mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-08-26 22:03:08 +02:00
Translations: Slovak translation update by LacaK, issue #39536
This commit is contained in:
Maxim Ganetsky
parent
624ef51567
commit
ab98595350
@ -3,13 +3,13 @@ msgstr ""
|
|||||||
"Project-Id-Version: lazaruside\n"
|
"Project-Id-Version: lazaruside\n"
|
||||||
"Report-Msgid-Bugs-To: \n"
|
"Report-Msgid-Bugs-To: \n"
|
||||||
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
|
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
|
||||||
"PO-Revision-Date: 2020-08-10 10:46+0200\n"
|
"PO-Revision-Date: 2022-01-07 17:50+0100\n"
|
||||||
"Last-Translator: Slavko <slavino@slavino.sk>\n"
|
"Last-Translator: Slavko <slavino@slavino.sk>\n"
|
||||||
"Language-Team: Slovenský <sk@li.org>\n"
|
"Language-Team: Slovenský <sk@li.org>\n"
|
||||||
"MIME-Version: 1.0\n"
|
"MIME-Version: 1.0\n"
|
||||||
"Content-Type: text/plain; charset=UTF-8\n"
|
"Content-Type: text/plain; charset=UTF-8\n"
|
||||||
"Content-Transfer-Encoding: 8bit\n"
|
"Content-Transfer-Encoding: 8bit\n"
|
||||||
"X-Generator: Poedit 2.2.3\n"
|
"X-Generator: Poedit 3.0\n"
|
||||||
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
||||||
"Language: sk\n"
|
"Language: sk\n"
|
||||||
|
|
||||||
@ -59,7 +59,7 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Unknown Breakpoint %s"
|
msgid "Unknown Breakpoint %s"
|
||||||
msgstr ""
|
msgstr "Neznámy bod prerušenia %s"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
#: lazarusidestrconsts.dbgeventbreakwatchpoint
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -342,7 +342,7 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
||||||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
||||||
msgid "Right"
|
msgid "Right"
|
||||||
msgstr "šípka vpravo"
|
msgstr "Vpravo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
||||||
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
||||||
@ -787,7 +787,7 @@ msgstr "Automaticky na malé písmená"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
||||||
msgid "Auto save active desktop"
|
msgid "Auto save active desktop"
|
||||||
msgstr ""
|
msgstr "Automatické uloženie aktívnej pracovnej plochy"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
||||||
msgid ""
|
msgid ""
|
||||||
@ -829,14 +829,12 @@ msgid "Selection"
|
|||||||
msgstr "Výber"
|
msgstr "Výber"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgblockindent
|
#: lazarusidestrconsts.dlgblockindent
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Block indent"
|
|
||||||
msgid "Block indent (spaces)"
|
msgid "Block indent (spaces)"
|
||||||
msgstr "Odsadenie bloku"
|
msgstr "Odsadenie bloku (medzery)"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgblockindentkeys
|
#: lazarusidestrconsts.dlgblockindentkeys
|
||||||
msgid "Block indent"
|
msgid "Block indent"
|
||||||
msgstr ""
|
msgstr "Odsadenie bloku"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgblockindentlink
|
#: lazarusidestrconsts.dlgblockindentlink
|
||||||
msgid "(edit keys)"
|
msgid "(edit keys)"
|
||||||
@ -944,7 +942,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
||||||
msgid "Test: Checking sources in fpc ppu search paths ..."
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
||||||
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu"
|
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
||||||
msgid "Test: Compiling an empty file"
|
msgid "Test: Compiling an empty file"
|
||||||
@ -1678,7 +1676,7 @@ msgstr "On"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgedtabindent
|
#: lazarusidestrconsts.dlgedtabindent
|
||||||
msgid "Tab and Indent"
|
msgid "Tab and Indent"
|
||||||
msgstr ""
|
msgstr "Tab a odsadenie"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgedunder
|
#: lazarusidestrconsts.dlgedunder
|
||||||
msgid "Underline"
|
msgid "Underline"
|
||||||
@ -1790,7 +1788,6 @@ msgid "%s files"
|
|||||||
msgstr ""
|
msgstr ""
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterall
|
#: lazarusidestrconsts.dlgfilterall
|
||||||
#, fuzzy
|
|
||||||
msgctxt "lazarusidestrconsts.dlgfilterall"
|
msgctxt "lazarusidestrconsts.dlgfilterall"
|
||||||
msgid "All files"
|
msgid "All files"
|
||||||
msgstr "Všetky súbory"
|
msgstr "Všetky súbory"
|
||||||
@ -1806,23 +1803,22 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterdelphiform
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
||||||
msgid "Delphi form"
|
msgid "Delphi form"
|
||||||
msgstr ""
|
msgstr "Delphi formulár"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterdelphipackage
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
||||||
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
|
||||||
msgid "Delphi package"
|
msgid "Delphi package"
|
||||||
msgstr ""
|
msgstr "Delphi balíček"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterdelphiproject
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
||||||
#, fuzzy
|
|
||||||
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
|
||||||
msgid "Delphi project"
|
msgid "Delphi project"
|
||||||
msgstr "Projekt Delphi"
|
msgstr "Delphi projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterdelphiunit
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
||||||
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
|
||||||
msgid "Delphi unit"
|
msgid "Delphi unit"
|
||||||
msgstr ""
|
msgstr "Delphi jednotka"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgfilterexecutable
|
#: lazarusidestrconsts.dlgfilterexecutable
|
||||||
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
|
||||||
@ -2819,7 +2815,7 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
||||||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
||||||
msgid "Left"
|
msgid "Left"
|
||||||
msgstr "šípka vľavo"
|
msgstr "Vľavo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
||||||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
||||||
@ -2833,7 +2829,7 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.dlgmouseoptbtnright
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
||||||
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
||||||
msgid "Right"
|
msgid "Right"
|
||||||
msgstr "šípka vpravo"
|
msgstr "Vpravo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
||||||
msgid "Wheel down"
|
msgid "Wheel down"
|
||||||
@ -3196,7 +3192,7 @@ msgstr "Pomenovanie"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgnewdesktop
|
#: lazarusidestrconsts.dlgnewdesktop
|
||||||
msgid "New desktop ..."
|
msgid "New desktop ..."
|
||||||
msgstr ""
|
msgstr "Nová pracovná plocha ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgnewprojecttype
|
#: lazarusidestrconsts.dlgnewprojecttype
|
||||||
msgid "New Project Type"
|
msgid "New Project Type"
|
||||||
@ -3580,7 +3576,7 @@ msgstr "Prichytiť k mriežke"
|
|||||||
#: lazarusidestrconsts.dlgreallydeletedesktop
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Really delete desktop \"%s\"?"
|
msgid "Really delete desktop \"%s\"?"
