mirror of
https://gitlab.com/freepascal.org/lazarus/lazarus.git
synced 2025-04-17 07:29:27 +02:00
1fd0fb7e36
IDE: regenerated translations and updated Russian translation ........ git-svn-id: branches/fixes_1_8@57222 -
21025 lines
656 KiB
Plaintext
21025 lines
656 KiB
Plaintext
msgid ""
|
|
msgstr ""
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"Project-Id-Version: \n"
|
|
"POT-Creation-Date: \n"
|
|
"PO-Revision-Date: \n"
|
|
"Last-Translator: x <y>\n"
|
|
"Language-Team: \n"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
|
|
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
|
|
msgid "Select Groups"
|
|
msgstr "Valitse ryhmät"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
|
|
msgid "Select groups to disable when breakpoint is hit"
|
|
msgstr "Valitse estettävät ryhmät, kun keskeytyskohta aktivoituu"
|
|
|
|
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
|
|
msgid "Select groups to enable when breakpoint is hit"
|
|
msgstr "Valitse sallittavat ryhmät, kun keskeytyskohta aktivoituu"
|
|
|
|
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
|
|
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
|
|
msgstr "Joitain Salli/Estä listan ryhmiä ei ole.%0:sLuodaanko ne?%0:s%0:s%1:s"
|
|
|
|
#: lazarusidestrconsts.dlfmousepredefinedscheme
|
|
msgid "Use predefined scheme"
|
|
msgstr "Käytä valmista kaavaa"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetall
|
|
msgid "Reset all settings"
|
|
msgstr "Nollaa kaikki asetukset"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresetgutter
|
|
msgid "Reset all gutter settings"
|
|
msgstr "Nollaa kaikki reunapalkin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlfmouseresettext
|
|
msgid "Reset all text settings"
|
|
msgstr "Nollaa kaikki tekstin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
|
|
msgid "Add history point"
|
|
msgstr "Lisää historiapiste"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
|
|
msgid "Context Menu"
|
|
msgstr "Pikavalikko"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
|
|
msgid "Context Menu (debug)"
|
|
msgstr "Pikavalikko (virheenjäljitys)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
|
|
msgid "Context Menu (tab)"
|
|
msgstr "Pikavalikko (tab)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
|
|
msgid "Jumps to implementation"
|
|
msgstr "Hyppää toteutukseen"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
|
|
msgid "Jumps to implementation/other block end"
|
|
msgstr "Hyppää toteutukseen / lohkon toiseen päähän"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
|
|
msgid "History back"
|
|
msgstr "Historia takaisin"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
|
|
msgid "History forward"
|
|
msgstr "Historia eteenpäin"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
|
|
msgid "Toggle extra Caret"
|
|
msgstr "Vaihda extra tekstikursori"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Ei mitään / oletus"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
|
|
msgid "Paste"
|
|
msgstr "Liitä"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
|
|
msgid "Continue %0:s (Bound to: %1:s)"
|
|
msgstr "Jatka %0:s (Kiinnitä: %1:s)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
|
|
msgid "Continue %0:s"
|
|
msgstr "Jatka %0:s"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselect
|
|
msgid "Select text"
|
|
msgstr "Valitse teksti"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
|
|
msgid "Select text (lines)"
|
|
msgstr "Valitse teksti (rivit)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
|
|
msgid "Select text (tokens)"
|
|
msgstr "Valitse teksti (merkit)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
|
|
msgid "Select text (words)"
|
|
msgstr "Valitse teksti (sanat)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
|
|
msgid "Select text (Column mode)"
|
|
msgstr "Valitse teksti (sarakemoodi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
|
|
msgid "Select text (Line mode)"
|
|
msgstr "Valitse teksti (rivimoodi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
|
|
msgid "Set free bookmark"
|
|
msgstr "Aseta vapaa kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
|
|
msgid "Select current Line (Full)"
|
|
msgstr "Valitse nykyinen rivi (täysi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
|
|
msgid "Select current Line (Text)"
|
|
msgstr "Valitse nykyinen rivi (teksti)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
|
|
msgid "Select current Paragraph"
|
|
msgstr "Valitse nykyinen kappale"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
|
|
msgid "Select current Word"
|
|
msgstr "Valitse nykyinen sana"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
|
|
msgid "Reset zoom"
|
|
msgstr "Nollaa zoomaus"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplediff
|
|
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
|
|
msgstr "Tämä sivu ei näytä asetuksiasi. Katso edistyneet asetukset. Käytä tätä sivua edistyneiden asetusten nollaamiseen."
