: fpwebstrconsts.shtmlinputformvalue
+msgid "Value"
+msgstr "Érték"
+
+#: fpwebstrconsts.shtmljsfile
+msgid "&Javascript file"
+msgstr "&Javascript fájl"
+
+#: fpwebstrconsts.shtmltableformborderwidth
+msgid "Border width"
+msgstr "Szegély szélessége"
+
+#: fpwebstrconsts.shtmltableformcaption
+msgid "New HTML table ..."
+msgstr "Új HTML táblázat ..."
+
+#: fpwebstrconsts.shtmltableformcellpadding
+msgid "Cell padding"
+msgstr "Cellamargó"
+
+#: fpwebstrconsts.shtmltableformcellspacing
+msgid "Cell spacing"
+msgstr "Cellatávolság"
+
+#: fpwebstrconsts.shtmltableformcolumncount
+msgid "Column count"
+msgstr "Oszlopszám"
+
+#: fpwebstrconsts.shtmltableformheaderbgcolor
+msgid "Header bg color"
+msgstr "Fejléc háttérszíne"
+
+#: fpwebstrconsts.shtmltableformrowcount
+msgid "Row count"
+msgstr "Sorszám"
+
+#: fpwebstrconsts.shtmltableformuseheader
+msgid "Use header row"
+msgstr "Fejlécsor használata"
+
+#: fpwebstrconsts.shtmltableformwidth
+msgid "Width"
+msgstr "Szélesség"
+
+#: fpwebstrconsts.shtmltagcaptionreset
+msgid "Reset"
+msgstr "Alaphelyzet"
+
+#: fpwebstrconsts.shtmltagcaptionsubmit
+msgid "Submit"
+msgstr "Küldés"
+
+#: fpwebstrconsts.shtmltagproperty
+msgid "Tag property: %s"
+msgstr "Cimke tulajdonság: %s"
+
+#: fpwebstrconsts.shtmltitle
+msgid "Html &title - <title>"
+msgstr "Html &cím - <title>"
+
+#: fpwebstrconsts.shttpport
+msgid "&Port to listen for requests:"
+msgstr "A kérések figyelésére használt &port:"
+
+#: fpwebstrconsts.sjsfile
+msgid "Javascript file"
+msgstr "Javascript fájl"
+
+#: fpwebstrconsts.sjsfiledesc
+msgid "Create new javascript file ..."
+msgstr "Új javascript fájl létrehozása ..."
+
+#: fpwebstrconsts.sjssource
+msgid "Enter your javascript code here"
+msgstr "Írja ide a javascript kódot"
+
+#: fpwebstrconsts.smihtmleditor
+msgid "HTML Editor"
+msgstr "HTML-szerkesztő"
+
+#: fpwebstrconsts.smihtmlformbuttton
+msgid "Insert Button control"
+msgstr "Gomb beszúrása"
+
+#: fpwebstrconsts.smihtmlformcheckbox
+msgid "Insert CheckBox control"
+msgstr "Jelölőnégyzet beszúrása"
+
+#: fpwebstrconsts.smihtmlformfieldset
+msgid "Insert HTML FIELDSET tag"
+msgstr "HTML FIELDSET címke beszúrása"
+
+#: fpwebstrconsts.smihtmlformlegend
+msgid "Insert HTML LEGEND tag"
+msgstr "HTML LEGEND címke beszúrása"
+
+#: fpwebstrconsts.smihtmlformradiobtn
+msgid "Insert RadioBtn control"
+msgstr "Rádiógomb beszúrása"
+
+#: fpwebstrconsts.smihtmlforms
+msgid "Forms"
+msgstr "Űrlapok"
+
+#: fpwebstrconsts.smihtmlformselect
+msgid "Insert Select control"
+msgstr "Választólista beszúrása"
+
+#: fpwebstrconsts.smihtmlformselectopt
+msgid "Insert Select options"
+msgstr "Választási lehetőség beszúrása"
+
+#: fpwebstrconsts.smihtmlformselectoptwd
+msgid "Insert Select options with dialog"
+msgstr "Választási lehetőség beszúrása párbeszéddel"
+
+#: fpwebstrconsts.smihtmlinsertbr
+msgid "Insert new line"
+msgstr "Új sor beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertcolor
+msgid "Insert HTML color value"
+msgstr "HTML színérték beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertcomment
+msgid "Insert HTML comment"
+msgstr "HTML megjegyzés beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertdivblock
+msgid "Insert HTML DIV tag"
+msgstr "HTML DIV címke beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertform
+msgid "Insert HTML Form"
+msgstr "HTML FORM beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertheader1level
+msgid "Insert HTML level 1 header"
+msgstr "HTML 1. szintű fejléc beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertheader2level
+msgid "Insert HTML level 2 header"
+msgstr "HTML 2. szintű fejléc beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertheader3level
+msgid "Insert HTML level 3 header"
+msgstr "HTML 3. szintű fejléc beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertheader4level
+msgid "Insert HTML level 4 header"
+msgstr "HTML 4. szintű fejléc beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertheader5level
+msgid "Insert HTML level 5 header"
+msgstr "HTML 5. szintű fejléc beszúrása"
+
+#: fpwebstrconsts.smihtmlinserthr
+msgid "Insert horizontal line"
+msgstr "Vízszintes vonal beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertimg
+msgid "Insert image"
+msgstr "Kép beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertinput
+msgid "Insert HTML INPUT tag"
+msgstr "HTML INPUT címke beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertinputreset
+msgid "Insert \"Reset\" button"
+msgstr "\"Alaphelyzet\" gomb beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertinputsubmit
+msgid "Insert \"Submit\" button "
+msgstr "\"Küldés\" gomb beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertlink
+msgid "Insert link (HREF)"
+msgstr "Hivatkozás beszúrása (HREF)"
+
+#: fpwebstrconsts.smihtmlinsertlist
+msgid "Insert HTML list"
+msgstr "HTML lista beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertnbsp
+msgid "Insert Non Breaking Space"
+msgstr "Nem tördelhető szóköz beillesztése"
+
+#: fpwebstrconsts.smihtmlinsertpre
+msgid "Insert HTML PRE tag"
+msgstr "HTML PRE címke beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertspantext
+msgid "Insert HTML SPAN tag"
+msgstr "HTML SPAN címke beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertsub
+msgid "Insert Subscript"
+msgstr "Alsó index beszúrása"
+
+#: fpwebstrconsts.smihtmlinsertsuper
+msgid "Insert Superscript"
+msgstr "Felső index beszúrása"
+
+#: fpwebstrconsts.smihtmlinserttable
+msgid "Insert HTML table"
+msgstr "HTML táblázat beszúrása"
+
+#: fpwebstrconsts.smihtmlinserttabledata
+msgid "Insert HTML table data"
+msgstr "HTML táblázatadat beszúrása"
+
+#: fpwebstrconsts.smihtmlinserttabledatawd
+msgid "Insert HTML table data with dialog"
+msgstr "HTML táblázatadat beszúrása párbeszéddel"
+
+#: fpwebstrconsts.smihtmlinserttablerow
+msgid "Insert HTML table row"
+msgstr "HTML táblázatsor beszúrása"
+
+#: fpwebstrconsts.smihtmlinserttablerowwd
+msgid "Insert HTML table row with dialog"
+msgstr "HTML táblázatsor beszúrása párbeszéddel"
+
+#: fpwebstrconsts.smihtmllists
+msgid "Lists"
+msgstr "Listák"
+
+#: fpwebstrconsts.smihtmlother
+msgid "Other"
+msgstr "Egyéb"
+
+#: fpwebstrconsts.smihtmlstandart
+msgid "Standard"
+msgstr "Szabványos"
+
+#: fpwebstrconsts.smihtmlstyle
+msgid "Styles"
+msgstr "Stílusok"
+
+#: fpwebstrconsts.smihtmltables
+msgid "Tables"
+msgstr "Táblázatok"
+
+#: fpwebstrconsts.smihtmltextaligncenter
+msgid "Text align center"
+msgstr "Szöveg igazítása középre"
+
+#: fpwebstrconsts.smihtmltextalignjustify
+msgid "Text align justify"
+msgstr "Szöveg igazítása egyenletesen (sorkizárt)"
+
+#: fpwebstrconsts.smihtmltextalignleft
+msgid "Text align left"
+msgstr "Szöveg igazítása balra"
+
+#: fpwebstrconsts.smihtmltextalignright
+msgid "Text align right"
+msgstr "Szöveg igazítása jobbra"
+
+#: fpwebstrconsts.smihtmltextbold
+msgid "Bold"
+msgstr "Félkövér"
+
+#: fpwebstrconsts.smihtmltextitalic
+msgid "Italic"
+msgstr "Dőlt"
+
+#: fpwebstrconsts.smihtmltextunderline
+msgid "Underline"
+msgstr "Aláhúzott"
+
+#: fpwebstrconsts.smiotherinsertfn
+msgid "Insert file name"
+msgstr "Fájlnév beszúrása"
+
+#: fpwebstrconsts.snewhtmlfileprops
+msgid "New Html file properties"
+msgstr "Új HTML fájl tulajdonságok"
+
+#: fpwebstrconsts.snewhttpapp
+msgid "New HTTP application"
+msgstr "Új HTTP alkalmazás"
+
+#: fpwebstrconsts.sregisterfiles
+msgid "&Register location to serve files from"
+msgstr "Hely &bejegyzése a fájlok kiszolgálására"
+
+#: fpwebstrconsts.susethreads
+msgid "Use &threads to serve requests in"
+msgstr "Szá&lak használata a kérések kiszolgálására"
--- a/components/fpweb/languages/fpwebtoolsunit.hu.po
+++ b/components/fpweb/languages/fpwebtoolsunit.hu.po
@ -0,0 +1,25 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: rxwebtoolsunit.shtmldesign
+msgid "HTML design"
+msgstr "HTML tervezés"
+
+#: rxwebtoolsunit.shtmlfile
+msgid "HTML file"
+msgstr "HTML fájl"
+
+#: rxwebtoolsunit.shtmlfiledesc
