mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-08-24 22:19:12 +02:00
Translations: Hungarian translation update by Péter Gábor, bug #28393
git-svn-id: branches/fixes_1_4@49527 -
This commit is contained in:
parent
8633fb5153
commit
bbd8f8b25e
@ -13,7 +13,7 @@ msgstr ""
|
||||
|
||||
#: anchordockstr.adrsafreesideofasplittermustnotbeanchorednodetypeancho
|
||||
msgid "A free side of a splitter must not be anchored: Node=\"%s\" Type=%s Anchors[%s]=\"%s\""
|
||||
msgstr "Egy elválasztó szabad oldalát nem lehet lehorgonyozni: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\""
|
||||
msgstr "Egy elválasztó szabad oldala nem rögzíthető: Csomópont=\"%s\" Típus=%s Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsallfiles
|
||||
msgid "All files"
|
||||
@ -25,23 +25,23 @@ msgstr "Ennyi képpontot kell mozdulnia az egérnek mielőtt a húzás elkezdőd
|
||||
|
||||
#: anchordockstr.adrsanchordockinglayout
|
||||
msgid "Anchor Docking Layout"
|
||||
msgstr "Lehorgonyzás elrendezése"
|
||||
msgstr "Rögzített ablakelrendezés"
|
||||
|
||||
#: anchordockstr.adrsanchorisnotsplitternodeanchors
|
||||
msgid "Anchor is not splitter: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "A horgony nem elválasztó: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítés nem elválasztóhoz: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsanchornotfoundnodeanchors
|
||||
msgid "Anchor not found: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "Horgonyzás nincs engedélyezve: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítési hely nem található: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsanchortowrongsideofsplitternodeanchors
|
||||
msgid "Anchor to wrong side of splitter: Node=\"%s\" Anchors[%s]=\"%s\""
|
||||
msgstr "Horgonyzás az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
msgstr "Rögzítés az elválasztó rossz oldalához: Csomópont=\"%s\" Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsapagemustnotbeanchorednodeparentparenttypeanchors
|
||||
msgid "A page must not be anchored: Node=\"%s\" Parent=%s ParentType=%s Anchors[%s]=\"%s\""
|
||||
msgstr "Egy lapot nem lehet lehorgonyozni: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\""
|
||||
msgstr "Egy lap nem rögzíthető: Csomópont=\"%s\" Szülő:%s Szülőtípus=%s Horgonyok[%s]=\"%s\""
|
||||
|
||||
#: anchordockstr.adrsautomatically
|
||||
msgid "Automatically"
|
||||
@ -65,7 +65,7 @@ msgstr "Az \"%s\" dokkterület csak egy területet tartalmazhat."
|
||||
|
||||
#: anchordockstr.adrsdockinganchordocking
|
||||
msgid "Docking / Anchordocking"
|
||||
msgstr "Dokkolás / Lehorgonyzás"
|
||||
msgstr "Dokkolás / Ablakok rögzítése"
|
||||
|
||||
#: anchordockstr.adrsdockingoptions
|
||||
msgid "Docking options"
|
||||
@ -289,7 +289,7 @@ msgstr "fel"
|
||||
|
||||
#: anchordockstr.adrstouseanchordockingyoumustfirstuninstall
|
||||
msgid "To use anchordocking you must first uninstall %s"
|
||||
msgstr "A lehorgonyzás használatához először el kell távolítani ezt: %s"
|
||||
msgstr "Az ablakok rögzítésének használatához először el kell távolítani ezt: %s"
|
||||
|
||||
#: anchordockstr.adrsundock
|
||||
msgid "Undock"
|
||||
|