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegenericsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
|
|
msgid "General"
|
|
msgstr "Yleistä"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
|
|
msgid "Standard, All actions (breakpoint, fold) on mouse down"
|
|
msgstr "Toiminnot (keskeytyskohta, laskostus) kun hiiren nappi painetaan alas"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftup
|
|
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
|
|
msgstr "Toiminnot kun hiiren nappi vapautuu. Valinta: hiiren nappi alas + liike"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
|
|
msgid "Extended, Actions, right gutter half only"
|
|
msgstr "Toiminnot vain oikeaa reunapalkkia varten"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplegutterlines
|
|
msgid "Use line numbers to select lines"
|
|
msgstr "Käytä rivinumeroita valitaksesi rivit"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpleguttersect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
|
|
msgid "Gutter"
|
|
msgstr "Reunapalkki"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
|
|
msgid "Right mouse includes caret move"
|
|
msgstr "Oikea hiiren nappi siirtää tekstikursoria"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsect
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
|
|
msgid "Text"
|
|
msgstr "Teksti"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
|
|
msgid "Alt-Ctrl Button"
|
|
msgstr "Alt-Ctrl nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
|
|
msgid "Alt-Ctrl Wheel"
|
|
msgstr "Alt-Ctrl rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
|
|
msgid "Alt Button"
|
|
msgstr "Alt nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
|
|
msgid "Alt Wheel"
|
|
msgstr "Alt rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
|
|
msgid "Ctrl Button"
|
|
msgstr "Ctrl nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
|
|
msgid "Ctrl Wheel"
|
|
msgstr "Ctrl rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
|
|
msgid "Drag selection (copy/paste)"
|
|
msgstr "Vedä valintaa (kopioi/liitä)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
|
|
msgid "Extra-1 Button"
|
|
msgstr "Extra-1 nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
|
|
msgid "Extra-2 Button"
|
|
msgstr "Extra-2 nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
|
|
msgid "Alt Double"
|
|
msgstr "Alt kaksois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
|
|
msgid "Ctrl Double"
|
|
msgstr "Ctrl kaksois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
|
|
msgid "Double"
|
|
msgstr "Kaksois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
|
|
msgid "Shift Double"
|
|
msgstr "Shift kaksois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
|
|
msgid "Quad"
|
|
msgstr "Nelois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
|
|
msgid "Triple"
|
|
msgstr "Kolmois"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
|
|
msgid "Middle Button"
|
|
msgstr "Keskinappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
|
|
msgid "Middle"
|
|
msgstr "Keski"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
|
|
msgid "Left 1"
|
|
msgstr "Vasen 1"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
|
|
msgid "Left 2"
|
|
msgstr "Vasen 2"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
|
|
msgid "Right"
|
|
msgstr "Oikea"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
|
|
msgid "Wheel"
|
|
msgstr "Rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
|
|
msgid "Right Button"
|
|
msgstr "Oikea nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
|
|
msgid "Shift-Alt-Ctrl Button"
|
|
msgstr "Shift-Alt-Ctrl nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
|
|
msgid "Shift-Alt-Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
|
|
msgid "Shift-Alt Button"
|
|
msgstr "Shift-Alt nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
|
|
msgid "Shift-Alt Wheel"
|
|
msgstr "Shift-Alt rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
|
|
msgid "Shift-Ctrl Button"
|
|
msgstr "Shift-Ctrl nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
|
|
msgid "Shift-Ctrl Wheel"
|
|
msgstr "Shift-Ctrl rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
|
|
msgid "Shift Button"
|
|
msgstr "Shift nappi"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