|
||||||
msgstr ""
|
msgstr "Naozaj zmazať pracovnú plochu \"%s\"?"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgreferencecolor
|
#: lazarusidestrconsts.dlgreferencecolor
|
||||||
msgid "Reference"
|
msgid "Reference"
|
||||||
@ -3592,7 +3588,7 @@ msgstr "&Regulárne výrazy"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgrenamedesktop
|
#: lazarusidestrconsts.dlgrenamedesktop
|
||||||
msgid "Rename desktop"
|
msgid "Rename desktop"
|
||||||
msgstr ""
|
msgstr "Premenovať pracovnú plochu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
|
||||||
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
|
||||||
@ -3601,7 +3597,7 @@ msgstr "Premenovať"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
|
||||||
msgid "Rename selected desktop"
|
msgid "Rename selected desktop"
|
||||||
msgstr ""
|
msgstr "Premenovať vybratú pracovnú plochu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgreplaceall
|
#: lazarusidestrconsts.dlgreplaceall
|
||||||
msgid "Replace &All"
|
msgid "Replace &All"
|
||||||
@ -4212,7 +4208,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlguseunitcaption
|
#: lazarusidestrconsts.dlguseunitcaption
|
||||||
msgid "Add unit to Uses section"
|
msgid "Add unit to Uses section"
|
||||||
msgstr ""
|
msgstr "Pridať jednotku do sekcie Uses"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgvaluecolor
|
#: lazarusidestrconsts.dlgvaluecolor
|
||||||
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
||||||
@ -4221,7 +4217,7 @@ msgstr "Hodnota"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.dlgverbosity
|
#: lazarusidestrconsts.dlgverbosity
|
||||||
msgid "Verbosity during compilation:"
|
msgid "Verbosity during compilation:"
|
||||||
msgstr "Výrečnosť počas prekladu"
|
msgstr "Výrečnosť počas prekladu:"
|
||||||
|
|
||||||
#: lazarusidestrconsts.dlgvisiblegutter
|
#: lazarusidestrconsts.dlgvisiblegutter
|
||||||
msgid "Visible gutter"
|
msgid "Visible gutter"
|
||||||
@ -5660,7 +5656,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
||||||
msgid "Can only change the class of TComponents."
|
msgid "Can only change the class of TComponents."
|
||||||
msgstr "Zmeniť možno len triedu TComponents"
|
msgstr "Zmeniť možno len triedu TComponents."
|
||||||
|
|
||||||
#: lazarusidestrconsts.liscantfindavalidppu
|
#: lazarusidestrconsts.liscantfindavalidppu
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -5730,7 +5726,7 @@ msgstr "CHYBA: "
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
||||||
msgid "FPC unit path contains a source: "
|
msgid "FPC unit path contains a source: "
|
||||||
msgstr "Cesta k jednotkám FPC so zdrojovým kódom"
|
msgstr "Cesta k jednotkám FPC obsahuje zdrojový kód: "
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisccohasnewline
|
#: lazarusidestrconsts.lisccohasnewline
|
||||||
msgid "new line symbols"
|
msgid "new line symbols"
|
||||||
@ -5763,7 +5759,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisccomultiplecfgfound
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
||||||
msgid "multiple compiler configs found: "
|
msgid "multiple compiler configs found: "
|
||||||
msgstr "nájdené viaceré konfigurácie prekladača:"
|
msgstr "nájdené viaceré konfigurácie prekladača: "
|
||||||
|
|
||||||
#: lazarusidestrconsts.liscconocfgfound
|
#: lazarusidestrconsts.liscconocfgfound
|
||||||
msgid "no fpc.cfg found"
|
msgid "no fpc.cfg found"
|
||||||
@ -5807,7 +5803,7 @@ msgstr "Všetky testy úspešné."
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
||||||
msgid "Unable to create Test File"
|
msgid "Unable to create Test File"
|
||||||
msgstr "textového vytvoriť testovací súbor"
|
msgstr "Nie je možné vytvoriť testovací súbor"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
||||||
#, object-pascal-format, fuzzy
|
#, object-pascal-format, fuzzy
|
||||||
@ -6324,15 +6320,15 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lischoosedelphipackage
|
#: lazarusidestrconsts.lischoosedelphipackage
|
||||||
msgid "Choose Delphi package (*.dpk)"
|
msgid "Choose Delphi package (*.dpk)"
|
||||||
msgstr ""
|
msgstr "Vyberte Delphi balíček (*.dpk)"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lischoosedelphiproject
|
#: lazarusidestrconsts.lischoosedelphiproject
|
||||||
msgid "Choose Delphi project (*.dpr)"
|
msgid "Choose Delphi project (*.dpr)"
|
||||||
msgstr ""
|
msgstr "Vyberte Delphi projekt (*.dpr)"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lischoosedelphiunit
|
#: lazarusidestrconsts.lischoosedelphiunit
|
||||||
msgid "Choose Delphi unit (*.pas)"
|
msgid "Choose Delphi unit (*.pas)"
|
||||||
msgstr "Zvoliť jednotku Delphi (*.pas)"
|
msgstr "Zvoliť Delphi jednotku (*.pas)"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lischoosedirectory
|
#: lazarusidestrconsts.lischoosedirectory
|
||||||
msgid "Choose directory"
|
msgid "Choose directory"
|
||||||
@ -6474,11 +6470,11 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.liscleanupandbuild
|
#: lazarusidestrconsts.liscleanupandbuild
|
||||||
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
||||||
msgid "Clean up and build"
|
msgid "Clean up and build"
|
||||||
msgstr ""
|
msgstr "Vyčistiť a vybudovať"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liscleanupandbuildproject
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
||||||
msgid "Clean up and build project"
|
msgid "Clean up and build project"
|
||||||
msgstr ""
|
msgstr "Vyčistiť a vybudovať projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liscleanuppackage
|
#: lazarusidestrconsts.liscleanuppackage
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -7637,15 +7633,15 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
||||||
msgid "Convert Delphi package"
|
msgid "Convert Delphi package"
|
||||||
msgstr ""
|
msgstr "Konvertovať Delphi balíček"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
||||||
msgid "Convert Delphi project"
|
msgid "Convert Delphi project"
|
||||||
msgstr ""
|
msgstr "Konvertovať Delphi projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
||||||
msgid "Convert Delphi unit"
|
msgid "Convert Delphi unit"
|
||||||
msgstr ""
|
msgstr "Konvertovať Delphi jednotku"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
||||||
msgid "*** Converting unit files found during conversion ***"
|
msgid "*** Converting unit files found during conversion ***"
|
||||||
@ -7684,7 +7680,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphifunc
|
#: lazarusidestrconsts.lisconvdelphifunc
|
||||||
msgid "Delphi Function"
|
msgid "Delphi Function"
|
||||||
msgstr ""
|
msgstr "Delphi funkcia"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -7693,7 +7689,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphiname
|
#: lazarusidestrconsts.lisconvdelphiname
|
||||||
msgid "Delphi Name"
|
msgid "Delphi Name"
|
||||||
msgstr ""
|
msgstr "Delphi meno"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
||||||
msgid "Package name exists"
|
msgid "Package name exists"
|
||||||
@ -8271,7 +8267,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.liscreateproject
|
#: lazarusidestrconsts.liscreateproject
|
||||||
msgid "Create project"
|
msgid "Create project"
|
||||||
msgstr ""
|
msgstr "Vytvoriť projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
||||||
msgid "Create/update .po file when saving a lfm file"
|
msgid "Create/update .po file when saving a lfm file"
|
||||||
@ -8465,7 +8461,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisdbgemnewvalue
|
#: lazarusidestrconsts.lisdbgemnewvalue
|
||||||
msgid "&New value:"
|
msgid "&New value:"
|
||||||
msgstr ""
|
msgstr "&Nová hodnota:"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisdbgemresult
|
#: lazarusidestrconsts.lisdbgemresult
|
||||||
msgid "&Result:"
|
msgid "&Result:"
|
||||||
@ -8965,7 +8961,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisdesktops
|
#: lazarusidestrconsts.lisdesktops
|
||||||
msgid "Desktops ..."