+msgid "Create new HTML file..."
+msgstr "Új HTML fájl létrehozása..."
--- a/components/fpweb/languages/frmrpcmoduleoptions.hu.po
+++ b/components/fpweb/languages/frmrpcmoduleoptions.hu.po
@ -0,0 +1,34 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: frmrpcmoduleoptions.scaption
+msgid "Create a new JSON-RPC module"
+msgstr "Új JSON-RPC modul létrehozása"
+
+#: frmrpcmoduleoptions.shttppath
+msgid "HTTP Path"
+msgstr "HTTP útvonal"
+
+#: frmrpcmoduleoptions.sjsonclass
+msgid "JSON-RPC class"
+msgstr "JSON-RPC osztály"
+
+#: frmrpcmoduleoptions.sregisterjson
+#, fuzzy
+msgid "Register JSON-RPC handlers in factory"
+msgstr "JSON-RPC kezelők regisztrálása a gyárban"
+
+#: frmrpcmoduleoptions.sregisterwebm
+msgid "Register web module"
+msgstr "Web modul regisztrálása"
--- a/components/fpweb/languages/reglazwebextra.hu.po
+++ b/components/fpweb/languages/reglazwebextra.hu.po
@ -0,0 +1,62 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: reglazwebextra.rshttpappli
+msgid "HTTP server Application"
+msgstr "HTTP kiszolgáló alkalmazás"
+
+#: reglazwebextra.rshttpappli2
+msgid ""
+"HTTP server Application. Complete HTTP Server program in Free Pascal using "
+"webmodules. The program source is automatically maintained by Lazarus."
+msgstr ""
+"HTTP kiszolgáló alkalmazás. Teljes HTTP kiszolgáló program Free Pascal-ban "
+"webmodulok használatával. Az program forráskódját a Lazarus automatikusan "
+"karbantartja."
+
+#: reglazwebextra.rswebdataprovi
+msgid "Web DataProvider Module"
+msgstr "Web adatszolgáltató modul"
+
+#: reglazwebextra.rswebdataprovi2
+msgid ""
+"WEB DataProvider Module%sA datamodule to handle data requests for WEB (HTTP) "
+"applications using WebDataProvider components."
+msgstr ""
+"Web adatszolgáltató modul%sEgy adatmodul WEB (HTTP) alkalmazások számára az "
+"adatkérések kezelésére WebDataProvider komponensek haszálatával."
+
+#: reglazwebextra.rswebextdirect
+msgid "Web Ext.Direct Module"
+msgstr "Web Ext.Direct modul"
+
+#: reglazwebextra.rswebextdirect2
+msgid ""
+"WEB Ext.Direct Module%sA datamodule to dispatch Ext.Direct requests in WEB "
+"(HTTP) applications using TJSONRPCHandler components."
+msgstr ""
+"Web Ext.Direct modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban az Ext."
+"Direct kéréseket kezeli TJSONRPCHandler komponensek használatával."
+
+#: reglazwebextra.rswebjsonrpcmo
+msgid "Web JSON-RPC Module"
+msgstr "Web JSON-RPC modul"
+
+#: reglazwebextra.rswebjsonrpcmo2
+msgid ""
+"WEB JSON-RPC Module%sA datamodule to dispatch JSON-RPC requests in WEB "
+"(HTTP) applications using TJSONRPCHandler components."
+msgstr ""
+"Web JSON-RPC modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban a JSON-"
+"RPC kéréseket kezeli TJSONRPCHandler komponensek használatával."
--- a/components/fpweb/languages/weblazideintf.hu.po
+++ b/components/fpweb/languages/weblazideintf.hu.po
@ -0,0 +1,142 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: weblazideintf.rsapachemodule
+msgid "Apache Module"
+msgstr "Apache modul"
+
+#: weblazideintf.rsapachemodule2
+msgid ""
+"Apache module%sAn Apache loadable module in Free Pascal using webmodules. "
+"The main library file is automatically maintained by Lazarus."
+msgstr ""
+"Apache modul%sEgy az Apache által betölthető modul Free Pascal-ban "
+"webmodulok használatával. A fő fügvénytár forráskódját a Lazarus "
+"automatikusan karbantartja."
+
+#: weblazideintf.rscgiapplicati
+msgid "CGI Application"
+msgstr "CGI alkalmazás"
+
+#: weblazideintf.rscgiapplicati2
+msgid ""
+"CGI Application%sA CGI (Common Gateway Interface) program in Free Pascal "
+"using webmodules. The program source is automatically maintained by Lazarus."
+msgstr ""
+"CGI alkalmazás%sEgy CGI (Common Gateway Interface) program Free Pascal-ban "
+"webmodulok használatával. A program forráskódját a Lazarus automatikusan "
+"karbantartja."
+
+#: weblazideintf.rscustomcgiapp
+msgid "Custom CGI Application"
+msgstr "Egyéni CGI alkalmazás"
+
+#: weblazideintf.rscustomcgiapp2
+msgid ""
+"Custom CGI Application%sA CGI (Common Gateway Interface) program in Free "
+"Pascal. The program source is automatically maintained by Lazarus."
+msgstr ""
+"Egyéni CGI alkalmazás%sEgy CGI (Common Gateway Interface) program Free "
+"Pascal-ban. A program forráskódját a Lazarus automatikusan karbantartja."
+
+#: weblazideintf.rscustomfastcg
+msgid "Custom FastCGI Application"
+msgstr "Egyéni FastCGI alkalmazás"
+
+#: weblazideintf.rscustomfastcg2
+msgid ""
+"Custom FastCGI Application%sA FastCGI (Common Gateway Interface) program in "
+"Free Pascal. The program source is automatically maintained by Lazarus."
+msgstr ""
+"Egyéni FastCGI alkalmazás%sEgy FastCGI (Common Gateway Interface) program "
+"Free Pascal-ban. A program forráskódját a Lazarus automatikusan karbantartja."
+
+#: weblazideintf.rsfastcgiappli
+msgid "FastCGI Application"
+msgstr "FastCGI alkalmazás"
+
+#: weblazideintf.rsfastcgiappli2
+msgid ""
+"FastCGI Application%sA FastCGI (Common Gateway Interface) program in Free "
+"Pascal using webmodules. The program source is automatically maintained by "
+"Lazarus."
+msgstr ""
+"FastCGI alkalmazás%sEgy FastCGI (Common Gateway Interface) program Free "
+"Pascal-ban webmodulok használatával. A program forráskódját a Lazarus "
+"automatikusan karbantartja."
+
+#: weblazideintf.rshtmlwebmodul
+msgid "HTML Web Module"
+msgstr "HTTP web modul"
+
+#: weblazideintf.rshtmlwebmodul2
+msgid "HTML WEB Module%sA Web datamodule for producing strict HTML."
+msgstr "HTML WEB modul%sEgy web adatmodul szigorú HTML létrehozására."
+
+#: weblazideintf.rshttpappli
+msgid "HTTP server Application"
+msgstr "HTTP kiszolgáló alkalmazás"
+
+#: weblazideintf.rshttpappli2
+msgid ""
+"HTTP server Application. Complete HTTP Server program in Free Pascal using "
+"webmodules. The program source is automatically maintained by Lazarus."
+msgstr ""
+"HTTP kiszolgáló alkalmazás. Teljes HTTP kiszolgáló program Free Pascal-ban "
+"webmodulok használatával. Az program forráskódját a Lazarus automatikusan "
+"karbantartja."
+
+#: weblazideintf.rswebdataprovi
+msgid "Web DataProvider Module"
+msgstr "Web adatszolgáltató modul"
+
+#: weblazideintf.rswebdataprovi2
+msgid ""
+"WEB DataProvider Module%sA datamodule to handle data requests for WEB (HTTP) "
+"applications using WebDataProvider components."
+msgstr ""
+"WEB adatszolgáltató modul%sEgy adatmodul WEB (HTTP) alkalmazások számára az "
+"adatkérések kezelésére WebDataProvider komponensek haszálatával."
+
+#: weblazideintf.rswebextdirect
+msgid "Web Ext.Direct Module"
+msgstr "Web Ext.Direct modul"
+
+#: weblazideintf.rswebextdirect2
+msgid ""
+"WEB Ext.Direct Module%sA datamodule to dispatch Ext.Direct requests in WEB "
+"(HTTP) applications using TJSONRPCHandler components."
+msgstr ""
+"Web Ext.Direct modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban az Ext."
+"Direct kéréseket kezeli TJSONRPCHandler komponensek használatával."
+
+#: weblazideintf.rswebjsonrpcmo
+msgid "Web JSON-RPC Module"
+msgstr "Web JSON-RPC modul"
+
+#: weblazideintf.rswebjsonrpcmo2
+msgid ""
+"WEB JSON-RPC Module%sA datamodule to dispatch JSON-RPC requests in WEB "
+"(HTTP) applications using TJSONRPCHandler components."
+msgstr ""
+"Web JSON-RPC modul%sEgy adatmodul, mely WEB (HTTP) alkalmazásokban a JSON-"
+"RPC kéréseket kezeli TJSONRPCHandler komponensek használatával."
+
+#: weblazideintf.rswebmodule
+msgid "Web Module"
+msgstr "Web modul"
+
+#: weblazideintf.rswebmoduleada
+msgid "WEB Module%sA datamodule for WEB (HTTP) applications."
+msgstr "Web modul%sEgy adatmodul WEB (HTTP) alkalmazások számára."
--- a/components/ideintf/languages/objinspstrconsts.hu.po
+++ b/components/ideintf/languages/objinspstrconsts.hu.po
@ -5,11 +5,11 @@ msgstr ""
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
+"Language: hu\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "X-Generator: Poedit 1.5.4\n"
-"Language: hu\n"