@ -655,19 +655,19 @@ msgstr "Beállítások"
|
||||
|
||||
#: objinspstrconsts.oisorderbackone
|
||||
msgid "Back One"
|
||||
msgstr "Egyet hátra"
|
||||
msgstr "Hátrább eggyel"
|
||||
|
||||
#: objinspstrconsts.oisorderforwardone
|
||||
msgid "Forward One"
|
||||
msgstr "Egyet előre"
|
||||
msgstr "Előbbre eggyel"
|
||||
|
||||
#: objinspstrconsts.oisordermovetoback
|
||||
msgid "Move to Back"
|
||||
msgstr "Háttérbe visz"
|
||||
msgstr "Háttérbe"
|
||||
|
||||
#: objinspstrconsts.oisordermovetofront
|
||||
msgid "Move to Front"
|
||||
msgstr "Előtérbe hoz"
|
||||
msgstr "Előtérbe"
|
||||
|
||||
#: objinspstrconsts.oispastecomponents
|
||||
msgctxt "objinspstrconsts.oispastecomponents"
|
||||
|
@ -178,7 +178,7 @@ msgstr "Kód"
|
||||
#: lr_const.sbarcodeformdbfld
|
||||
msgctxt "lr_const.sbarcodeformdbfld"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sbarcodeformopts
|
||||
msgctxt "lr_const.sbarcodeformopts"
|
||||
@ -681,7 +681,7 @@ msgstr "Elérhető adatbázisok"
|
||||
#: lr_const.sfieldsforminsert
|
||||
msgctxt "lr_const.sfieldsforminsert"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sfilenotfound
|
||||
msgid "File not found"
|
||||
@ -903,7 +903,7 @@ msgstr "Teljes keret"
|
||||
|
||||
#: lr_const.sfrdesignerformback
|
||||
msgid "Send to back"
|
||||
msgstr "Háttérbeküldés"
|
||||
msgstr "Háttérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerformbackcolor
|
||||
msgid "Background color"
|
||||
@ -923,7 +923,7 @@ msgstr "Alsó keretvonal"
|
||||
|
||||
#: lr_const.sfrdesignerformbring
|
||||
msgid "Bring to front"
|
||||
msgstr "Előtérbehozás"
|
||||
msgstr "Előtérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerformcapt
|
||||
msgctxt "lr_const.sfrdesignerformcapt"
|
||||
@ -1164,7 +1164,7 @@ msgstr "Igazítás"
|
||||
|
||||
#: lr_const.sfrdesignerform_back
|
||||
msgid "Send to &back"
|
||||
msgstr "Háttérbeküldés"
|
||||
msgstr "Háttérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerform_beforeprintscript
|
||||
msgid "&Before print script ..."
|
||||
@ -1172,7 +1172,7 @@ msgstr "Nyomtatás előtti szkript ..."
|
||||
|
||||
#: lr_const.sfrdesignerform_bring
|
||||
msgid "Bring to &front"
|
||||
msgstr "Előtérbehozás "
|
||||
msgstr "Előtérbe helyezés"
|
||||
|
||||
#: lr_const.sfrdesignerform_copy
|
||||
msgid "&Copy"
|
||||
@ -1362,7 +1362,7 @@ msgstr "Nyújtás"
|
||||
#: lr_const.sgroupeditorformadddbfield
|
||||
msgctxt "lr_const.sgroupeditorformadddbfield"
|
||||
msgid "Insert DB field"
|
||||
msgstr "Adatbázis-mező beszúrása"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
|
||||
#: lr_const.sgroupeditorformcapt
|
||||
msgid "Group"
|
||||
@ -1453,7 +1453,7 @@ msgstr "Kifejezés beszúrása"
|
||||
|
||||
#: lr_const.sinsertfields
|
||||
msgid "Insert DB fields"
|
||||
msgstr "Adatbázismező beszúrása"
|
||||
msgstr "Adatbázismezők beszúrása"
|
||||
|
||||
#: lr_const.sinsertfieldsformaviabledset
|
||||
msgid "&Available datasets"
|
||||
|
@ -49,7 +49,7 @@ msgstr "Szivárgás és Nyomkövetés - HeapTrc és GDB visszakövetési kimenet
|
||||
|
||||
#: heaptrcview.sfrmselectfilewithdebuginfo
|
||||
msgid "Select File with debug info"
|
||||
msgstr "Válasszon fájlt hibakeresési infókkal!"