|
msgid "Desktops ..."
|
||||||
msgstr ""
|
msgstr "Pracovné plochy ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisdestinationdirectory
|
#: lazarusidestrconsts.lisdestinationdirectory
|
||||||
msgid "Destination directory"
|
msgid "Destination directory"
|
||||||
@ -9937,7 +9933,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisevaluatemodify
|
#: lazarusidestrconsts.lisevaluatemodify
|
||||||
msgid "&Evaluate/Modify"
|
msgid "&Evaluate/Modify"
|
||||||
msgstr ""
|
msgstr "Vyhodnotiť/Upraviť"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liseventlogclear
|
#: lazarusidestrconsts.liseventlogclear
|
||||||
msgid "Clear Events"
|
msgid "Clear Events"
|
||||||
@ -11825,7 +11821,7 @@ msgstr "Pridať pozorovanie"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.liskmbuildmanymodes
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
||||||
msgid "Build many modes"
|
msgid "Build many modes"
|
||||||
msgstr ""
|
msgstr "Vybudovať viacej režimov"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmbuildprojectprogram
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
||||||
msgid "Build project/program"
|
msgid "Build project/program"
|
||||||
@ -11842,7 +11838,7 @@ msgstr "Klasický"
|
|||||||
#: lazarusidestrconsts.liskmcleanupandbuild
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
||||||
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
||||||
msgid "Clean up and build"
|
msgid "Clean up and build"
|
||||||
msgstr ""
|
msgstr "Vyčistiť a vybudovať"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmcloseproject
|
#: lazarusidestrconsts.liskmcloseproject
|
||||||
msgid "Close project"
|
msgid "Close project"
|
||||||
@ -11874,23 +11870,17 @@ msgstr "Kontextovo závislá pomoc"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
||||||
msgid "Convert Delphi package to Lazarus package"
|
msgid "Convert Delphi package to Lazarus package"
|
||||||
msgstr "Konvertovať balíček Delhi na Lazarus"
|
msgstr "Konvertovať Delphi balíček na Lazarus balíček"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Convert Delphi project to Lazarus project"
|
|
||||||
msgid "Convert Delphi Project to Lazarus Project"
|
msgid "Convert Delphi Project to Lazarus Project"
|
||||||
msgstr "Konvertovať projekt Delphi na Lazarus"
|
msgstr "Konvertovať Delphi projekt na Lazarus projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Convert Delphi unit to Lazarus unit"
|
|
||||||
msgid "Convert Delphi Unit to Lazarus Unit"
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
||||||
msgstr "Konvertovať jednotku Delphi na Lazarus"
|
msgstr "Konvertovať Delphi jednotku na Lazarus jednotku"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Convert DFM file to LFM"
|
|
||||||
msgid "Convert DFM File to LFM"
|
msgid "Convert DFM File to LFM"
|
||||||
msgstr "Konvertovať súbor DFM na LFM"
|
msgstr "Konvertovať súbor DFM na LFM"
|
||||||
|
|
||||||
@ -11934,11 +11924,11 @@ msgstr "Uzavrieť výber"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.liskmevaluatemodify
|
#: lazarusidestrconsts.liskmevaluatemodify
|
||||||
msgid "Evaluate/Modify"
|
msgid "Evaluate/Modify"
|
||||||
msgstr "Vyskúšať/Upraviť"
|
msgstr "Vyhodnotiť/Upraviť"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmexampleprojects
|
#: lazarusidestrconsts.liskmexampleprojects
|
||||||
msgid "Example Projects"
|
msgid "Example Projects"
|
||||||
msgstr ""
|
msgstr "Vzorové projekty"
|
||||||
|
|
||||||
#: lazarusidestrconsts.liskmexternaltoolssettings
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
||||||
msgid "External Tools settings"
|
msgid "External Tools settings"
|
||||||
@ -12462,7 +12452,7 @@ msgstr "Akcia"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
||||||
msgid "Choose output directory of the IDE executable "
|
msgid "Choose output directory of the IDE executable "
|
||||||
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE"
|
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE "
|
||||||
|
|
||||||
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
||||||
msgid "Are you sure you want to delete this build profile?"
|
msgid "Are you sure you want to delete this build profile?"
|
||||||
@ -12659,7 +12649,7 @@ msgstr "Jednotku %s nevlastní žiadny balíček alebo projekt.%sProsím pridajt
|
|||||||
#: lazarusidestrconsts.lisleft
|
#: lazarusidestrconsts.lisleft
|
||||||
msgctxt "lazarusidestrconsts.lisleft"
|
msgctxt "lazarusidestrconsts.lisleft"
|
||||||
msgid "Left"
|
msgid "Left"
|
||||||
msgstr "šípka vľavo"
|
msgstr "Vľavo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
||||||
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
||||||
@ -13032,19 +13022,15 @@ msgstr "Pridať &bod prerušenia"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
||||||
msgid "Add Active File to Package ..."
|
msgid "Add Active File to Package ..."
|
||||||
msgstr ""
|
msgstr "Pridať aktívny súbor do balíčka ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Add jump point to history"
|
|
||||||
msgid "Add Jump Point to History"
|
msgid "Add Jump Point to History"
|
||||||
msgstr "Pridať bod skoku do histórie"
|
msgstr "Pridať bod skoku do histórie"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuaddtoproject
|
#: lazarusidestrconsts.lismenuaddtoproject
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Add editor file to Project"
|
|
||||||
msgid "Add Editor File to Project"
|
msgid "Add Editor File to Project"
|
||||||
msgstr "Pridať z editora do projektu"
|
msgstr "Pridať editovaný súbor do projektu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuaddwatch
|
#: lazarusidestrconsts.lismenuaddwatch
|
||||||
msgid "Add &Watch ..."
|
msgid "Add &Watch ..."
|
||||||
@ -13106,8 +13092,6 @@ msgid "CodeTools Defines Editor ..."
|
|||||||
msgstr "Editor definícií CodeTools ..."
|
msgstr "Editor definícií CodeTools ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenucommentselection
|
#: lazarusidestrconsts.lismenucommentselection
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Comment selection"
|
|
||||||
msgid "Comment Selection"
|
msgid "Comment Selection"
|
||||||
msgstr "Zakomentovať výber"
|
msgstr "Zakomentovať výber"
|
||||||
|
|
||||||
@ -13156,15 +13140,15 @@ msgstr "Pokračovať"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
||||||
msgid "Convert Delphi Package to Lazarus Package ..."