 #: objinspstrconsts.cactionlisteditorallcategory
 msgid "(All)"
@ -132,7 +132,6 @@ msgid "Up"
 msgstr "Fel"

 #: objinspstrconsts.fescalculated
-#, fuzzy
 msgid "&Calculated"
 msgstr "Számított"

@ -150,7 +149,6 @@ msgid "&Data"
 msgstr "A&datok"

 #: objinspstrconsts.fesdataset
-#, fuzzy
 msgid "&Dataset:"
 msgstr "&Dataset:"

@ -192,7 +190,6 @@ msgid "Lookup definition"
 msgstr "Definíció keresése"

 #: objinspstrconsts.feslookupkeys
-#, fuzzy
 msgid "L&ookup keys:"
 msgstr "Keresési kulcsok:"

@ -206,7 +203,8 @@ msgstr "Nem sikerült összegyűjteni a Dataset mezőinek listáját"

 #: objinspstrconsts.fesnofieldsnote
 msgid "Field's list is not available, can't check for duplicates"
-msgstr "A mezők listája nem érhető el, nem lehet többszörös előfordulásokat keresni"
+msgstr ""
+"A mezők listája nem érhető el, nem lehet többszörös előfordulásokat keresni"

 #: objinspstrconsts.fesokbtn
 msgctxt "objinspstrconsts.fesokbtn"
@ -218,7 +216,6 @@ msgid "Co&mponent Name:"
 msgstr "Komponens neve:"

 #: objinspstrconsts.fesresultfield
-#, fuzzy
 msgid "&Result Fields:"
 msgstr "Visszaadott mezők:"

@ -265,7 +262,7 @@ msgstr "Érték megadása"

 #: objinspstrconsts.lisunabletofindparserfortool
 msgid "Unable to find parser for tool \"%s\""
-msgstr ""
+msgstr "Nem található elemző az eszközhöz: \"%s\""

 #: objinspstrconsts.nbcesaddpage
 msgid "Add Page"
@ -409,10 +406,8 @@ msgid "Clear picture"
 msgstr "Kép tisztítása"

 #: objinspstrconsts.oiscomponentnameisnotavalididentifier
-#, fuzzy
-#| msgid "Component name %s%s%s is not a valid identifier"
 msgid "Component name \"%s\" is not a valid identifier"
-msgstr "A(z) %s%s%s komponens név nem érvényes azonosító"
+msgstr "A(z) \"%s\" komponens név nem érvényes azonosító"

 #: objinspstrconsts.oiscomponentrestrictions
 msgid "Component restrictions: "
@ -455,10 +450,8 @@ msgid "&Delete"
 msgstr "&Törlés"

 #: objinspstrconsts.oisdeleteitem
-#, fuzzy
-#| msgid "Delete item %s%s%s?"
 msgid "Delete item \"%s\"?"
-msgstr "Törli a(z) %s%s%s elemet?"
+msgstr "Törli a(z) \"%s\" elemet?"

 #: objinspstrconsts.oisdeleteselectedfields
 msgid "Delete selected field(s)"
@ -485,10 +478,8 @@ msgid "Error loading image"
 msgstr "Hiba kép betöltése közben"

 #: objinspstrconsts.oiserrorloadingimage2
-#, fuzzy
-#| msgid "Error loading image %s%s%s:%s%s"
 msgid "Error loading image \"%s\":%s%s"
-msgstr "Hiba a(z) %s%s%s kép betöltése közben:%s%s"
+msgstr "Hiba a(z) \"%s\" kép betöltése közben:%s%s"

 #: objinspstrconsts.oiserrorwhiledeletingaction
 msgid "Error while deleting action:%s%s"
@ -547,10 +538,8 @@ msgid "Invalid property value"
 msgstr "Érvénytelen tulajdonság érték"

 #: objinspstrconsts.oisisnotavalidmethodname
-#, fuzzy
-#| msgid "%s%s%s is not a valid method name."
 msgid "\"%s\" is not a valid method name."
-msgstr "A(z) %s%s%s nem egy érvényes metódusnév."
+msgstr "A(z) \"%s\" nem egy érvényes metódusnév."

 #: objinspstrconsts.oisitemsselected
 msgid "%u items selected"
@ -727,7 +716,6 @@ msgid "Set MaxHeight=%d, MaxWidth=%d"
 msgstr "Legyen MaxHeight=%d, MaxWidth=%d"

 #: objinspstrconsts.oissetmaxconstraintshint
-#, fuzzy
 msgid "Use current size as Max Constraints"
 msgstr "Az aktuális méret használata legnagyobb méretként"

@ -736,7 +724,6 @@ msgid "Set MinHeight=%d, MinWidth=%d"
 msgstr "Legyen MinHeight=%d, MinWidth=%d"

 #: objinspstrconsts.oissetminconstraintshint
-#, fuzzy
 msgid "Use current size as Min Constraints"
 msgstr "Az aktuális méret használata legkisebb méretként"

@ -1076,28 +1063,34 @@ msgid "Test Input"
 msgstr "Teszt bemenet"

 #: objinspstrconsts.oistheidentifierisnotamethodpresscanceltoundopressign
-#, fuzzy
-#| msgid "The identifier %s%s%s is not a method.%sPress Cancel to undo,%spress Ignore to force it."
-msgid "The identifier \"%s\" is not a method.%sPress Cancel to undo,%spress Ignore to force it."
-msgstr "A(z) %s%s%s azonosító nem metódus.%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."
+msgid ""
+"The identifier \"%s\" is not a method.%sPress Cancel to undo,%spress Ignore "
+"to force it."
+msgstr ""
+"A(z) \"%s\" azonosító nem metódus.%sKattintson a Mégse gombra a "
+"visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."

 #: objinspstrconsts.oisthemethodisincompatibletothiseventpresscanceltound
-#, fuzzy
-#| msgid "The method %s%s%s is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it."
-msgid "The method \"%s\" is incompatible to this event (%s).%sPress Cancel to undo,%spress Ignore to force it."
-msgstr "A(z) %s%s%s metódus nem kompatibilis ezzel az eseménnyel (%s).%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."
+msgid ""
+"The method \"%s\" is incompatible to this event (%s).%sPress Cancel to undo,"
+"%spress Ignore to force it."
+msgstr ""
+"A(z) \"%s\" metódus nem kompatibilis ezzel az eseménnyel (%s).%sKattintson a "
+"Mégse gombra a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."

 #: objinspstrconsts.oisthemethodisnotpublishedpresscanceltoundopressignor
-#, fuzzy
-#| msgid "The method %s%s%s is not published.%sPress Cancel to undo,%spress Ignore to force it."
-msgid "The method \"%s\" is not published.%sPress Cancel to undo,%spress Ignore to force it."
-msgstr "A(z) %s%s%s metódus nincs publikálva.%sKlikkeljen a Mégsé-re a visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."
+msgid ""
+"The method \"%s\" is not published.%sPress Cancel to undo,%spress Ignore to "
+"force it."
+msgstr ""
+"A(z) \"%s\" metódus nincs publikálva.%sKattintson a Mégse  gombra a "
+"visszavonáshoz,%svagy a Kihagyás-ra az erőltetéshez."

 #: objinspstrconsts.oisunabletochangeparentofcontroltonewparent
-#, fuzzy
-#| msgid "Unable to change parent of control %s%s%s to new parent %s%s%s.%s%s"
 msgid "Unable to change parent of control \"%s\" to new parent \"%s\".%s%s"
-msgstr "A(z) %s%s%s vezérlő szülőjét nem lehet megváltoztatni az új szülőre: %s%s%s.%s%s"
+msgstr ""
+"A(z) \"%s\" vezérlő szülőjét nem lehet megváltoztatni az új szülőre: \"%s\"."
+"%s%s"

 #: objinspstrconsts.oisundo
 msgctxt "objinspstrconsts.oisundo"
@ -1391,9 +1384,7 @@ msgstr "Betöltés ..."

 #: objinspstrconsts.sccssgedtmoverowscols
 msgid "Move Rows/Cols"
-msgstr ""
-"Sorok/Oszlopok\n"
-"mozgatása\n"
+msgstr "Sorok/Oszlopok mozgatása"

 #: objinspstrconsts.sccssgedtopendialog
 msgctxt "objinspstrconsts.sccssgedtopendialog"
@ -1512,7 +1503,6 @@ msgid "New Button"
 msgstr "Új gomb"

 #: objinspstrconsts.tbcenewcheckbutton
-#, fuzzy
 msgid "New CheckButton"
 msgstr "Új beragadó-gomb"

@ -1544,3 +1534,274 @@ msgstr "Fül mozgatása eggyel balra"
 msgid "Move tab right"
 msgstr "Fül mozgatása eggyel jobbra"