|
|
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
|
|
msgid "Wheel"
|
|
msgstr "Rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
|
|
msgid "Shift Wheel"
|
|
msgstr "Shift rulla"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewarning
|
|
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
|
|
msgstr "Tietoja ei tallennettu. Tämän sivun käyttö kumoaa edistyneelle sivulle tehdyt muutokset"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
|
|
msgid "Scroll horizontal (System speed)"
|
|
msgstr "Vieritä vaakatasossa (systeeminopeus)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
|
|
msgid "Scroll horizontal (Single line)"
|
|
msgstr "Vieritä vaakatasossa (yksi rivi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
|
|
msgid "Scroll horizontal (Page)"
|
|
msgstr "Vieritä vaakatasossa (sivu)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
|
|
msgid "Scroll horizontal (Half page)"
|
|
msgstr "Vieritä vaakatasossa (puoli sivua)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
|
|
msgid "Scroll horizontal (Page, less one line)"
|
|
msgstr "Vieritä vaakatasossa (sivu - 1 rivi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelnothing
|
|
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
|
|
msgid "Nothing/Default"
|
|
msgstr "Ei mitään / oletus"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
|
|
msgid "Scroll (System speed)"
|
|
msgstr "Vieritä (järjestelmän nopeus)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
|
|
msgid "Scroll (Single line)"
|
|
msgstr "Vieritä (yksi rivi)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
|
|
msgid "Scroll (Page)"
|
|
msgstr "Vieritä (sivu)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
|
|
msgid "Scroll (Half page)"
|
|
msgstr "Vieritä (puoli sivua)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
|
|
msgid "Scroll (Page, less one line)"
|
|
msgstr "Vieritä (riviä vaille sivu)"
|
|
|
|
#: lazarusidestrconsts.dlfmousesimplewheelzoom
|
|
msgid "Zoom"
|
|
msgstr "Zoomaus"
|
|
|
|
#: lazarusidestrconsts.dlfnopredefinedscheme
|
|
msgid "< None >"
|
|
msgstr "< Ei mikään >"
|
|
|
|
#: lazarusidestrconsts.dlfreadonlycolor
|
|
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
|
|
msgid "Read Only"
|
|
msgstr "Vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.dlg1up2low
|
|
msgid "Lowercase, first letter up"
|
|
msgstr "Ensimmäinen kirjain iso muut pieniä"
|
|
|
|
#: lazarusidestrconsts.dlgactivedesktop
|
|
msgid "active"
|
|
msgstr "aktiivinen"
|
|
|
|
#: lazarusidestrconsts.dlgaddassignmentoperator
|
|
msgid "Add assignment operator :="
|
|
msgstr "Lisää := operaattori (saa arvokseen) "
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
|
|
msgid "Brackets highlight"
|
|
msgstr "Sulkeiden korostus"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
|
|
msgid "Code folding tree"
|
|
msgstr "Koodin laskostuspuu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdefault
|
|
msgid "Default Text"
|
|
msgstr "Oletus teksti"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
|
|
msgid "Disabled breakpoint"
|
|
msgstr "Estetty keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
|
|
msgid "Enabled breakpoint"
|
|
msgstr "Sallittu keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrerrorline
|
|
msgid "Error line"
|
|
msgstr "Virheen rivi"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
|
|
msgid "Execution point"
|
|
msgstr "Suorituspiste"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
|
|
msgid "Folded code marker"
|
|
msgstr "Laskostetun koodin merkki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
|
|
msgid "Fold start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
|
|
msgid "Global"
|
|
msgstr "Julkinen"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
|
|
msgid "Gutter"
|
|
msgstr "Reunapalkki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
|
|
msgid "IfDef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupline
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
|
|
msgid "Line"
|
|
msgstr "Rivi"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
|
|
msgid "Outline Colors"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
|
|
msgid "Syncron Edit"
|
|