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
||||||
msgstr "Konvertovať balíček Delphi na Lazarus ..."
|
msgstr "Konvertovať Delphi balíček na Lazarus balíček ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
||||||
msgid "Convert Delphi Project to Lazarus Project ..."
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
||||||
msgstr "Konvertovať projekt Delphi na Lazarus ..."
|
msgstr "Konvertovať Delphi projekt na Lazarus projekt ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
||||||
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
||||||
msgstr "Konvertovať jednotku Deplhi na Lazarus ..."
|
msgstr "Konvertovať Delphi jednotku na Lazarus jednotku ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
||||||
#, fuzzy
|
#, fuzzy
|
||||||
@ -13182,7 +13166,7 @@ msgstr "Okná ladenia"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismenudelphiconversion
|
#: lazarusidestrconsts.lismenudelphiconversion
|
||||||
msgid "Delphi Conversion"
|
msgid "Delphi Conversion"
|
||||||
msgstr ""
|
msgstr "Delphi konverzia"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuedit
|
#: lazarusidestrconsts.lismenuedit
|
||||||
msgid "&Edit"
|
msgid "&Edit"
|
||||||
@ -13785,14 +13769,12 @@ msgid "Enclose Selection ..."
|
|||||||
msgstr "Uzavrieť výber ..."
|
msgstr "Uzavrieť výber ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuevaluate
|
#: lazarusidestrconsts.lismenuevaluate
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Evaluate/Modify ..."
|
|
||||||
msgid "E&valuate/Modify ..."
|
msgid "E&valuate/Modify ..."
|
||||||
msgstr "Vyskúšať/Upraviť ..."
|
msgstr "Vyhodnotiť/Upraviť ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuexampleprojects
|
#: lazarusidestrconsts.lismenuexampleprojects
|
||||||
msgid "Example Projects ..."
|
msgid "Example Projects ..."
|
||||||
msgstr ""
|
msgstr "Vzorové projekty ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuextractproc
|
#: lazarusidestrconsts.lismenuextractproc
|
||||||
#, fuzzy
|
#, fuzzy
|
||||||
@ -13814,14 +13796,10 @@ msgid "&Find ..."
|
|||||||
msgstr "&Nájsť ..."
|
msgstr "&Nájsť ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Find other end of code block"
|
|
||||||
msgid "Find Other End of Code Block"
|
msgid "Find Other End of Code Block"
|
||||||
msgstr "Nájsť druhý koniec bloku kódu"
|
msgstr "Nájsť zodpovedajúci koniec bloku kódu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenufindcodeblockstart
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Find code block start"
|
|
||||||
msgid "Find Start of Code Block"
|
msgid "Find Start of Code Block"
|
||||||
msgstr "Nájsť začiatok bloku kódu"
|
msgstr "Nájsť začiatok bloku kódu"
|
||||||
|
|
||||||
@ -13872,10 +13850,8 @@ msgid "Guess Misplaced IFDEF/ENDIF"
|
|||||||
msgstr "Odhadni zle umiestnený IFDEF/ENDIF"
|
msgstr "Odhadni zle umiestnený IFDEF/ENDIF"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuguessunclosedblock
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Guess unclosed block"
|
|
||||||
msgid "Guess Unclosed Block"
|
msgid "Guess Unclosed Block"
|
||||||
msgstr "Odhadni neuzavretý blok"
|
msgstr "Odhadnúť neuzavretý blok"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuhelp
|
#: lazarusidestrconsts.lismenuhelp
|
||||||
msgid "&Help"
|
msgid "&Help"
|
||||||
@ -14107,14 +14083,10 @@ msgid "Open Loaded Package ..."
|
|||||||
msgstr "Otvoriť načítaný balíček ..."
|
msgstr "Otvoriť načítaný balíček ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuopenpackagefile
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Open package file (.lpk) ..."
|
|
||||||
msgid "Open Package File (.lpk) ..."
|
msgid "Open Package File (.lpk) ..."
|
||||||
msgstr "Otvoriť súbor balíčka (.lpk) ..."
|
msgstr "Otvoriť súbor balíčka (.lpk) ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Open package of current unit"
|
|
||||||
msgid "Open Package of Current Unit"
|
msgid "Open Package of Current Unit"
|
||||||
msgstr "Otvoriť balíček aktuálnej jednotky"
|
msgstr "Otvoriť balíček aktuálnej jednotky"
|
||||||
|
|
||||||
@ -14148,10 +14120,8 @@ msgid "Package Graph"
|
|||||||
msgstr "Graf balíčkov"
|
msgstr "Graf balíčkov"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenupackagelinks
|
#: lazarusidestrconsts.lismenupackagelinks
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Package links ..."
|
|
||||||
msgid "Package Links ..."
|
msgid "Package Links ..."
|
||||||
msgstr "Odkazy balíčkov ..."
|
msgstr "Odkazy balíčka ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenupastefromclipboard
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
||||||
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
||||||
@ -14215,7 +14185,7 @@ msgstr "Hlásenie chyby"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
||||||
msgid "Resave forms with enabled i18n"
|
msgid "Resave forms with enabled i18n"
|
||||||
msgstr ""
|
msgstr "Znovu uložiť formuláre s povoleným i18n"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
||||||
msgid "Rescan FPC Source Directory"
|
msgid "Rescan FPC Source Directory"
|
||||||
@ -14243,8 +14213,6 @@ msgid "Run &Parameters ..."
|
|||||||
msgstr "&Parametre spustenia ..."
|
msgstr "&Parametre spustenia ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuruntocursor
|
#: lazarusidestrconsts.lismenuruntocursor
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Run to &Cursor"
|
|
||||||
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
msgctxt "lazarusidestrconsts.lismenuruntocursor"
|
||||||
msgid "Run to Cursor"
|
msgid "Run to Cursor"
|
||||||
msgstr "Spustiť po kurzor"
|
msgstr "Spustiť po kurzor"
|
||||||
@ -14405,17 +14373,15 @@ msgstr "Výber na veľké písmená"
|
|||||||
#: lazarusidestrconsts.lismenuuseunit
|
#: lazarusidestrconsts.lismenuuseunit
|
||||||
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
msgctxt "lazarusidestrconsts.lismenuuseunit"
|
||||||
msgid "Add Unit to Uses Section ..."
|
msgid "Add Unit to Uses Section ..."