|
||||
msgstr "Hibakeresési infókat tartalmazó fájl választása"
|
||||
|
||||
#: heaptrcview.slbltrace
|
||||
msgid ".trc file"
|
||||
|
@ -29,7 +29,7 @@ msgstr "Betöltés gyorsítótárból (%s = %s)"
|
||||
|
||||
#: ipconst.httpcantloadgraphic
|
||||
msgid "Unable to load graphic %s"
|
||||
msgstr ""
|
||||
msgstr "Nem lehet betölteni a grafikát: %s"
|
||||
|
||||
#: ipconst.httpconnect
|
||||
msgid "Connected: (%s)"
|
||||
@ -284,7 +284,7 @@ msgstr "Az átvitelt a felhasználó megszakította"
|
||||
|
||||
#: ipconst.shtmlcharstackoverfl
|
||||
msgid "Character stack overflow"
|
||||
msgstr ""
|
||||
msgstr "Karakter-verem túlcsordulás"
|
||||
|
||||
#: ipconst.shtmldashexp
|
||||
msgid "- expected"
|
||||
@ -1613,11 +1613,11 @@ msgstr "Hitelesítés újrapróbálása"
|
||||
|
||||
#: ipconst.srascallbackcomplete
|
||||
msgid "Callback complete"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás kész"
|
||||
|
||||
#: ipconst.srascallbacksetbycaller
|
||||
msgid "Callback set by caller"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás beállítva a hívó által"
|
||||
|
||||
#: ipconst.srasconnectdevice
|
||||
msgid "Connect device"
|
||||
@ -1666,7 +1666,7 @@ msgstr "Port megnyitva"
|
||||
|
||||
#: ipconst.srasprepareforcallback
|
||||
msgid "Prepare for callback"
|
||||
msgstr ""
|
||||
msgstr "Visszahívás előkészítése"
|
||||
|
||||
#: ipconst.srasprojected
|
||||
msgid "Projected"
|
||||
@ -1694,7 +1694,7 @@ msgstr ""
|
||||
|
||||
#: ipconst.sraswaitforcallback
|
||||
msgid "Wait for callback"
|
||||
msgstr ""
|
||||
msgstr "Várakozás visszahívásra"
|
||||
|
||||
#: ipconst.sraswaitformodemreset
|
||||
msgid "Wait for modem reset"
|
||||
@ -1734,7 +1734,7 @@ msgstr "Siker,"
|
||||
|
||||
#: ipconst.ssmtpresponse04
|
||||
msgid "Transient, "
|
||||
msgstr ""
|
||||
msgstr "Átmenő, "
|
||||
|
||||
#: ipconst.ssmtpresponse05
|
||||
msgid "Persistent, "
|
||||
@ -1842,7 +1842,7 @@ msgstr ""
|
||||
|
||||
#: ipconst.ssmtpresponse46
|
||||
msgid "Routing loop detected"
|
||||
msgstr ""
|
||||
msgstr "Útválasztás ismétlődése érzékelve"
|
||||
|
||||
#: ipconst.ssmtpresponse47
|
||||
msgid "Delivery time expired"
|
||||
@ -2028,7 +2028,7 @@ msgstr "A puffer mérete nem egyezik."
|
||||
|
||||
#: ipconst.ssslclosenotify
|
||||
msgid "Server sent close notify."
|
||||
msgstr ""
|
||||
msgstr "A kiszolgáló lezárási értesítést küldött."
|
||||
|
||||
#: ipconst.ssslcompressionfailure
|
||||
msgid "Compression failure."