msgstr "Tahdistettu muokkaus"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
|
|
msgid "Template Edit"
|
|
msgstr "Mallineen muokkaus"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgrouptext
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
|
|
msgid "Text"
|
|
msgstr "Teksti"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
|
|
msgid "Gutter Separator"
|
|
msgstr "Reunapalkin erotin"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
|
|
msgid "Hide start-line"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightall
|
|
msgid "Incremental others"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrhighlightword
|
|
msgid "Highlight current word"
|
|
msgstr "Korosta aktiivinen sana"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
|
|
msgid "Incremental search"
|
|
msgstr "Kirjain kerrallaan haku"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
|
|
msgid "Invalid breakpoint"
|
|
msgstr "Kelvoton keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
|
|
msgid "Current line highlight"
|
|
msgstr "Aktiivisen rivin korostus"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrlinenumber
|
|
msgid "Line number"
|
|
msgstr "Rivinumero"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
|
|
msgid "Modified line"
|
|
msgstr "Muutettu rivi"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrmouselink
|
|
msgid "Mouse link"
|
|
msgstr "Hiiren linkki"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
|
|
msgid "Level 10"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
|
|
msgid "Level 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
|
|
msgid "Level 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
|
|
msgid "Level 3"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
|
|
msgid "Level 4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
|
|
msgid "Level 5"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
|
|
msgid "Level 6"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
|
|
msgid "Level 7"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
|
|
msgid "Level 8"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
|
|
msgid "Level 9"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
|
|
msgid "Selected Area"
|
|
msgstr "Valittu alue"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktiivinen solu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Muut solut"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Tahdistetut solut"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
|
|
msgid "Active Cell"
|
|
msgstr "Aktiivinen solu"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
|
|
msgid "Other Cells"
|
|
msgstr "Muut solut"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
|
|
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
|
|
msgid "Syncronized Cells"
|
|
msgstr "Tahdistetut solut"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrtextblock
|
|
msgid "Text block"
|
|
msgstr "Tekstilohko"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
|
|
msgid "Unknown breakpoint"
|
|
msgstr "Tuntematon keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.dlgaddhiattrwordgroup
|
|
msgid "Word-Brackets"
|
|
msgstr "Sana-sulut"
|
|
|
|
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
|
|
msgid "Visualized Special Chars"
|
|
msgstr "Näytä erikoismerkit"
|
|
|
|
#: lazarusidestrconsts.dlgaddsemicolon
|
|
msgid "Add semicolon"
|
|
msgstr "Lisää puolipiste"
|
|
|
|
#: lazarusidestrconsts.dlgadjusttopline
|
|
msgid "Adjust top line due to comment in front"
|
|
msgstr "Säädä ylin rivi edellä olevan kommentin mukaan"
|
|
|
|
#: lazarusidestrconsts.dlgalphabetically
|
|
msgid "Alphabetically"
|
|
msgstr "Aakkosjärjestys"
|
|
|
|
#: lazarusidestrconsts.dlgalwaysvisiblecursor
|
|
msgid "Always visible cursor"
|
|
msgstr "Kursori näkyy aina"
|
|
|
|
#: lazarusidestrconsts.dlgambigfileact
|
|
msgid "Ambiguous file action:"
|
|
msgstr "Toiminta ristiriitaisten tiedostojen kanssa"
|
|
|
|
#: lazarusidestrconsts.dlgambigwarn
|
|
msgid "Warn on compile"
|
|
msgstr "Varoita käännettäessä"
|
|
|
|
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
|
|
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
|
|
msgstr "Virheen/varoituksen/vihjeen kuvake näytetään tekstin edessä. Sama kuvake näytetään editorin reunapalkissa joka tapauksessa."