|
||||||
msgstr ""
|
msgstr "Pridať jednotku do sekcie Uses ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuview
|
#: lazarusidestrconsts.lismenuview
|
||||||
msgid "&View"
|
msgid "&View"
|
||||||
msgstr "&Zobraziť"
|
msgstr "&Zobraziť"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewanchoreditor
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
||||||
#, fuzzy
|
|
||||||
#| msgid "View Anchor Editor"
|
|
||||||
msgid "Anchor Editor"
|
msgid "Anchor Editor"
|
||||||
msgstr "Zobraziť Editor ukotvenia"
|
msgstr "Editor ukotvenia"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewassembler
|
#: lazarusidestrconsts.lismenuviewassembler
|
||||||
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
||||||
@ -14431,7 +14397,6 @@ msgid "Call Stack"
|
|||||||
msgstr "Zásobník volaní"
|
msgstr "Zásobník volaní"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewcodebrowser
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
||||||
#, fuzzy
|
|
||||||
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
||||||
msgid "Code Browser"
|
msgid "Code Browser"
|
||||||
msgstr "Prehliadač kódu"
|
msgstr "Prehliadač kódu"
|
||||||
@ -14442,10 +14407,8 @@ msgid "Code Explorer"
|
|||||||
msgstr "Prieskumník kódu"
|
msgstr "Prieskumník kódu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
||||||
#, fuzzy
|
|
||||||
#| msgid "View Component Palette"
|
|
||||||
msgid "Component Palette"
|
msgid "Component Palette"
|
||||||
msgstr "Zobraziť Paletu komponentov"
|
msgstr "Paleta komponentov"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewcomponents
|
#: lazarusidestrconsts.lismenuviewcomponents
|
||||||
msgid "&Components"
|
msgid "&Components"
|
||||||
@ -14530,11 +14493,9 @@ msgid "Toggle Form/Unit View"
|
|||||||
msgstr "Prepnúť formulár/jednotka"
|
msgstr "Prepnúť formulár/jednotka"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewunitdependencies
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Unit Dependencies ..."
|
|
||||||
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
||||||
msgid "Unit Dependencies"
|
msgid "Unit Dependencies"
|
||||||
msgstr "Zobraziť závislosti jednotky"
|
msgstr "Závislosti jednotky"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismenuviewunitinfo
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
||||||
msgid "Unit Information ..."
|
msgid "Unit Information ..."
|
||||||
@ -14566,7 +14527,7 @@ msgstr "Ostatné"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismeprojects
|
#: lazarusidestrconsts.lismeprojects
|
||||||
msgid "Projects"
|
msgid "Projects"
|
||||||
msgstr ""
|
msgstr "Projekty"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismessageseditor
|
#: lazarusidestrconsts.lismessageseditor
|
||||||
msgid "Messages Editor"
|
msgid "Messages Editor"
|
||||||
@ -14612,7 +14573,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lismissingunitsfordelphi
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
||||||
msgid "For Delphi only"
|
msgid "For Delphi only"
|
||||||
msgstr ""
|
msgstr "Len pre Delphi"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lismissingunitsinfo1
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
||||||
msgid "1) Comment out the selected units."
|
msgid "1) Comment out the selected units."
|
||||||
@ -15234,12 +15195,12 @@ msgstr "Dole"
|
|||||||
#: lazarusidestrconsts.lisnotebooktabposleft
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
||||||
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
||||||
msgid "Left"
|
msgid "Left"
|
||||||
msgstr "šípka vľavo"
|
msgstr "Vľavo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisnotebooktabposright
|
#: lazarusidestrconsts.lisnotebooktabposright
|
||||||
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
||||||
msgid "Right"
|
msgid "Right"
|
||||||
msgstr "šípka vpravo"
|
msgstr "Vpravo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisnotebooktabpostop
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
||||||
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
||||||
@ -15508,7 +15469,7 @@ msgstr "Otvoriť súbor"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lisopenfileatcursor
|
#: lazarusidestrconsts.lisopenfileatcursor
|
||||||
msgid "Open file at cursor"
|
msgid "Open file at cursor"
|
||||||
msgstr ""
|
msgstr "Otvoriť súbor na pozícii kurzora"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisopeninfileman
|
#: lazarusidestrconsts.lisopeninfileman
|
||||||
msgid "Open in file manager"
|
msgid "Open in file manager"
|
||||||
@ -16067,10 +16028,9 @@ msgid "Remove Dependency?"
|
|||||||
msgstr "Odstrániť závislosť?"
|
msgstr "Odstrániť závislosť?"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
#| msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
|
|
||||||
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
||||||
msgstr "Odstrániť závislosť %s%s%s%sz balíčka %s%s%s?"
|
msgstr "Odstrániť závislosť \"%s\"%sz balíčka \"%s\"?"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispckeditremovedfiles
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
||||||
msgid "Removed Files"
|
msgid "Removed Files"
|
||||||
@ -16527,16 +16487,14 @@ msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Nam
|
|||||||
msgstr ""
|
msgstr ""
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
#| msgid "%sAdding new Dependency for package %s: package %s%s"
|
|
||||||
msgid "%sAdding new Dependency for package %s: package %s"
|
msgid "%sAdding new Dependency for package %s: package %s"
|
||||||
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s%s"
|
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
#| msgid "%sAdding new Dependency for project %s: package %s%s"
|
|
||||||
msgid "%sAdding new Dependency for project %s: package %s"
|
msgid "%sAdding new Dependency for project %s: package %s"
|
||||||
msgstr "%sPridanie novej závislosti projektu %s: balíček %s%s"
|
msgstr "%sPridanie novej závislosti projektu %s: balíček %s"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
#: lazarusidestrconsts.lispkgmangaddunittousesclause
|
||||||
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
|
||||||
@ -17220,7 +17178,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
||||||
msgid "Please select some code to extract a new procedure/method."
|
msgid "Please select some code to extract a new procedure/method."
|
||||||
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy"
|
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisplistall
|
#: lazarusidestrconsts.lisplistall
|
||||||
msgctxt "lazarusidestrconsts.lisplistall"
|
msgctxt "lazarusidestrconsts.lisplistall"
|
||||||
@ -17388,10 +17346,8 @@ msgid "Dependency already exists"
|
|||||||
msgstr "Závislosť už existuje"
|
msgstr "Závislosť už existuje"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddeditorfile
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Add editor files"
|
|
||||||
msgid "Add Editor Files"
|
msgid "Add Editor Files"
|
||||||
msgstr "Pridať súbory editora"
|
msgstr "Pridať editované súbory"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
||||||
msgid "Invalid Min-Max version"
|
msgid "Invalid Min-Max version"
|
||||||
@ -17440,10 +17396,9 @@ msgid "Package Type:"
|
|||||||
msgstr ""
|
msgstr ""
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
#| msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
|
|
||||||
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
||||||
msgstr "Závislosť %s%s%s nebola nájdená.%sProsím zvoľte existujúci balíček."
|
msgstr "Závislosť \"%s\" nebola nájdená.%sProsím zvoľte existujúci balíček."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format, fuzzy, badformat
|
||||||
@ -17465,10 +17420,9 @@ msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor
|
|||||||
msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"
|
msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
#| msgid "The project has already a dependency for the package %s%s%s."
|
|
||||||
msgid "The project has already a dependency for the package \"%s\"."
|
msgid "The project has already a dependency for the package \"%s\"."
|
||||||
msgstr "Projekt už má závislosť na balíčku %s%s%s."
|
msgstr "Projekt už má závislosť pre balíček \"%s\"."