|
||||
@ -2255,7 +2255,7 @@ msgstr "%s nem található"
|
||||
|
||||
#: ipconst.swebimagestreambad
|
||||
msgid "Cannot load image from stream"
|
||||
msgstr ""
|
||||
msgstr "Nem lehet képet betölteni az adatfolyamból"
|
||||
|
||||
#: ipconst.swinsockerr
|
||||
msgid "WinSock Error (%d): %s, on API '%s'"
|
||||
@ -2263,7 +2263,7 @@ msgstr "WinSock hiba (%d): %s, a következő API-n: '%s'"
|
||||
|
||||
#: ipconst.swriteafterrename
|
||||
msgid "***Write after rename"
|
||||
msgstr ""
|
||||
msgstr "***Írás átnevezés után"
|
||||
|
||||
#: ipconst.swrongstateerr
|
||||
msgid "Can not comply, wrong state"
|
||||
@ -2315,7 +2315,7 @@ msgstr "Célcím szükséges"
|
||||
|
||||
#: ipconst.swsaediscon
|
||||
msgid "Graceful shutdown in progress"
|
||||
msgstr ""
|
||||
msgstr "Rendes lekapcsolás folyamatban"
|
||||
|
||||
#: ipconst.swsaedquot
|
||||
msgid "Disk quota exceeded"
|
||||
@ -2440,7 +2440,7 @@ msgstr "Elutasítva"
|
||||
|
||||
#: ipconst.swsaeremote
|
||||
msgid "Too many levels of remote in path"
|
||||
msgstr ""
|
||||
msgstr "Túl sok szint a távoli útvonalban"
|
||||
|
||||
#: ipconst.swsaeshutdown
|
||||
msgid "Cannot send after socket shutdown"
|
||||
@ -2480,7 +2480,7 @@ msgstr "Sikeres WSAStartup még nem lett végrehajtva"
|
||||
|
||||
#: ipconst.swsano_data
|
||||
msgid "Valid name, no data record of requested type"
|
||||
msgstr ""
|
||||
msgstr "Érvényes név, nincs adatrekord a kért típussal"
|
||||
|
||||
#: ipconst.swsano_recovery
|
||||
msgid "This is a nonrecoverable error"
|
||||
@ -2504,7 +2504,7 @@ msgstr ""
|
||||
|
||||
#: ipconst.swsatype_not_found
|
||||
msgid "Type not found"
|
||||
msgstr ""
|
||||
msgstr "Típus nem található"
|
||||
|
||||
#: ipconst.swsavernotsupported
|
||||
msgid "WinSock DLL version not supported"
|
||||
|
@ -442,7 +442,7 @@ msgstr "Szinkron szerkesztés"
|
||||
|
||||
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
||||
msgid "Template Edit"
|
||||
msgstr "Sablon szerkesztés"
|
||||
msgstr "Sablon szerkesztése"
|
||||
|
||||
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
||||
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
||||
@ -692,7 +692,7 @@ msgstr "Blokk behúzás (tab-ok)"
|
||||
|
||||
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
||||
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
||||
msgstr "A keret-térköz beállítható a Horgony szerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."
|
||||
msgstr "A keret-térköz beállítható a Horgonyszerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."
|
||||
|
||||
#: lazarusidestrconsts.dlgbrackethighlight
|
||||
msgid "Bracket highlight"
|
||||
@ -814,7 +814,7 @@ msgstr "A form csomagokat igényelhet a működéshez. Az ilyen csomagok automat
|
||||
|
||||
#: lazarusidestrconsts.dlgchscodetempl
|
||||
msgid "Choose code template file (*.dci)"
|
||||
msgstr "Válasszon kódsablon fájlt! (*.dcl)"
|
||||
msgstr "Kódsablon fájl választása (*.dci)"
|
||||
|
||||
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
||||
msgid "Show close buttons in notebook"
|
||||
@ -3383,11 +3383,11 @@ msgstr "Tükrözés függőlegesen"
|
||||
|
||||
#: lazarusidestrconsts.fdmorderbackone
|
||||
msgid "Back One"
|
||||
msgstr "Egyet hátra"
|
||||
msgstr "Hátrább eggyel"
|
||||
|
||||
#: lazarusidestrconsts.fdmorderforwardone
|
||||
msgid "Forward One"
|
||||
msgstr "Egyet előre"
|
||||
msgstr "Előbbre eggyel"
|
||||
|
||||
#: lazarusidestrconsts.fdmordermovetoback
|
||||
msgid "Move to Back"
|
||||