+#~ msgid "OEM 1"
+#~ msgstr "OEM 1"
+
+#~ msgid "OEM 2"
+#~ msgstr "OEM 2"
+
+#~ msgid "OEM 3"
+#~ msgstr "OEM 3"
+
+#~ msgid "OEM 4"
+#~ msgstr "OEM 4"
+
+#~ msgid "OEM 5"
+#~ msgstr "OEM 5"
+
+#~ msgid "OEM 6"
+#~ msgstr "OEM 6"
+
+#~ msgid "OEM 7"
+#~ msgstr "OEM 7"
+
+#~ msgid "OEM 8"
+#~ msgstr "OEM 8"
+
+#~ msgid "OEM comma"
+#~ msgstr "OEM vessző"
+
+#~ msgid "OEM minus"
+#~ msgstr "OEM minusz"
+
+#~ msgid "OEM period"
+#~ msgstr "OEM pont"
+
+#~ msgid "OEM plus"
+#~ msgstr "OEM plusz"
+
+#~ msgid "All"
+#~ msgstr "Mind"
+
+#~ msgctxt "objinspstrconsts.oiscancel"
+#~ msgid "&Cancel"
+#~ msgstr "Mégsem"
+
+#~ msgid "Copy components"
+#~ msgstr "Komponensek másolása"
+
+#~ msgid "Cut components"
+#~ msgstr "Komponensek kivágása"
+
+#~ msgid "Delete components"
+#~ msgstr "Komponensek törlése"
+
+#~ msgid "Edit action list..."
+#~ msgstr "Műveletlista szerkesztése..."
+
+#~ msgid "Index out of bounds"
+#~ msgstr "Az index kívül esik a határokon"
+
+#~ msgid "not supported"
+#~ msgstr "nem támogatott"
+
+#~ msgid "Paste components"
+#~ msgstr "Komponensek beillesztése"
+
+#~ msgid "Set to default value"
+#~ msgstr "Beállítás alapértelmezett értékre"
+
+#~ msgid "Custom options"
+#~ msgstr "Saját beállítások"
+
+#~ msgid "Debug search path"
+#~ msgstr "Hibakereső keresési útvonala"
+
+#~ msgid "Include search path"
+#~ msgstr "Include fájlok keresési útvonala"
+
+#~ msgid "Library search path"
+#~ msgstr "Függvénytár keresési útvonal"
+
+#~ msgid "Linker options"
+#~ msgstr "Linker opciók"
+
+#~ msgid "Object search path"
+#~ msgstr "Objektum keresési útvonal"
+
+#~ msgid "Result"
+#~ msgstr "Eredmény"
+
+#~ msgid "Unit"
+#~ msgstr "Unit"
+
+#~ msgid "Unit search path"
+#~ msgstr "Unit keresési útvonal"
+
+#~ msgid "Unit source search path"
+#~ msgstr "Unit forrás keresési útvonal"
+
+#~ msgid "Add..."
+#~ msgstr "Hozzáadás..."
+
+#~ msgctxt "objinspstrconsts.sccsiledtdelete"
+#~ msgid "Delete"
+#~ msgstr "Törlés"
+
+#~ msgid "Edit ListView Items..."
+#~ msgstr "ListView elemek szerkesztése..."
+
+#~ msgid "Edit TreeView Items..."
+#~ msgstr "TreeView elemeinek szerkesztése..."
+
+#~ msgid "Alt"
+#~ msgstr "Alt"
+
+#~ msgid "Ctrl"
+#~ msgstr "Ctrl"
+
+#~ msgid "Accept"
+#~ msgstr "Elfogadás"
+
+#~ msgid "Application Key"
+#~ msgstr "Alkalmazás gomb"
+
+#~ msgid "Backspace"
+#~ msgstr "Backspace"
+
+#~ msgctxt "objinspstrconsts.srvk_cancel"
+#~ msgid "Cancel"
+#~ msgstr "Mégsem"
+
+#~ msgid "Capital"
+#~ msgstr "Capital"
+
+#~ msgctxt "objinspstrconsts.srvk_clear"
+#~ msgid "Clear"
+#~ msgstr "Clear"
+
+#~ msgid "Cmd"
+#~ msgstr "Cmd"
+
+#~ msgid "Control"
+#~ msgstr "Control"
+
+#~ msgid "Convert"
+#~ msgstr "Convert"
+
+#~ msgctxt "objinspstrconsts.srvk_delete"
+#~ msgid "Delete"
+#~ msgstr "Törlés"
+
+#~ msgctxt "objinspstrconsts.srvk_down"
+#~ msgid "Down"
+#~ msgstr "Le"
+
+#~ msgid "End"
+#~ msgstr "End"
+
+#~ msgid "Escape"
+#~ msgstr "Escape"
+
+#~ msgid "Execute"
+#~ msgstr "Execute"
+
+#~ msgid "Hanja"
+#~ msgstr "Hanja"
+
+#~ msgctxt "objinspstrconsts.srvk_help"
+#~ msgid "Help"
+#~ msgstr "Súgó"
+
+#~ msgid "Home"
+#~ msgstr "Home"
+
+#~ msgctxt "objinspstrconsts.srvk_insert"
+#~ msgid "Insert"
+#~ msgstr "Insert"
+
+#~ msgid "Junja"
+#~ msgstr "Junja"
+
+#~ msgid "Kana"
+#~ msgstr "Kana"
+
+#~ msgid "Mouse Button Left"
+#~ msgstr "Bal egérgomb"
+
+#~ msgctxt "objinspstrconsts.srvk_left"
+#~ msgid "Left"
+#~ msgstr "Balra"
+
+#~ msgid "Left Windows Key"
+#~ msgstr "Bal Windows gomb"
+
+#~ msgid "Mouse Button Middle"
+#~ msgstr "Középső egérgomb"
+
+#~ msgid "Menu"
+#~ msgstr "Menü"
+
+#~ msgid "Meta"
+#~ msgstr "Meta"
+
+#~ msgid "Mode Change"
+#~ msgstr "Mód váltása"
+
+#~ msgctxt "objinspstrconsts.srvk_next"
+#~ msgid "Next"
+#~ msgstr "Következő"
+
+#~ msgid "Nonconvert"
+#~ msgstr "Nonconvert"
+
+#~ msgid "none"
+#~ msgstr "semmi"
+
+#~ msgid "Numlock"
+#~ msgstr "Num Lock"
+
+#~ msgid "Numpad %d"
+#~ msgstr "Numpad %d"
+
+#~ msgid "Pause key"
+#~ msgstr "Pause gomb"
+
+#~ msgid "Print"
+#~ msgstr "Nyomtatás"
+
+#~ msgctxt "objinspstrconsts.srvk_prior"
+#~ msgid "Prior"
+#~ msgstr "Előző"
+
+#~ msgid "Mouse Button Right"
+#~ msgstr "Jobb egérgomb"
+
+#~ msgid "Return"
+#~ msgstr "Enter"
+
+#~ msgctxt "objinspstrconsts.srvk_right"
+#~ msgid "Right"
+#~ msgstr "Jobbra"
+
+#~ msgid "Right Windows Key"
+#~ msgstr "Jobb Windows gomb"
+
+#~ msgid "Scroll"
+#~ msgstr "Görgetés"
+
+#~ msgid "Select"
+#~ msgstr "Kijelölés"
+
+#~ msgid "Shift"
+#~ msgstr "Shift"
+
+#~ msgid "Snapshot"
+#~ msgstr "Snapshot"
+
+#~ msgid "Space key"
+#~ msgstr "Szóköz"
+
+#~ msgid "Super"
+#~ msgstr "Super"
+
+#~ msgid "Tab"
+#~ msgstr "Tab"
+
+#~ msgctxt "objinspstrconsts.srvk_unknown"
+#~ msgid "Unknown"
+#~ msgstr "Ismeretlen"
+
+#~ msgctxt "objinspstrconsts.srvk_up"
+#~ msgid "Up"
+#~ msgstr "Fel"
--- a/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po
+++ b/components/lazreport/source/addons/ZeosDB/languages/lrdbzeosconst.hu.po
@ -2,14 +2,15 @@
 msgid ""
 msgstr ""
 "MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=utf-8\n"
+"Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
-"Language-Team: \n"
+"Language-Team: Magyar (Hungarian)\n"
 "X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"

 #: lrdbzeosconst.slreditparamsform_caption
 msgid "Edit query param list"
@ -28,6 +29,5 @@ msgid "Param value"
 msgstr "Paraméter értéke"

 #: lrdbzeosconst.slreditparamsform_selectexpresion
-#, fuzzy
 msgid "Select expresion"
 msgstr "Kifejezés választása"
--- a/components/lazreport/source/languages/lr_const.hu.po
+++ b/components/lazreport/source/languages/lr_const.hu.po
@ -267,11 +267,16 @@ msgid "Default printer"
 msgstr "Alapértelmezett nyomtató"

 #: lr_const.sdescriptionavg
-msgid "AVG(<Expression> [,BandName [,1]])/Calculates the average of <Expression> for [BandName] row given. If [1] parameter is used, calculates average for non-visible rows too."
+msgid ""
+"AVG(<Expression> [,BandName [,1]])/Calculates the average of <Expression> "
+"for [BandName] row given. If [1] parameter is used, calculates average for "
+"non-visible rows too."
 msgstr ""

 #: lr_const.sdescriptioncopy
-msgid "COPY(<String>, <Position>, <Length>)/Returns <Length> characters from <String> starting at <Position>."
+msgid ""
+"COPY(<String>, <Position>, <Length>)/Returns <Length> characters from "
+"<String> starting at <Position>."
 msgstr ""

 #: lr_const.sdescriptioncount
@ -287,15 +292,21 @@ msgid "DEC(<Value>)/Decrement <Value>."
 msgstr ""

 #: lr_const.sdescriptionformatdatetime
-msgid "FORMATDATETIME(<Fmt>, <DateTime>)/Converts a <DateTime> value to a string using mask in <Fmt>."
+msgid ""
+"FORMATDATETIME(<Fmt>, <DateTime>)/Converts a <DateTime> value to a string "
+"using mask in <Fmt>."
 msgstr ""

 #: lr_const.sdescriptionformatfloat
-msgid "FORMATFLOAT(<Fmt>, <Numeric>)/Converts a <Numeric> value to a string using mask in <Fmt>."
+msgid ""
+"FORMATFLOAT(<Fmt>, <Numeric>)/Converts a <Numeric> value to a string using "
+"mask in <Fmt>."
 msgstr ""

 #: lr_const.sdescriptionformattext
-msgid "FORMATTEXT(<Mask>, <String>)/Applies <Mask> to given <String> and returns formatted string."
+msgid ""
+"FORMATTEXT(<Mask>, <String>)/Applies <Mask> to given <String> and returns "
+"formatted string."
 msgstr ""

 #: lr_const.sdescriptionfrac
@ -307,7 +318,10 @@ msgid "INC(<Value>)/Increment <Value>."
 msgstr ""

 #: lr_const.sdescriptioninput
-msgid "INPUT(<Caption> [,Default])/Shows dialog window with title <Caption> and edit box. If [Default] parameter is set, puts this string in edit box. After user clicks OK, returns input string."
+msgid ""
+"INPUT(<Caption> [,Default])/Shows dialog window with title <Caption> and "
+"edit box. If [Default] parameter is set, puts this string in edit box. After "
+"user clicks OK, returns input string."
 msgstr ""

 #: lr_const.sdescriptionint
@ -323,7 +337,10 @@ msgid "LOWERCASE(<String>)/Converts <String> symbols to lower case."
 msgstr ""

 #: lr_const.sdescriptionmax
-msgid "MAX(<Expression> [,BandName [,1]])/Calculates the maximum of <Expression> for [BandName] row given. If [1] parameter is used, calculates maximum for non-visible rows too."
+msgid ""
+"MAX(<Expression> [,BandName [,1]])/Calculates the maximum of <Expression> "
+"for [BandName] row given. If [1] parameter is used, calculates maximum for "
+"non-visible rows too."
 msgstr ""

 #: lr_const.sdescriptionmaxnum
@ -331,11 +348,16 @@ msgid "MAXNUM(<Value1>, <Value2>)/Returns max of given values."
 msgstr ""

 #: lr_const.sdescriptionmessagebox
-msgid "MESSAGEBOX(<Text>, <Title>, <Buttons>)/Shows standard dialog window with title, text and buttons."
+msgid ""
+"MESSAGEBOX(<Text>, <Title>, <Buttons>)/Shows standard dialog window with "
+"title, text and buttons."
 msgstr ""