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format, fuzzy, badformat
|
||||||
@ -17783,10 +17737,8 @@ msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|||||||
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"
|
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispwconvertproject
|
#: lazarusidestrconsts.lispwconvertproject
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Convert Delphi Project"
|
|
||||||
msgid "Convert &Delphi Project"
|
msgid "Convert &Delphi Project"
|
||||||
msgstr "Konvertovať projekt Delphi"
|
msgstr "Konvertovať &Delphi projekt"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lispwnewproject
|
#: lazarusidestrconsts.lispwnewproject
|
||||||
msgid "&New Project"
|
msgid "&New Project"
|
||||||
@ -17803,7 +17755,7 @@ msgstr "Otvo&riť nedávny projekt"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.lispwviewexampleprojects
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
||||||
msgid "View &Example Projects"
|
msgid "View &Example Projects"
|
||||||
msgstr ""
|
msgstr "Zobraziť vzorové projekty"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisquickfixerror
|
#: lazarusidestrconsts.lisquickfixerror
|
||||||
msgid "QuickFix error"
|
msgid "QuickFix error"
|
||||||
@ -17848,7 +17800,6 @@ msgid "Recent tabs"
|
|||||||
msgstr ""
|
msgstr ""
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisrecord
|
#: lazarusidestrconsts.lisrecord
|
||||||
#, fuzzy
|
|
||||||
msgctxt "lazarusidestrconsts.lisrecord"
|
msgctxt "lazarusidestrconsts.lisrecord"
|
||||||
msgid "Record"
|
msgid "Record"
|
||||||
msgstr "Záznam"
|
msgstr "Záznam"
|
||||||
@ -18136,7 +18087,7 @@ msgstr ""
|
|||||||
#: lazarusidestrconsts.lisright
|
#: lazarusidestrconsts.lisright
|
||||||
msgctxt "lazarusidestrconsts.lisright"
|
msgctxt "lazarusidestrconsts.lisright"
|
||||||
msgid "Right"
|
msgid "Right"
|
||||||
msgstr "šípka vpravo"
|
msgstr "Vpravo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisrightanchoring
|
#: lazarusidestrconsts.lisrightanchoring
|
||||||
msgid "Right anchoring"
|
msgid "Right anchoring"
|
||||||
@ -20928,7 +20879,7 @@ msgstr "Domovský adresár používateľa"
|
|||||||
#: lazarusidestrconsts.lisuseunit
|
#: lazarusidestrconsts.lisuseunit
|
||||||
msgctxt "lazarusidestrconsts.lisuseunit"
|
msgctxt "lazarusidestrconsts.lisuseunit"
|
||||||
msgid "Add Unit to Uses Section"
|
msgid "Add Unit to Uses Section"
|
||||||
msgstr ""
|
msgstr "Pridať jednotku do sekcie Uses"
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisuseunitinunit
|
#: lazarusidestrconsts.lisuseunitinunit
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -21245,8 +21196,6 @@ msgid "You can download FPC and the FPC sources from http://sourceforge.net/proj
|
|||||||
msgstr ""
|
msgstr ""
|
||||||
|
|
||||||
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
||||||
#, fuzzy
|
|
||||||
#| msgid "You can not build lazarus while debugging or compiling."
|
|
||||||
msgid "You cannot build Lazarus while debugging or compiling."
|
msgid "You cannot build Lazarus while debugging or compiling."
|
||||||
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."
|
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."
|
||||||
|
|
||||||
@ -21455,7 +21404,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.rsattachto
|
#: lazarusidestrconsts.rsattachto
|
||||||
msgid "Attach to"
|
msgid "Attach to"
|
||||||
msgstr ""
|
msgstr "Pripojiť k"
|
||||||
|
|
||||||
#: lazarusidestrconsts.rsattributes
|
#: lazarusidestrconsts.rsattributes
|
||||||
msgid "Attributes"
|
msgid "Attributes"
|
||||||
@ -21856,7 +21805,7 @@ msgstr "pridať pozorovanie"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmecattach
|
#: lazarusidestrconsts.srkmecattach
|
||||||
msgid "Attach to program"
|
msgid "Attach to program"
|
||||||
msgstr ""
|
msgstr "Pripojiť k programu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecautocompletion
|
#: lazarusidestrconsts.srkmecautocompletion
|
||||||
msgid "Code template completion"
|
msgid "Code template completion"
|
||||||
@ -21924,7 +21873,7 @@ msgstr "Vybudovať Lazarus"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmecbuildmanymodes
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
||||||
msgid "build many modes"
|
msgid "build many modes"
|
||||||
msgstr ""
|
msgstr "vybudovať viacej režimov"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecchar
|
#: lazarusidestrconsts.srkmecchar
|
||||||
msgid "Char"
|
msgid "Char"
|
||||||
@ -21932,7 +21881,7 @@ msgstr "Znak"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmeccleanupandbuild
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
||||||
msgid "clean up and build"
|
msgid "clean up and build"
|
||||||
msgstr ""
|
msgstr "vyčistiť a vybudovať"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecclearall
|
#: lazarusidestrconsts.srkmecclearall
|
||||||
msgid "Delete whole text"
|
msgid "Delete whole text"
|
||||||
@ -22098,7 +22047,7 @@ msgstr "Zmazať do konca slova"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmecdetach
|
#: lazarusidestrconsts.srkmecdetach
|
||||||
msgid "Detach from program"
|
msgid "Detach from program"
|
||||||
msgstr ""
|
msgstr "Odpojiť od programu"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecdiff
|
#: lazarusidestrconsts.srkmecdiff
|
||||||
msgctxt "lazarusidestrconsts.srkmecdiff"
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
||||||
@ -22135,7 +22084,7 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmecevaluate
|
#: lazarusidestrconsts.srkmecevaluate
|
||||||
msgid "evaluate/modify"
|
msgid "evaluate/modify"
|
||||||
msgstr "vyskúšať/zmeniť"
|
msgstr "vyhodnotiť/zmeniť"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecextractproc
|
#: lazarusidestrconsts.srkmecextractproc
|
||||||
#, fuzzy
|
#, fuzzy
|
||||||
@ -22732,7 +22681,7 @@ msgstr "Vybrať stranu vľavo"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.srkmecselpageright
|
#: lazarusidestrconsts.srkmecselpageright
|
||||||
msgid "Select Page Right"
|
msgid "Select Page Right"
|
||||||
msgstr "vybrať stranu vpravo"
|
msgstr "Vybrať stranu vpravo"
|
||||||
|
|
||||||
#: lazarusidestrconsts.srkmecselpagetop
|
#: lazarusidestrconsts.srkmecselpagetop
|
||||||
#, fuzzy
|
#, fuzzy
|
||||||
@ -23214,11 +23163,11 @@ msgstr ""
|
|||||||
|
|
||||||
#: lazarusidestrconsts.synfhidecomments
|
#: lazarusidestrconsts.synfhidecomments
|
||||||
msgid "Hide comments"
|
msgid "Hide comments"
|
||||||
msgstr ""
|
msgstr "Skryť komentáre"
|
||||||
|
|
||||||
#: lazarusidestrconsts.synfhidecommentsinselection
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
||||||
msgid "Hide comments in selection"
|
msgid "Hide comments in selection"
|
||||||
msgstr ""
|
msgstr "Skryť komentáre vo výbere"
|
||||||
|
|
||||||
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
||||||
msgid "Match action button of mouse down"
|
msgid "Match action button of mouse down"
|
||||||
@ -23376,7 +23325,7 @@ msgstr "Kódovanie"
|
|||||||
|
|
||||||
#: lazarusidestrconsts.uemevaluatemodify
|
#: lazarusidestrconsts.uemevaluatemodify
|
||||||
msgid "&Evaluate/Modify ..."