@ -5114,7 +5114,7 @@ msgstr "%s Ellenőrizze a célt (OS, CPU, LCL vezérlőkészlet típusa)! Talán
|
||||
|
||||
#: lazarusidestrconsts.lischeckuncheckall
|
||||
msgid "Check/uncheck all"
|
||||
msgstr ""
|
||||
msgstr "Minden/Semmi kijelölése"
|
||||
|
||||
#: lazarusidestrconsts.lischooseadifferentname
|
||||
msgid "Choose a different name"
|
||||
@ -5549,7 +5549,7 @@ msgstr "Konstansok kihagyása a következő függvényekben"
|
||||
#: lazarusidestrconsts.liscodeobscharconst
|
||||
msgctxt "lazarusidestrconsts.liscodeobscharconst"
|
||||
msgid "Search for unnamed char constants"
|
||||
msgstr "Meg nem nevezett karakter konstansok megkeresése"
|
||||
msgstr "Névtelen karakter konstansok megkeresése"
|
||||
|
||||
#: lazarusidestrconsts.liscodeobserver
|
||||
msgid "Code Observer"
|
||||
@ -5567,7 +5567,7 @@ msgstr "Sablon hozzáadása"
|
||||
|
||||
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
||||
msgid "Add code template"
|
||||
msgstr "Kód sablon hozzáadása"
|
||||
msgstr "Kódsablon hozzáadása"
|
||||
|
||||
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
||||
msgid " A token \"%s\" already exists! "
|
||||
@ -5588,7 +5588,7 @@ msgstr "Megjegyzés:"
|
||||
|
||||
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
||||
msgid "Edit code template"
|
||||
msgstr "Kód sablon szerkesztése"
|
||||
msgstr "Kódsablon szerkesztése"
|
||||
|
||||
#: lazarusidestrconsts.liscodetemplerror
|
||||
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
||||
@ -5991,7 +5991,7 @@ msgstr "Szimbólum"
|
||||
|
||||
#: lazarusidestrconsts.liscodetoolstemplatefile
|
||||
msgid "CodeTools template file"
|
||||
msgstr "CodeTools sablon fájl"
|
||||
msgstr "CodeTools sablonfájl"
|
||||
|
||||
#: lazarusidestrconsts.liscoexecuteafter
|
||||
msgid "Execute after"
|
||||
@ -7010,7 +7010,7 @@ msgstr "Alapértelmezett szín"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenexceptionraised
|
||||
msgid "Exception Raised"
|
||||
msgstr "Kivétel Keletkezett"
|
||||
msgstr "Kivétel keletkezett"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenmoduleload
|
||||
msgid "Module Load"
|
||||
@ -7042,11 +7042,11 @@ msgstr "Szál indítása"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
||||
msgid "Windows Message Posted"
|
||||
msgstr "Windows üzenet küldése"
|
||||
msgstr "Küldött Windows üzenet"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
||||
msgid "Windows Message Sent"
|
||||
msgstr "Küldött Windows üzenet"
|
||||
msgstr "Windows üzenet elküldve"
|
||||
|
||||
#: lazarusidestrconsts.lisdbgitemdeletehint
|
||||
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
||||
@ -7719,15 +7719,15 @@ msgstr "Kijelölt komponensek kivágása a vágólapra"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgorderbackone
|
||||
msgid "Move component one back"
|
||||
msgstr "Komponens eggyel hátra"
|
||||
msgstr "Komponens mozgatása eggyel hátrább"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgorderforwardone
|
||||
msgid "Move component one forward"
|
||||
msgstr "Komponens eggyel előre"
|
||||
msgstr "Komponens mozgatása eggyel előbbre"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgordermovetoback
|
||||
msgid "Move component to back"
|
||||
msgstr "Komponens háttérbe rakása"
|
||||
msgstr "Komponens háttérbe küldése"
|
||||
|
||||
#: lazarusidestrconsts.lisdsgordermovetofront
|
||||
msgid "Move component to front"
|
||||
@ -8252,7 +8252,7 @@ msgstr "Példák:%sAzonosító%sTMyEnum.Enum%sUnitnév.Azonosító%s#Csomagnév.