 #: lr_const.sdescriptionmin
-msgid "MIN(<Expression> [,BandName [,1]])/Calculates the minimum of <Expression> for [BandName] row given. If [1] parameter is used, calculates minimum for non-visible rows too."
+msgid ""
+"MIN(<Expression> [,BandName [,1]])/Calculates the minimum of <Expression> "
+"for [BandName] row given. If [1] parameter is used, calculates minimum for "
+"non-visible rows too."
 msgstr ""

 #: lr_const.sdescriptionminnum
@ -347,7 +369,9 @@ msgid "MONTHOF(<Date>)/Returns month number (1..12) of given <Date>."
 msgstr ""

 #: lr_const.sdescriptionnamecase
-msgid "NAMECASE(<String>)/Converts <String> symbols to lower case, and first symbol is in upper case."
+msgid ""
+"NAMECASE(<String>)/Converts <String> symbols to lower case, and first symbol "
+"is in upper case."
 msgstr ""

 #: lr_const.sdescriptionnewcolumn
@ -359,11 +383,13 @@ msgid "NEWPAGE/Create new page for current report."
 msgstr ""

 #: lr_const.sdescriptionpos
-msgid "POS(<SubString>, <String>)/Returns position of substring in given string."
+msgid ""
+"POS(<SubString>, <String>)/Returns position of substring in given string."
 msgstr ""

 #: lr_const.sdescriptionround
-msgid "ROUND(<Value>)/Rounds the floating point <Value> to nearest integer number."
+msgid ""
+"ROUND(<Value>)/Rounds the floating point <Value> to nearest integer number."
 msgstr ""

 #: lr_const.sdescriptionshowband
@ -387,11 +413,16 @@ msgid "STRTOTIME(<String>)/Converts <String> to time."
 msgstr ""

 #: lr_const.sdescriptionsum
-msgid "SUM(<Expression> [,BandName [,1]])/Calculates the sum of <Expression> for [BandName] row given. If [1] parameter is used, calculates sum for non-visible rows too."
+msgid ""
+"SUM(<Expression> [,BandName [,1]])/Calculates the sum of <Expression> for "
+"[BandName] row given. If [1] parameter is used, calculates sum for non-"
+"visible rows too."
 msgstr ""

 #: lr_const.sdescriptiontrim
-msgid "TRIM(<String>)/Trims all heading and trailing spaces in <String> and returns resulting string."
+msgid ""
+"TRIM(<String>)/Trims all heading and trailing spaces in <String> and returns "
+"resulting string."
 msgstr ""

 #: lr_const.sdescriptionuppercase
@ -1317,7 +1348,6 @@ msgid "&Stretch"
 msgstr "Nyújtás"

 #: lr_const.sgroupeditorformadddbfield
-#, fuzzy
 msgctxt "lr_const.sgroupeditorformadddbfield"
 msgid "Insert DB field"
 msgstr "Adatbázis-mező beszúrása"
@ -1458,8 +1488,9 @@ msgid "LazReport template"
 msgstr "LazReport sablon"

 #: lr_const.smathcategory
+#, fuzzy
 msgid "Math"
-msgstr ""
+msgstr "Matematikai"

 #: lr_const.smm
 msgid "MM"
@ -2167,7 +2198,6 @@ msgid "&All"
 msgstr "&Mind"

 #: lr_const.sprintformcollate
-#, fuzzy
 msgid "Collate"
 msgstr "Oldalankénti csoportosítás"

@ -2181,8 +2211,12 @@ msgid "Current &page"
 msgstr "Jelenlegi oldal"

 #: lr_const.sprintforminfo
-msgid "Enter page numbers and/or page ranges, separated by commas. For example, 1,3,5-12"
-msgstr "Adja meg az oldalak sorszámait és/vagy tartományát, vesszővel elválasztva! Például: 1,3,5-12"
+msgid ""
+"Enter page numbers and/or page ranges, separated by commas. For example, "
+"1,3,5-12"
+msgstr ""
+"Adja meg az oldalak sorszámait és/vagy tartományát, vesszővel elválasztva! "
+"Például: 1,3,5-12"

 #: lr_const.sprintformnumber
 msgid "&Numbers:"
@ -2499,4 +2533,3 @@ msgstr "Szó tördelés"
 #: lr_const.syes
 msgid "Yes"
 msgstr "Igen"
-
--- a/components/lazsvnpkg/languages/svnclasses.hu.po
+++ b/components/lazsvnpkg/languages/svnclasses.hu.po
@ -34,15 +34,15 @@ msgstr "Beküldés"

 #: svnclasses.rscommitmsg
 msgid "Commit Message"
-msgstr ""
+msgstr "Beküldési üzenet"

 #: svnclasses.rscommitmsghistory
 msgid "Commit Message History"
-msgstr ""
+msgstr "Beküldési üzenetek előzményei"

 #: svnclasses.rscommitrevision
 msgid "Commit revision"
-msgstr ""
+msgstr "Változat beküldése"

 #: svnclasses.rsconflict
 msgid "Conflict"
@ -70,7 +70,7 @@ msgstr "Törölve"

 #: svnclasses.rsdiffactivefile
 msgid "Diff active file"
-msgstr ""
+msgstr "Jelenlegi fájl különbségei"

 #: svnclasses.rsedit
 msgid "Edit"
@ -94,19 +94,19 @@ msgstr "Az index tartományon kívül esik (%d)"

 #: svnclasses.rslazarussvncommit
 msgid "LazarusSVN Commit"
-msgstr ""
+msgstr "LazarusSVN beküldés"

 #: svnclasses.rslazarussvndiff
 msgid "%s - LazarusSVN Diff ..."
-msgstr ""
+msgstr "%s - LazarusSVN Különbségek ..."

 #: svnclasses.rslazarussvnlog
 msgid "%s - LazarusSVN Log ..."
-msgstr ""
+msgstr "%s - LazarusSVN Napló ..."

 #: svnclasses.rslazarussvnupdate
 msgid "%s - LazarusSVN Update ..."
-msgstr ""
+msgstr "%s - LazarusSVN Frissítés ..."

 #: svnclasses.rsmerged
 msgid "Merged"
@ -122,7 +122,7 @@ msgstr "(nincs szerző)"

 #: svnclasses.rsonlymodifieditemscanbediffed
 msgid "Only modified (M) Items can be diffed"
-msgstr ""
+msgstr "Csak a módosított (M) elemek különbségei vizsgálhatók"

 #: svnclasses.rsopenfileineditor
 msgid "Open file in editor"
@ -195,23 +195,23 @@ msgstr "Beállítások"

 #: svnclasses.rsshowdiff
 msgid "Show diff"
-msgstr ""
+msgstr "Különbségek megjelenítése"

 #: svnclasses.rsshowdiffbase
 msgid "Show Diff of Local Changes"
-msgstr ""
+msgstr "Helyi változtatások különbségeinek megjelenítése"

 #: svnclasses.rsshowdiffcountrev
 msgid "Show Last X Commits"
-msgstr ""
+msgstr "Utolsó X beküldés megjelenítése"

 #: svnclasses.rsshowdiffhead
 msgid "Show Diff Against HEAD"
-msgstr ""
+msgstr "Különbségek megjelenítése a HEAD-hez képest"

 #: svnclasses.rsshowdiffprev
 msgid "Show Diff Against Previous Version"
-msgstr ""
+msgstr "Különbségek megjelenítése az előző változathoz képest"

 #: svnclasses.rsshowlog
 msgid "Show log"
--- a/components/leakview/languages/heaptrcview.hu.po
+++ b/components/leakview/languages/heaptrcview.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: heaptrcview.rsdtimes
 msgid " (%d times)"
@ -17,13 +17,11 @@ msgstr " (%d alkalommal)"

 #: heaptrcview.rserrorparse
 msgid "Error while parsing trace file"
-msgstr "Hiba a nyomkövetési fájl kiértékelésekor"
+msgstr "Hiba a nyomkövetési fájl elemzésekor"

 #: heaptrcview.rsleakview
-#, fuzzy
-#| msgid "Find source lines for leak/stack-traces"
 msgid "Leaks and Traces"
-msgstr "Forrás sorainak megkeresése a szivárgás/verem követéséhez"
+msgstr "Szivárgás és Nyomkövetés"

 #: heaptrcview.sbtnclipbrd
 msgid "Paste Clipboard"
@ -47,10 +45,9 @@ msgid "Stay on top"
 msgstr "Maradjon mindig legfelül"

 #: heaptrcview.sfrmcap
-#, fuzzy
-#| msgid "LeakView - HeapTrc output viewer"
 msgid "Leaks and Traces - HeapTrc and GDB backtrace output viewer"
-msgstr "LeakView - HeapTrc kimenet megjelenítő"
+msgstr ""
+"Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet megjelenítő"

 #: heaptrcview.sfrmselectfilewithdebuginfo
 msgid "Select File with debug info"
@ -85,8 +82,8 @@ msgid "Leaking Mem Size: %d"
 msgstr "Szivárgó memória mérete: %d"

 #: heaptrcview.strtotalmemalloc
-#, fuzzy
-#| msgid "Total Mem alloced: %d"
 msgid "Total Mem allocated: %d"
 msgstr "Teljes lefoglalt memória: %d"