|
msgid "&Evaluate/Modify ..."
|
||||||
msgstr ""
|
msgstr "Vyhodnotiť/Upraviť ..."
|
||||||
|
|
||||||
#: lazarusidestrconsts.uemfinddeclaration
|
#: lazarusidestrconsts.uemfinddeclaration
|
||||||
msgid "&Find Declaration"
|
msgid "&Find Declaration"
|
||||||
|
|||||||
@ -3,7 +3,7 @@ msgstr ""
|
|||||||
"Project-Id-Version: lclstrconsts\n"
|
"Project-Id-Version: lclstrconsts\n"
|
||||||
"Report-Msgid-Bugs-To: \n"
|
"Report-Msgid-Bugs-To: \n"
|
||||||
"POT-Creation-Date: 2008-02-02 16:22+0100\n"
|
"POT-Creation-Date: 2008-02-02 16:22+0100\n"
|
||||||
"PO-Revision-Date: 2019-09-30 11:52+0200\n"
|
"PO-Revision-Date: 2022-01-07 16:00+0100\n"
|
||||||
"Last-Translator: Slavo Gbúr <slavusec@azet.sk>\n"
|
"Last-Translator: Slavo Gbúr <slavusec@azet.sk>\n"
|
||||||
"Language-Team: Slovenský <sk@li.org>\n"
|
"Language-Team: Slovenský <sk@li.org>\n"
|
||||||
"Language: sk\n"
|
"Language: sk\n"
|
||||||
@ -11,7 +11,7 @@ msgstr ""
|
|||||||
"Content-Type: text/plain; charset=UTF-8\n"
|
"Content-Type: text/plain; charset=UTF-8\n"
|
||||||
"Content-Transfer-Encoding: 8bit\n"
|
"Content-Transfer-Encoding: 8bit\n"
|
||||||
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
|
||||||
"X-Generator: Poedit 2.2.3\n"
|
"X-Generator: Poedit 3.0\n"
|
||||||
|
|
||||||
#: lclstrconsts.hhshelpbrowsernotexecutable
|
#: lclstrconsts.hhshelpbrowsernotexecutable
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -33,9 +33,9 @@ msgid "Unable to find a HTML browser."
|
|||||||
msgstr "Nie je možné nájsť prehliadač HTML."
|
msgstr "Nie je možné nájsť prehliadač HTML."
|
||||||
|
|
||||||
#: lclstrconsts.hhshelpnohtmlbrowserfoundpleasedefineone
|
#: lclstrconsts.hhshelpnohtmlbrowserfoundpleasedefineone
|
||||||
#, object-pascal-format, fuzzy, badformat
|
#, object-pascal-format
|
||||||
msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help -> Help Options"
|
msgid "No HTML Browser found.%sPlease define one in Tools -> Options -> Help -> Help Options"
|
||||||
msgstr "HTML prehliadač nebol nájdený.%Prosím zadajte jeden v Nástroje -> Možnosti -> Pomoc -> Možnosti pomoci"
|
msgstr "HTML prehliadač nebol nájdený.%sProsím zadajte jeden v Nástroje -> Možnosti -> Pomoc -> Možnosti pomoci"
|
||||||
|
|
||||||
#: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile
|
#: lclstrconsts.hhshelpthehelpdatabasewasunabletofindfile
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -122,7 +122,7 @@ msgstr "Vodná"
|
|||||||
#: lclstrconsts.rsascannothaveasparent
|
#: lclstrconsts.rsascannothaveasparent
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Class %s cannot have %s as parent."
|
msgid "Class %s cannot have %s as parent."
|
||||||
msgstr ""
|
msgstr "Trieda %s nemôže mať %s ako rodiča."
|
||||||
|
|
||||||
#: lclstrconsts.rsbackgroundcolorcaption
|
#: lclstrconsts.rsbackgroundcolorcaption
|
||||||
msgid "Desktop"
|
msgid "Desktop"
|
||||||
@ -197,7 +197,7 @@ msgstr "Prvok triedy '%s' nemôže mať prvok triedy '%s' ako dieťa"
|
|||||||
#: lclstrconsts.rscontrolhasnoparentformorframe
|
#: lclstrconsts.rscontrolhasnoparentformorframe
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Control '%s' has no parent form or frame"
|
msgid "Control '%s' has no parent form or frame"
|
||||||
msgstr ""
|
msgstr "Ovládací prvok '%s' nemá nadradený formulár ani rámec"
|
||||||
|
|
||||||
#: lclstrconsts.rscontrolisnotaparent
|
#: lclstrconsts.rscontrolisnotaparent
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
@ -369,11 +369,11 @@ msgstr "Prvý"
|
|||||||
|
|
||||||
#: lclstrconsts.rsfixedcolstoobig
|
#: lclstrconsts.rsfixedcolstoobig
|
||||||
msgid "FixedCols can't be > ColCount"
|
msgid "FixedCols can't be > ColCount"
|
||||||
msgstr "FixedCols nemôže byť >= ColCount"
|
msgstr "FixedCols nemôže byť > ColCount"
|
||||||
|
|
||||||
#: lclstrconsts.rsfixedrowstoobig
|
#: lclstrconsts.rsfixedrowstoobig
|
||||||
msgid "FixedRows can't be > RowCount"
|
msgid "FixedRows can't be > RowCount"
|
||||||
msgstr "FixedRows nemôže byť >= RowCount"
|
msgstr "FixedRows nemôže byť > RowCount"
|
||||||
|
|
||||||
#: lclstrconsts.rsformcolorcaption
|
#: lclstrconsts.rsformcolorcaption
|
||||||
msgid "Form"
|
msgid "Form"
|
||||||
@ -616,10 +616,8 @@ msgid "Hot Light"
|
|||||||
msgstr "Hot Light"
|
msgstr "Hot Light"
|
||||||
|
|
||||||
#: lclstrconsts.rsicns
|
#: lclstrconsts.rsicns
|
||||||
#, fuzzy
|
|
||||||
#| msgid "Mac OS X Icon"
|
|
||||||
msgid "macOS Icon"
|
msgid "macOS Icon"
|
||||||
msgstr "Mac OS X Iikony"
|
msgstr "macOS Ikona"
|
||||||
|
|
||||||
#: lclstrconsts.rsicon
|
#: lclstrconsts.rsicon
|
||||||
msgid "Icon"
|
msgid "Icon"
|
||||||
@ -732,29 +730,29 @@ msgstr "Index zoznamu prekračuje hranice (%d)"
|
|||||||
|
|
||||||
#: lclstrconsts.rsmacosfileformat
|
#: lclstrconsts.rsmacosfileformat
|
||||||
msgid "File Format:"
|
msgid "File Format:"
|
||||||
msgstr ""
|
msgstr "Formát súboru:"
|
||||||
|
|
||||||
#: lclstrconsts.rsmacosmenuhide
|
#: lclstrconsts.rsmacosmenuhide
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Hide %s"
|
msgid "Hide %s"
|
||||||
msgstr ""
|
msgstr "Skryť %s"
|
||||||
|
|
||||||