|
||||
|
||||
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
||||
msgid "Open first selected"
|
||||
msgstr "Első kijelölt megynitása"
|
||||
msgstr "Első kijelölt megnyitása"
|
||||
|
||||
#: lazarusidestrconsts.lisexceptiondialog
|
||||
msgid "Debugger Exception Notification"
|
||||
@ -8926,7 +8926,7 @@ msgstr "Ugrás adott sorra"
|
||||
|
||||
#: lazarusidestrconsts.lisgotoselected
|
||||
msgid "Goto selected"
|
||||
msgstr ""
|
||||
msgstr "Ugrás a kijelöltre"
|
||||
|
||||
#: lazarusidestrconsts.lisgplnotice
|
||||
msgid ""
|
||||
@ -9677,11 +9677,11 @@ msgstr "Kiadások"
|
||||
|
||||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
||||
msgid "I wonder how you did that. Error in the %s:"
|
||||
msgstr "Hát, ez nagyon furcsa. Hiba itt: %s:"
|
||||
msgstr "Nahát, ez nagyon furcsa. Hiba itt: %s:"
|
||||
|
||||
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
||||
msgid "I wonder how you did that: Error in the base directory:"
|
||||
msgstr "Hát, ez nagyon furcsa: Hiba az alapkönyvtárban:"
|
||||
msgstr "Nahát, ez nagyon furcsa: Hiba az alapkönyvtárban:"
|
||||
|
||||
#: lazarusidestrconsts.lisjhjumphistory
|
||||
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
||||
@ -11008,7 +11008,7 @@ msgstr "Sz&erkesztés"
|
||||
|
||||
#: lazarusidestrconsts.lismenueditcodetemplates
|
||||
msgid "Code Templates ..."
|
||||
msgstr "Kód sablonok ..."
|
||||
msgstr "Kódsablonok ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenueditcontexthelp
|
||||
msgid "Edit context sensitive Help"
|
||||
@ -11133,7 +11133,7 @@ msgstr "Azonosító hivatkozásainak megkeresése ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenufindinfiles
|
||||
msgid "Find &in Files ..."
|
||||
msgstr "Keresés fájlokban ..."
|
||||
msgstr "Keresés a fájlokban ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenufindnext
|
||||
msgid "Find &Next"
|
||||
@ -11358,7 +11358,7 @@ msgstr "Projekt megnyitása ..."
|
||||
|
||||
#: lazarusidestrconsts.lismenuopenrecent
|
||||
msgid "Open &Recent"
|
||||
msgstr "Legutóbbi megynyitása"
|
||||
msgstr "Legutóbbi megnyitása"
|
||||
|
||||
#: lazarusidestrconsts.lismenuopenrecentpkg
|
||||
msgid "Open Recent Package"
|
||||
@ -15344,7 +15344,7 @@ msgstr "Csomagok megjelenítése"
|
||||
|
||||
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
||||
msgid "Show position of source editor"
|
||||
msgstr "Váltás a forráskódbeli helyére"
|
||||
msgstr "Váltás a forráskódbeli helyzetére"
|
||||
|
||||
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
||||
msgid "Show recently used identifiers at top"
|
||||
@ -17986,11 +17986,11 @@ msgstr "Egyidejű szerkesztés (kijelölés közben)"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattemplateedit
|
||||
msgid "Template Editing"
|
||||
msgstr "Sablon szerkesztés"
|
||||
msgstr "Sablon szerkesztése"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattemplateeditoff
|
||||
msgid "Template Editing (not in Cell)"
|
||||
msgstr "Sablon szerkesztés (kurzor cellán kívül)"
|
||||
msgstr "Sablon szerkesztése (kurzor cellán kívül)"
|
||||
|
||||
#: lazarusidestrconsts.srkmcattoolmenu
|
||||
msgid "Tools menu commands"
|
||||
@ -18043,7 +18043,7 @@ msgstr "Csatolás programhoz "