+#~ msgid "Find source lines for leak/stack-traces"
+#~ msgstr "Forrás sorainak megkeresése a szivárgás/verem követéséhez"
--- a/components/macroscript/languages/emsstrings.hu.po
+++ b/components/macroscript/languages/emsstrings.hu.po
@ -0,0 +1,68 @@
+#
+msgid ""
+msgstr ""
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Project-Id-Version: \n"
+"POT-Creation-Date: \n"
+"PO-Revision-Date: \n"
+"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
+"Language-Team: Magyar (Hungarian)\n"
+"X-Generator: Poedit 1.5.4\n"
+"Language: hu\n"
+
+#: emsstrings.emsactive
+msgid "Scripting active."
+msgstr "Szkriptek használata bekapcsolva."
+
+#: emsstrings.emsbtntestagain
+msgid "Test again"
+msgstr "Újratesztelés"
+
+#: emsstrings.emseditormacrotitle
+#, fuzzy
+msgid "Editor Macro Script"
+msgstr "Szerkesztő Makrószkript"
+
+#: emsstrings.emsnotactive
+msgid "Scripting not active. Selftest failed."
+msgstr "Szkriptek használata kikapcsolva. Az önellenőrzés sikertelen volt."
+
+#: emsstrings.emsnotsupported
+msgid "Scripting not active. Not supported on this platform or CPU."
+msgstr "Szkriptek használata kikapcsolva. Nem támogatott platform vagy CPU."
+
+#: emsstrings.emspending
+msgid "Scripting not active. Selftest will run next time the IDE is started."
+msgstr ""
+"Szkriptek használata kikapcsolva. Az önellenőrzés az IDE következő "
+"indításakor fut."
+
+#: emsstrings.emsselftesterrcaption
+msgid "Error in EditorMacroScript"
+msgstr "EditorMacroScript hiba"
+
+#: emsstrings.emsselftestfailed
+msgid ""
+"The package EditorMacroScript (pascalscript macros) has detected a problem "
+"and was deactivated.%0:sThe package failed its selftest with the message:%0:s"
+"\"%1:s\""
+msgstr ""
+"Az EditorMacroScript (pascalscript makrók) hibát érzékelt és ki lett "
+"kapcsolva.%0:sA csomag önellenőrzése sikertelenül zárult a következő "
+"üzenettel::%0:s\"%1:s\""
+
+#: emsstrings.emsselftestfailedlasttime
+msgid ""
+"The package EditorMacroScript (pascalscript macros) has detected a problem "
+"and was deactivated.%0:sThe package selftest was not completed during the "
+"last start of the IDE."
+msgstr ""
+"Az EditorMacroScript (pascalscript makrók) hibát érzékelt és ki lett "
+"kapcsolva.%0:sA csomag önellenőrzése nem futott végig az IDE legutóbbi "
+"indításakor."
+
+#: emsstrings.emsstatustitle
+msgid "Status"
+msgstr "Állapot"
--- a/components/memds/languages/frmselectdataset.hu.po
+++ b/components/memds/languages/frmselectdataset.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: frmselectdataset.scancelbtn
 msgid "Cancel"
--- a/components/messagecomposer/languages/messagecomposer.hu.po
+++ b/components/messagecomposer/languages/messagecomposer.hu.po
@ -50,11 +50,11 @@ msgstr "Törlés"

 #: messagecomposer.sdlgcaption
 msgid "Dialog caption"
-msgstr "Párbeszédpanel címe"
+msgstr "Párbeszéd címe"

 #: messagecomposer.sdlgtype
 msgid "Dialog type"
-msgstr "Párbeszédpanel típusa"
+msgstr "Párbeszéd típusa"

 #: messagecomposer.shelpcontext
 msgid "Help context"
@ -77,8 +77,9 @@ msgid "Kind of message"
 msgstr "Az üzenet típusa"

 #: messagecomposer.smaskinput
+#, fuzzy
 msgid "Mask input"
-msgstr ""
+msgstr "Maszk bevitel"

 #: messagecomposer.smessagecomposercaption
 msgctxt "messagecomposer.smessagecomposercaption"
--- a/components/pochecker/languages/pocheckerconsts.hu.po
+++ b/components/pochecker/languages/pocheckerconsts.hu.po
@ -107,7 +107,9 @@ msgstr "A(z) %s azonosító nem található ebben: %s"

 #: pocheckerconsts.sincompatibleformatargs
 msgid "[Line: %d] Incompatible and/or invalid format() arguments for:"
-msgstr "[Sor: %d] Nem megfelelő és/vagy érvénytelen format() paraméterek a következőben:"
+msgstr ""
+"[Sor: %d] Nem megfelelő és/vagy érvénytelen format() paraméterek a "
+"következőben:"

 #: pocheckerconsts.slineinfilename
 msgid "[Line %d] in %s:"
@ -197,13 +199,12 @@ msgstr ""

 #: pocheckerconsts.sselectalltests
 msgid "Select &All"
-msgstr ""
+msgstr "Összes kijelölése"

 #: pocheckerconsts.sselectbasictests
-#, fuzzy
-#| msgid "Select &Basic Tests"
+#| msgid "Select basic tests"
 msgid "Select &Basic"
-msgstr "Alapvető tesztek kijelölése"
+msgstr "Alapvetőek kijelölése"

 #: pocheckerconsts.sselecttesttypes
 msgid "Select test types"
@ -227,5 +228,4 @@ msgstr "Fordítási statisztika ehhez:"

 #: pocheckerconsts.sunselectalltests
 msgid "&Unselect All"
-msgstr ""
-
+msgstr "Kijelölések törlése"
--- a/components/printers/design/languages/ideprinting.hu.po
+++ b/components/printers/design/languages/ideprinting.hu.po
@ -5,11 +5,11 @@ msgstr ""
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
+"Language: hu\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "X-Generator: Poedit 1.5.4\n"
-"Language: hu\n"

 #: ideprinting.sdescrformatting
 msgid "Formatting"
--- a/components/projecttemplates/languages/frmtemplatevariables.hu.po
+++ b/components/projecttemplates/languages/frmtemplatevariables.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: frmtemplatevariables.screateindir
 msgid "Create in &directory:"
--- a/components/projecttemplates/languages/idetemplateproject.hu.po
+++ b/components/projecttemplates/languages/idetemplateproject.hu.po
@ -1,17 +1,18 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: idetemplateproject.snewfromtemplate
+msgctxt "idetemplateproject.snewfromtemplate"
 msgid "New project from template"
 msgstr "Új projekt sablonból"

--- a/components/projecttemplates/languages/projecttemplates.hu.po
+++ b/components/projecttemplates/languages/projecttemplates.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: projecttemplates.sbtncancel
 msgid "Cancel"
--- a/components/synedit/languages/syndesignstringconstants.hu.po
+++ b/components/synedit/languages/syndesignstringconstants.hu.po
@ -30,7 +30,7 @@ msgstr "Sorszámok"

 #: syndesignstringconstants.syndslineoverview
 msgid "Line Overview"
-msgstr ""
+msgstr "Sor áttekintés"

 #: syndesignstringconstants.syndsresetmouseactions
 msgid "Reset mouse actions"
--- a/components/synedit/languages/syneditstrconst.hu.po
+++ b/components/synedit/languages/syneditstrconst.hu.po
@ -650,7 +650,7 @@ msgstr "GEMBASE fájlok (*.dml,*.gem)|*.DML;*.GEM"

 #: syneditstrconst.syns_filtergws
 msgid "GW-TEL Script Files (*.gws)|*.gws"
-msgstr "GW-TEL Script fájlok (*.gws)|*.gws"
+msgstr "GW-TEL parancsfájlok (*.gws)|*.gws"

 #: syneditstrconst.syns_filterhp48
 msgid "HP48 Files (*.s,*.sou,*.a,*.hp)|*.s;*.sou;*.a;*.hp"
@ -666,7 +666,7 @@ msgstr "INI-fájlok (*.ini)|*.ini"

 #: syneditstrconst.syns_filterinno
 msgid "Inno Setup Script Files (*.iss)|*.iss"
-msgstr "Inno Setup Script fájlok (*.iss)|*.iss"
+msgstr "Inno Setup parancsfájlok (*.iss)|*.iss"

 #: syneditstrconst.syns_filterjava
 msgid "Java Files (*.java)|*.java"
--- a/components/tdbf/languages/registerdbf.hu.po
+++ b/components/tdbf/languages/registerdbf.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: registerdbf.dbfsalldbasefiles
 msgid "DBase Files"
--- a/doceditor/languages/lazde.hu.po
+++ b/doceditor/languages/lazde.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: lazdemsg.saboutformcaption
 msgid "About this application"
--- a/languages/debuggerstrconst.hu.po
+++ b/languages/debuggerstrconst.hu.po
@ -1,15 +1,15 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: debuggerstrconst.drsbreakpointcolwidthaction
 msgid "Action column"
--- a/languages/lazaruside.hu.po
+++ b/languages/lazaruside.hu.po
--- a/lcl/languages/lclstrconsts.hu.po
+++ b/lcl/languages/lclstrconsts.hu.po
@ -5,29 +5,26 @@ msgstr ""
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
+"Language: hu\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "X-Generator: Poedit 1.5.4\n"
-"Language: hu\n"

 #: lclstrconsts.hhshelpbrowsernotexecutable
-#, fuzzy
 #| msgid "Browser %s%s%s not executable."
 msgid "Browser \"%s\" not executable."
-msgstr "A böngésző nem végrehajtható: %s%s%s"
+msgstr "A böngésző nem végrehajtható: \"%s\""

 #: lclstrconsts.hhshelpbrowsernotfound
-#, fuzzy
 #| msgid "Browser %s%s%s not found."
 msgid "Browser \"%s\" not found."
-msgstr "A böngésző nem található: %s%s%s"
+msgstr "A böngésző nem található: \"%s\""

 #: lclstrconsts.hhshelperrorwhileexecuting
-#, fuzzy
 #| msgid "Error while executing %s%s%s:%s%s"
 msgid "Error while executing \"%s\":%s%s"
-msgstr "Hiba a végrehajtás közben: %s%s%s:%s%s"
+msgstr "Hiba a végrehajtás közben: \"%s\":%s%s"

 #: lclstrconsts.hhshelpnohtmlbrowserfound
 msgid "Unable to find a HTML browser."
@ -38,10 +35,9 @@ msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help ->
 msgstr "Nincs HTML böngésző. %s Meg kell adni egyet: Eszközök -> Beállítások -> Súgó -> Súgó beállítások"

 #: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile
-#, fuzzy
 #| msgid "The help database %s%s%s was unable to find file %s%s%s."
 msgid "The help database \"%s\" was unable to find file \"%s\"."
-msgstr "A(z) %s%s%s súgóadatbázishoz hiányzik a %s%s%s fájl."
+msgstr "A(z) \"%s\" súgóadatbázishoz hiányzik a \"%s\" fájl."