#: lclstrconsts.rsmacosmenuhideothers
|
#: lclstrconsts.rsmacosmenuhideothers
|
||||||
msgid "Hide Others"
|
msgid "Hide Others"
|
||||||
msgstr ""
|
msgstr "Skryť ostatných"
|
||||||
|
|
||||||
#: lclstrconsts.rsmacosmenuquit
|
#: lclstrconsts.rsmacosmenuquit
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Quit %s"
|
msgid "Quit %s"
|
||||||
msgstr ""
|
msgstr "Skončiť %s"
|
||||||
|
|
||||||
#: lclstrconsts.rsmacosmenuservices
|
#: lclstrconsts.rsmacosmenuservices
|
||||||
msgid "Services"
|
msgid "Services"
|
||||||
msgstr ""
|
msgstr "Služby"
|
||||||
|
|
||||||
#: lclstrconsts.rsmacosmenushowall
|
#: lclstrconsts.rsmacosmenushowall
|
||||||
msgid "Show All"
|
msgid "Show All"
|
||||||
msgstr ""
|
msgstr "Zobraziť všetko"
|
||||||
|
|
||||||
#: lclstrconsts.rsmarooncolorcaption
|
#: lclstrconsts.rsmarooncolorcaption
|
||||||
msgid "Maroon"
|
msgid "Maroon"
|
||||||
@ -931,7 +929,7 @@ msgstr "Odoslať (pošta)"
|
|||||||
#: lclstrconsts.rspressoktoignoreandriskdatacorruptionpressaborttok
|
#: lclstrconsts.rspressoktoignoreandriskdatacorruptionpressaborttok
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "%s%sPress OK to ignore and risk data corruption.%sPress Abort to kill the program."
|
msgid "%s%sPress OK to ignore and risk data corruption.%sPress Abort to kill the program."
|
||||||
msgstr ""
|
msgstr "%s%sStlačte tlačítko OK, ak chcete ignorovať a riskovať poškodenie dát.%sStlačte tlačítko Prerušiť, ak chcete ukončiť program."
|
||||||
|
|
||||||
#: lclstrconsts.rspriorrecordhint
|
#: lclstrconsts.rspriorrecordhint
|
||||||
msgctxt "lclstrconsts.rspriorrecordhint"
|
msgctxt "lclstrconsts.rspriorrecordhint"
|
||||||
@ -953,7 +951,7 @@ msgstr "Fialová"
|
|||||||
|
|
||||||
#: lclstrconsts.rsqtoptiondisableaccurateframe
|
#: lclstrconsts.rsqtoptiondisableaccurateframe
|
||||||
msgid "-disableaccurateframe, disables fully accurate window frame under X11. This feature is implemented for Qt, Qt5 and Gtk2 interfaces and used mostly by GetWindowRect()."
|
msgid "-disableaccurateframe, disables fully accurate window frame under X11. This feature is implemented for Qt, Qt5 and Gtk2 interfaces and used mostly by GetWindowRect()."
|
||||||
msgstr ""
|
msgstr "-disableaccurateframe, deaktivuje úplne presný rám okna pod X11. Táto funkcia je implementovaná pre rozhrania Qt, Qt5 a Gtk2 a väčšinou ju používa GetWindowRect()."
|
||||||
|
|
||||||
#: lclstrconsts.rsqtoptiondograb
|
#: lclstrconsts.rsqtoptiondograb
|
||||||
msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG."
|
msgid "-dograb (only under X11), running under a debugger can cause an implicit -nograb, use -dograb to override. Need QT_DEBUG."
|
||||||
@ -972,9 +970,8 @@ msgid "-reverse, sets the application's layout direction to Qt::RightToLeft."
|
|||||||
msgstr "-reverse, nastavuje smer rozloženia aplikácie na Qt::RightToLeft."
|
msgstr "-reverse, nastavuje smer rozloženia aplikácie na Qt::RightToLeft."
|
||||||
|
|
||||||
#: lclstrconsts.rsqtoptionsession
|
#: lclstrconsts.rsqtoptionsession
|
||||||
#, fuzzy
|
|
||||||
msgid "-session session, restores the application from an earlier session."
|
msgid "-session session, restores the application from an earlier session."
|
||||||
msgstr "-session session - obnovuje aplikáciu z skoršieho posedenia"
|
msgstr "-session session, obnoví aplikáciu zo skoršej relácie."
|
||||||
|
|
||||||
#: lclstrconsts.rsqtoptionstyle
|
#: lclstrconsts.rsqtoptionstyle
|
||||||
msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)."
|
msgid "-style style or -style=style, sets the application GUI style. Possible values are motif, windows, and platinum. If you compiled Qt with additional styles or have additional styles as plugins these will be available to the -style command line option. NOTE: Not all styles are available on all platforms. If style param does not exist Qt will start an application with default common style (windows)."
|
||||||
@ -1120,7 +1117,7 @@ msgstr "Text"
|
|||||||
|
|
||||||
#: lclstrconsts.rsthebuiltinurlisreadonlychangethebaseurlinstead
|
#: lclstrconsts.rsthebuiltinurlisreadonlychangethebaseurlinstead
|
||||||
msgid "The built-in URL is read only. Change the BaseURL instead."
|
msgid "The built-in URL is read only. Change the BaseURL instead."
|
||||||
msgstr ""
|
msgstr "Vstavaná adresa URL je len na čítanie. Namiesto toho zmeňte BaseURL."
|
||||||
|
|
||||||
#: lclstrconsts.rstiff
|
#: lclstrconsts.rstiff
|
||||||
msgid "Tagged Image File Format"
|
msgid "Tagged Image File Format"
|
||||||
@ -1361,7 +1358,7 @@ msgstr "Nie sú dostupné žiadne časovače"
|
|||||||
#: lclstrconsts.sparentrequired
|
#: lclstrconsts.sparentrequired
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
msgid "Control \"%s\" has no parent window."
|
msgid "Control \"%s\" has no parent window."
|
||||||
msgstr "Kontrola \"%s\" nemá nadradené okno."
|
msgstr "Ovládací prvok \"%s\" nemá nadradené okno."
|
||||||
|
|
||||||
#: lclstrconsts.sparexpected
|
#: lclstrconsts.sparexpected
|
||||||
#, object-pascal-format
|
#, object-pascal-format
|
||||||
|
|||||||
Loading…
Reference in New Issue
Block a user