|
||||
|
||||
#: lazarusidestrconsts.srkmecautocompletion
|
||||
msgid "Code template completion"
|
||||
msgstr "Kód sablon kiegészítés"
|
||||
msgstr "Kódsablon kiegészítése"
|
||||
|
||||
#: lazarusidestrconsts.srkmecblockcopy
|
||||
msgid "Copy Block"
|
||||
@ -18322,7 +18322,7 @@ msgstr "Azonosító hivatkozásainak megkeresése"
|
||||
|
||||
#: lazarusidestrconsts.srkmecfindinfiles
|
||||
msgid "Find in Files"
|
||||
msgstr "Keresés fájlokban"
|
||||
msgstr "Keresés a fájlokban"
|
||||
|
||||
#: lazarusidestrconsts.srkmecfindnext
|
||||
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
||||
|
@ -213,11 +213,11 @@ msgstr "Külső kulcs hozzáadása a táblához"
|
||||
|
||||
#: lazdatadeskstr.sld_actionaddsequence
|
||||
msgid "New sequence"
|
||||
msgstr "Új sorrend"
|
||||
msgstr "Új sorozat"
|
||||
|
||||
#: lazdatadeskstr.sld_actionaddsequenceh
|
||||
msgid "Add a sequence"
|
||||
msgstr "Sorrend hozzáadása"
|
||||
msgstr "Sorozat hozzáadása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionclose
|
||||
msgid "&Close"
|
||||
@ -346,7 +346,7 @@ msgstr "A kiválasztott legutóbbi kapcsolat megnyitása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionopenh
|
||||
msgid "Open a new Data Dictionary"
|
||||
msgstr "Új adatszótár megnyitása"
|
||||
msgstr "Egy új adatszótár megnyitása"
|
||||
|
||||
#: lazdatadeskstr.sld_actionopenrecentdatadict
|
||||
msgid "Open"
|
||||
@ -399,7 +399,7 @@ msgstr "Meghajtó"
|
||||
|
||||
#: lazdatadeskstr.sld_connectionlv3
|
||||
msgid "Last used"
|
||||
msgstr "Legutóbb használt"
|
||||
msgstr "Utolsó használat"
|
||||
|
||||
#: lazdatadeskstr.sld_connectionlv4
|
||||
msgctxt "lazdatadeskstr.sld_connectionlv4"
|
||||
@ -531,7 +531,7 @@ msgstr "Fájlnév"
|
||||
|
||||
#: lazdatadeskstr.sld_recentlv3
|
||||
msgid "Last used on"
|
||||
msgstr "Utolsó használat:"
|
||||
msgstr "Utolsó használat"
|
||||
|
||||
#: lazdatadeskstr.sld_savefileasfilter
|
||||
msgctxt "lazdatadeskstr.sld_savefileasfilter"
|
||||
@ -644,7 +644,7 @@ msgstr "Új %s létrehozása"
|
||||
|
||||
#: lazdatadeskstr.snewsequence
|
||||
msgid "Create new sequence"
|
||||
msgstr "Új sorozat étrehozása"
|
||||
msgstr "Új sorozat létrehozása"
|
||||
|
||||
#: lazdatadeskstr.snewsequencename
|
||||
msgid "Enter a name for the new sequence:"
|
||||
@ -698,7 +698,7 @@ msgstr "Index beállítások:"
|
||||
|
||||
#: lazdatadeskstr.snodesequences
|
||||
msgid "Sequences"
|
||||
msgstr "Sorrendek"
|
||||
msgstr "Sorozatok"
|
||||
|
||||
#: lazdatadeskstr.snodetabledata
|
||||
msgid "Table Data"
|
||||
@ -738,7 +738,7 @@ msgstr "Változások mentése"
|
||||
|
||||
#: lazdatadeskstr.sselectdbfdir
|
||||
msgid "Select a directory with DBF files"
|
||||
msgstr "Válasszon könyvtárat a DBF fájlok számára!"
|
||||
msgstr "Könyvtár választása a DBF fájlok számára"
|
||||
|
||||
#: lazdatadeskstr.sselectedobject
|
||||
msgid "Selected object"
|
||||
@ -746,7 +746,7 @@ msgstr "Kiválasztott objektum"
|
||||
|
||||
#: lazdatadeskstr.ssequence
|
||||
msgid "Sequence"
|
||||
msgstr "Sorrend"
|
||||
msgstr "Sorozat"
|
||||
|
||||
#: lazdatadeskstr.ssqlfilters
|
||||
msgid "SQL files|*.sql|All files|*.*"
|
||||
|
Loading…
Reference in New Issue
Block a user