 #: lclstrconsts.hhshelpthemacrosinbrowserparamswillbereplacedbytheurl
 msgid "The macro %s in BrowserParams will be replaced by the URL."
@ -60,9 +56,8 @@ msgid "Accept"
 msgstr "Elfogadás"

 #: lclstrconsts.ifsvk_apps
-#, fuzzy
 msgid "application key"
-msgstr "Alkalmazás gomb"
+msgstr "Alkalmazás billentyű"

 #: lclstrconsts.ifsvk_back
 msgid "Backspace"
@ -159,7 +154,7 @@ msgstr "Balra"

 #: lclstrconsts.ifsvk_lwin
 msgid "left windows key"
-msgstr "bal windows gomb"
+msgstr "bal windows billentyű"

 #: lclstrconsts.ifsvk_mbutton
 msgid "Mouse Button Middle"
@ -198,7 +193,7 @@ msgstr "Numpad %d"

 #: lclstrconsts.ifsvk_pause
 msgid "Pause key"
-msgstr "Pause gomb"
+msgstr "Pause billentyű"

 #: lclstrconsts.ifsvk_print
 msgid "Print"
@ -224,7 +219,7 @@ msgstr "Jobbra"

 #: lclstrconsts.ifsvk_rwin
 msgid "right windows key"
-msgstr "jobb windows gomb"
+msgstr "jobb windows billentyű"

 #: lclstrconsts.ifsvk_scroll
 msgid "Scroll"
@ -538,12 +533,10 @@ msgid "First"
 msgstr "Első"

 #: lclstrconsts.rsfixedcolstoobig
-#| msgid "FixedCols can't be >= ColCount"
 msgid "FixedCols can't be > ColCount"
 msgstr "FixedCols nem lehet > ColCount"

 #: lclstrconsts.rsfixedrowstoobig
-#| msgid "FixedRows can't be >= RowCount"
 msgid "FixedRows can't be > RowCount"
 msgstr "FixedRows nem lehet > RowCount"

@ -569,11 +562,11 @@ msgstr "Fukszia"

 #: lclstrconsts.rsgdkoptiondebug
 msgid "--gdk-debug flags     Turn on specific GDK trace/debug messages."
-msgstr ""
+msgstr "--gdk-debug jelzők     Bekapcsolja a megadott GDK nyomkövetési/hibakeresési üzeneteket."

 #: lclstrconsts.rsgdkoptionnodebug
 msgid "--gdk-no-debug flags  Turn off specific GDK trace/debug messages."
-msgstr ""
+msgstr "--gdk-no-debug jelzők     Kikapcsolja a megadott GDK nyomkövetési/hibakeresési üzeneteket."

 #: lclstrconsts.rsgif
 msgid "Graphics Interchange Format"
@ -581,7 +574,7 @@ msgstr "Graphics Interchange Format"

 #: lclstrconsts.rsgoptionfatalwarnings
 msgid "--g-fatal-warnings    Warnings and errors generated by Gtk+/GDK will halt the application."
-msgstr ""
+msgstr "--g-fatal-warnings    A Gtk+/GDK által generált figyelmeztetések és hibák leállítják az alkalmazást."

 #: lclstrconsts.rsgradientactivecaptioncolorcaption
 msgid "Gradient Active Caption"
@ -593,7 +586,7 @@ msgstr "Inaktív gradiens cím"

 #: lclstrconsts.rsgraphic
 msgid "Graphic"
-msgstr ""
+msgstr "Grafika"

 #: lclstrconsts.rsgraycolorcaption
 msgid "Gray"
@ -633,7 +626,7 @@ msgstr ""

 #: lclstrconsts.rsgtkoptiondebug
 msgid "--gtk-debug flags     Turn on specific Gtk+ trace/debug messages."
-msgstr ""
+msgstr "--gtk-debug jelzők     Bekapcsolja a megadott Gtk+ nyomkövetési/hibakeresési üzeneteket."

 #: lclstrconsts.rsgtkoptiondisplay
 msgid "--display h:s:d       Connect to the specified X server, where \"h\" is the hostname, \"s\" is the server number (usually 0), and \"d\" is the display number (typically omitted). If --display is not specified, the DISPLAY environment variable is used."
@ -641,23 +634,23 @@ msgstr ""

 #: lclstrconsts.rsgtkoptionmodule
 msgid "--gtk-module module   Load the specified module at startup."
-msgstr ""
+msgstr "--gtk-module modul    Betölti a megadott modult induláskor."

 #: lclstrconsts.rsgtkoptionname
 msgid "--name programe       Set program name to \"progname\". If not specified, program name will be set to ParamStrUTF8(0)."
-msgstr ""
+msgstr "--name prognév       Beállítja a program nevét a \"prognév\" értékére. Ha nincs megadva, a program neve a ParamStrUTF8(0) értékére lesz beállítva."

 #: lclstrconsts.rsgtkoptionnodebug
 msgid "--gtk-no-debug flags  Turn off specific Gtk+ trace/debug messages."
-msgstr ""
+msgstr "--gtk-no-debug jelzők  Kikapcsolja a megadott Gtk+ nyomkövetési/hibakeresési üzeneteket."

 #: lclstrconsts.rsgtkoptionnotransient
 msgid "--lcl-no-transient    Do not set transient order for modal forms"
-msgstr ""
+msgstr "--lcl-no-transient    Nem lesz beállítva ideiglenes sorrend a modal form-ok számára"

 #: lclstrconsts.rsgtkoptionnoxshm
 msgid "--no-xshm             Disable use of the X Shared Memory Extension."
-msgstr ""
+msgstr "--no-xshm             Letiltja az X Shared Memory Extension használatát."

 #: lclstrconsts.rsgtkoptionsync
 msgid "--sync                Call XSynchronize (display, True) after the Xserver connection has been established. This makes debugging X protocol errors easier, because X request buffering will be disabled and X errors will be received immediately after the protocol request that generated the error has been processed by the X server."
@ -684,52 +677,45 @@ msgid "Help context %s not found."
 msgstr "A(z) %s súgó témakör nem található"

 #: lclstrconsts.rshelphelpcontextnotfoundindatabase
-#, fuzzy
 #| msgid "Help context %s not found in Database %s%s%s."
 msgid "Help context %s not found in Database \"%s\"."
-msgstr "A(z) %s súgó témakör nem található a(z) %s%s%s adatbázisban."
+msgstr "A(z) %s súgó témakör nem található a(z) \"%s\" adatbázisban."

 #: lclstrconsts.rshelphelpdatabasedidnotfoundaviewerforahelppageoftype
 #, fuzzy
-#| msgid "Help Database %s%s%s did not found a viewer for a help page of type %s"
+#| msgid "Help Database %s%s%s did not found a viewer for a help page of type %sHelp Database \"%s\" did not found a viewer for a help page of type %s"
 msgid "Help Database \"%s\" did not found a viewer for a help page of type %s"
-msgstr "A(z) %s%s%s súgó adatbázis nem talált megjelenítőt a(z) %s típusú súgó oldalhoz"
+msgstr "A(z) \"%s\" súgó adatbázis nem talált megjelenítőt a(z) %s típusú súgó oldalhoz"

 #: lclstrconsts.rshelphelpdatabasenotfound
-#, fuzzy
 #| msgid "Help Database %s%s%s not found"
 msgid "Help Database \"%s\" not found"
-msgstr "A(z) %s%s%s súgó adatbázis nem található"
+msgstr "A(z) \"%s\" súgó adatbázis nem található"

 #: lclstrconsts.rshelphelpfordirectivenotfound
-#, fuzzy
 #| msgid "Help for directive %s%s%s not found."
 msgid "Help for directive \"%s\" not found."
-msgstr "Nem található súgó a(z) %s%s%s direktívához."
+msgstr "Nem található súgó a(z) \"%s\" direktívához."

 #: lclstrconsts.rshelphelpfordirectivenotfoundindatabase
-#, fuzzy
 #| msgid "Help for directive %s%s%s not found in Database %s%s%s."
 msgid "Help for directive \"%s\" not found in Database \"%s\"."
-msgstr "Nem található súgó a(z) %s%s%s direktívához a(z) %s%s%s adatbázisban."
+msgstr "Nem található súgó a(z) \"%s\" direktívához a(z) \"%s\" adatbázisban."

 #: lclstrconsts.rshelphelpkeywordnotfound
-#, fuzzy
 #| msgid "Help keyword %s%s%s not found."
 msgid "Help keyword \"%s\" not found."
-msgstr "A(z) %s%s%s súgó kulcsszó nem található"
+msgstr "A(z) \"%s\" súgó kulcsszó nem található."

 #: lclstrconsts.rshelphelpkeywordnotfoundindatabase
-#, fuzzy
 #| msgid "Help keyword %s%s%s not found in Database %s%s%s."
 msgid "Help keyword \"%s\" not found in Database \"%s\"."
-msgstr "A(z) %s%s%s súgó kulcsszó nem található a(z) %s%s%s adatbázisban."
+msgstr "A(z) \"%s\" súgó kulcsszó nem található a(z) \"%s\" adatbázisban."

 #: lclstrconsts.rshelphelpnodehasnohelpdatabase
-#, fuzzy
 #| msgid "Help node %s%s%s has no Help Database"
 msgid "Help node \"%s\" has no Help Database"
-msgstr "A(z) %s%s%s elemhez nincs súgó az adatbázisban"
+msgstr "A(z) \"%s\" elemhez nincs súgó adatbázis"

 #: lclstrconsts.rshelpnohelpfoundforsource
 msgid "No help found for line %d, column %d of %s."
@ -752,10 +738,9 @@ msgid "Help Selector Error"
 msgstr "Súgó kiválasztó hiba"

 #: lclstrconsts.rshelpthereisnoviewerforhelptype
-#, fuzzy
 #| msgid "There is no viewer for help type %s%s%s"
 msgid "There is no viewer for help type \"%s\""
-msgstr "Nincs megjelenítő a(z) %s%s%s típusú súgóhoz"
+msgstr "Nincs megjelenítő a(z) \"%s\" típusú súgóhoz."

 #: lclstrconsts.rshelpviewererror
 msgid "Help Viewer Error"
@ -915,7 +900,7 @@ msgstr "&Súgó"

 #: lclstrconsts.rsmbignore
 msgid "&Ignore"
-msgstr "M&ellőz"
+msgstr "Ki&hagyás"

 #: lclstrconsts.rsmbno
 msgid "&No"
@ -1084,7 +1069,7 @@ msgstr "Lila"

 #: lclstrconsts.rsqtoptiondograb
 msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG."
-msgstr ""
+msgstr "-dograb (csak X11 alatt), a hibakeresőben történő futtatás akaratlan \"-nograb\"-ot okozhat, a -dograb használata ezt bírálja felül. QT_DEBUG szükséges hozzá."

 #: lclstrconsts.rsqtoptiongraphicsstyle
 msgid "-graphicssystem param, sets the backend to be used for on-screen widgets and QPixmaps. Available options are native, raster and opengl. OpenGL is still unstable."
@ -1092,15 +1077,15 @@ msgstr ""

 #: lclstrconsts.rsqtoptionnograb
 msgid "-nograb, tells Qt that it must never grab the mouse or the keyboard. Need QT_DEBUG."
-msgstr ""
+msgstr "-nograb, utasítja a Qt rendszert, hogy ne sajátítsa ki az egeret vagy a billentyűzetet. QT_DEBUG szükséges hozzá."

 #: lclstrconsts.rsqtoptionreverse
 msgid "-reverse, sets the application's layout direction to Qt::RightToLeft."
-msgstr ""
+msgstr "-reverse, beállítja az alkalmazás elrendezési irányát a Qt::RightToLeft értékre."

 #: lclstrconsts.rsqtoptionsession
 msgid "-session session, restores the application from an earlier session."
-msgstr ""
+msgstr "-session munkamenet, visszaállítja az alkalmazást egy korábbi munkamenetből."

 #: lclstrconsts.rsqtoptionstyle
 msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style  command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)."
@ -1112,7 +1097,7 @@ msgstr ""

 #: lclstrconsts.rsqtoptionsync
 msgid "-sync (only under X11), switches to synchronous mode for debugging."
-msgstr ""
+msgstr "-sync (csak X11 alatt), szinkronmódba kapcsol a hibakereséshez."

 #: lclstrconsts.rsqtoptionwidgetcount
 msgid "-widgetcount, prints debug message at the end about number of widgets left undestroyed and maximum number of widgets existed at the same time."
@ -1120,35 +1105,35 @@ msgstr ""

 #: lclstrconsts.rsqtoptionx11bgcolor
 msgid "-bg or -background color, sets the default background color and an application palette (light and dark shades are calculated)."
-msgstr ""
+msgstr "-bg vagy -background szín, beállítja az alkalmazás alapértelmezett háttérszínét és színkészletét (a világos és sötét árnyalatok számított értékek)."

 #: lclstrconsts.rsqtoptionx11btncolor
 msgid "-btn or -button color, sets the default button color."
-msgstr ""
+msgstr "-btn vagy -button szín, beállítja a gombok alapértelmezett színét."

 #: lclstrconsts.rsqtoptionx11cmap
 msgid "-cmap, causes the application to install a private color map on an 8-bit display."
-msgstr ""
+msgstr "-cmap, egyéni színösszeállítás használatára kényszeríti az alkalmazást 8-bites megjelenítőn."

 #: lclstrconsts.rsqtoptionx11display
 msgid "-display display, sets the X display (default is $DISPLAY)."
-msgstr ""
+msgstr "-display megjelenítő, beállítja az X megjelenítőt (alapértelmezett a $DISPLAY)."

 #: lclstrconsts.rsqtoptionx11fgcolor
 msgid "-fg or -foreground color, sets the default foreground color."
-msgstr ""
+msgstr "-fg vagy -foreground szín, beállítja az alapértelmezett előtérszínt."

 #: lclstrconsts.rsqtoptionx11font
 msgid "-fn or -font font, defines the application font. The font should be specified using an X logical font description."
-msgstr ""
+msgstr "-fn vagy -font betűtípus, beállítja az alkalmazás betűtípusát, A betűtípust az X logikai betűtípus leírás használatával kell megadni."

 #: lclstrconsts.rsqtoptionx11geometry
 msgid "-geometry geometry, sets the client geometry of the first window that is shown."
-msgstr ""
+msgstr "-geometry elhelyezés, megadja az elsőként megjelenő ablak elhelyezkedését."

 #: lclstrconsts.rsqtoptionx11im
 msgid "-im, sets the input method server (equivalent to setting the XMODIFIERS environment variable)."
-msgstr ""
+msgstr "-im, beállítja a beviteli mód kiszolgálóját (ugyanúgy mint az XMODIFIERS környezeti változó beállítása)."

 #: lclstrconsts.rsqtoptionx11inputstyle
 msgid "-inputstyle, defines how the input is inserted into the given widget, e.g. onTheSpot makes the input appear directly in the widget, while overTheSpot makes the input appear in a box floating over the widget and is not inserted until the editing is done."
@ -1156,7 +1141,7 @@ msgstr ""

 #: lclstrconsts.rsqtoptionx11name
 msgid "-name name, sets the application name."
-msgstr ""
+msgstr "-name név, beállítja az alkalmazás nevét."

 #: lclstrconsts.rsqtoptionx11ncols
 msgid "-ncols count, limits the number of colors allocated in the color cube on an 8-bit display, if the application is using the QApplication::ManyColor color specification. If count is 216 then a 6x6x6 color cube is used (i.e. 6 levels of red, 6 of green, and 6 of blue); for other values, a cube approximately proportional to a 2x3x1 cube is used."
@ -1164,23 +1149,25 @@ msgstr ""

 #: lclstrconsts.rsqtoptionx11title
 msgid "-title title, sets the application title."
-msgstr ""
+msgstr "-title cím, beállítja az alkalmazás címét."

 #: lclstrconsts.rsqtoptionx11visual
 msgid "-visual TrueColor, forces the application to use a TrueColor visual on an 8-bit display."
-msgstr ""
+msgstr "-visual TrueColor, az alkalmazást TrueColor megjelenítés használatára kényszeríti 8-bites megjelenítőn."

 #: lclstrconsts.rsrasterimageendupdate
+#, fuzzy
 msgid "Endupdate while no update in progress"
-msgstr ""
+msgstr "Endupdate esemény miközben nincs frissítés folyamatban"

 #: lclstrconsts.rsrasterimagesaveinupdate
 msgid "Cannot save image while update in progress"
 msgstr "A kép mentése nem lehetséges frissítés közben"

 #: lclstrconsts.rsrasterimageupdateall
+#, fuzzy
 msgid "Cannot begin update all when canvas only update in progress"
-msgstr ""
+msgstr "Nem kezdhető el az összes frissítése amikor helyi frissítés van folyamatban"

 #: lclstrconsts.rsredcolorcaption
 msgid "Red"
@ -1201,7 +1188,7 @@ msgstr "Mindet cseréli"
 #: lclstrconsts.rsresourcenotfound
 msgctxt "lclstrconsts.rsresourcenotfound"
 msgid "Resource %s not found"
-msgstr "Az erőforrás nincs meg: %s"
+msgstr "Az erőforrás nem található: %s"

 #: lclstrconsts.rsscrollbarcolorcaption
 msgid "ScrollBar"
@ -1499,7 +1486,7 @@ msgstr "Érvénytelen egész szám: %s"

 #: lclstrconsts.sparlocinfo
 msgid " (at %d,%d, stream offset %d)"
-msgstr "(itt: %d,%d, az adatfolyamban itt: %d)"
+msgstr " (itt: %d,%d, az adatfolyamban itt: %d)"

 #: lclstrconsts.sparunterminatedbinvalue
 msgid "Unterminated byte value"
--- a/tools/lazdatadesktop/languages/lazdatadesktop.hu.po
+++ b/tools/lazdatadesktop/languages/lazdatadesktop.hu.po
@ -1,19 +1,19 @@
 msgid ""
 msgstr ""
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
 "Project-Id-Version: \n"
 "POT-Creation-Date: \n"
 "PO-Revision-Date: \n"
 "Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
 "Language-Team: Magyar (Hungarian)\n"
-"X-Generator: Poedit 1.5.4\n"
 "Language: hu\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Generator: Poedit 1.5.4\n"

 #: lazdatadeskstr.eoaddterminator
 msgid "Add terminator"
-msgstr ""
+msgstr "Lezárás hozzáadása"

 #: lazdatadeskstr.eoandtermsinbrackets
 msgid "Put brackets around AND Terms"
@ -33,7 +33,7 @@ msgstr "Mezőnevek idézőjelben"

 #: lazdatadeskstr.eoskipforeignkeys
 msgid "Skip foreign keys"
-msgstr ""
+msgstr "Külső kulcsok átugrása"

 #: lazdatadeskstr.eouseoldinwhereparams
 msgid "Use OLD prefix in where parameters"
@ -153,7 +153,7 @@ msgstr "Mező"

 #: lazdatadeskstr.sforeignkey
 msgid "Foreign key"
-msgstr ""
+msgstr "Külső kulcs"

 #: lazdatadeskstr.shintclose
 msgid "Close query result data panel"
@ -205,11 +205,11 @@ msgstr "Tartomány hozzáadása az adatszótárhoz"

 #: lazdatadeskstr.sld_actionaddforeignkey
 msgid "New Foreign Key"
-msgstr ""
+msgstr "Új külső kulcs"

 #: lazdatadeskstr.sld_actionaddforeignkeyh
 msgid "Add a foreign key to the table"
-msgstr ""
+msgstr "Külső kulcs hozzáadása a táblához"

 #: lazdatadeskstr.sld_actionaddsequence
 msgid "New sequence"
@ -624,11 +624,11 @@ msgstr "Az új mező nevének megadása:"

 #: lazdatadeskstr.snewforeignkey
 msgid "Create new foreign key in table %s"
-msgstr ""
+msgstr "Új külső kulcs létrehozása a(z) %s táblában"

 #: lazdatadeskstr.snewforeignkeyname
 msgid "Enter a name for the new foreign key:"
-msgstr ""
+msgstr "Név megadása az új külső kulcs számára:"

 #: lazdatadeskstr.snewindex
 msgid "Create new index on table %s"
@ -644,11 +644,11 @@ msgstr "Új %s létrehozása"

 #: lazdatadeskstr.snewsequence
 msgid "Create new sequence"
-msgstr ""
+msgstr "Új sorozat étrehozása"

 #: lazdatadeskstr.snewsequencename
 msgid "Enter a name for the new sequence:"
-msgstr ""
+msgstr "Név megadása az új sorozat számára:"

 #: lazdatadeskstr.snewtable
 msgid "Create new table"
@ -682,7 +682,7 @@ msgstr "Mezők"

 #: lazdatadeskstr.snodeforeignkeys
 msgid "Foreign keys"
-msgstr ""
+msgstr "Külső kulcsok"

 #: lazdatadeskstr.snodeindexes
 msgid "Indexes"