|
|
|
|
#: lazarusidestrconsts.dlgansicommenttab
|
|
msgid "Ansi (* *)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgapplicationsettings
|
|
msgid "Application settings"
|
|
msgstr "Sovelluksen asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgassertcode
|
|
msgid "Include assertion code"
|
|
msgstr "Ota mukaan assertion-koodi"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateforms
|
|
msgid "Auto-create forms:"
|
|
msgstr "Automaattisesti luotavat lomakkeet:"
|
|
|
|
#: lazarusidestrconsts.dlgautocreateformshint
|
|
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
|
|
msgstr "Pää .lpr tiedosto luo jokaisen lomakkeen Application.CreateForm():ssa. Ne myös tuhotaan automaattisesti."
|
|
|
|
#: lazarusidestrconsts.dlgautocreatenewforms
|
|
msgid "Auto-create new forms"
|
|
msgstr "Luo automaattisesti uusi lomake"
|
|
|
|
#: lazarusidestrconsts.dlgautodel
|
|
msgid "Auto delete file"
|
|
msgstr "Poista tiedosto automaattisesti"
|
|
|
|
#: lazarusidestrconsts.dlgautodisplayfuncproto
|
|
msgid "Auto Display Function Prototypes"
|
|
msgstr "Näytä automaattisesti funktioiden prototyypit"
|
|
|
|
#: lazarusidestrconsts.dlgautohidecursor
|
|
msgid "Hide mouse when typing"
|
|
msgstr "Piilota hiiri kirjoitettaessa"
|
|
|
|
#: lazarusidestrconsts.dlgautoindent
|
|
msgctxt "lazarusidestrconsts.dlgautoindent"
|
|
msgid "Auto indent"
|
|
msgstr "Automaattinen sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgautoindentlink
|
|
msgid "(Set up smart indent)"
|
|
msgstr "(Aseta älykäs sisennys)"
|
|
|
|
#: lazarusidestrconsts.dlgautoindenttype
|
|
msgctxt "lazarusidestrconsts.dlgautoindenttype"
|
|
msgid "Auto indent"
|
|
msgstr "Automaattinen sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgautoremoveemptymethods
|
|
msgid "Auto remove empty methods"
|
|
msgstr "Poista automaattisesti tyhjät metodit"
|
|
|
|
#: lazarusidestrconsts.dlgautoren
|
|
msgid "Auto rename file lowercase"
|
|
msgstr "Muuta nimi pieniksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktop
|
|
msgid "Auto save active desktop"
|
|
msgstr "Tallenna aktiivinen työpöytä automaattisesti"
|
|
|
|
#: lazarusidestrconsts.dlgautosaveactivedesktophint
|
|
msgid ""
|
|
"Save active desktop on IDE close\n"
|
|
"Save debug desktop on IDE close and debug end\n"
|
|
msgstr ""
|
|
"Tallenna aktiivinen työpöytä kun IDE suljetaan\n"
|
|
"Tallenna debug-työpöytä kun IDE suljetaan ja virheenjäljitys loppuu\n"
|
|
|
|
#: lazarusidestrconsts.dlgavailableforms
|
|
msgid "Available forms:"
|
|
msgstr "Käytettävissä olevat lomakkeet:"
|
|
|
|
#: lazarusidestrconsts.dlgavailableformshint
|
|
msgid "These forms must be created and freed in the program code."
|
|
msgstr "Nämä lomakkeet pitää luoda ja tuhota ohjelmakoodissa."
|
|
|
|
#: lazarusidestrconsts.dlgbackcolor
|
|
msgid "Background"
|
|
msgstr "Tausta"
|
|
|
|
#: lazarusidestrconsts.dlgbaknosubdirectory
|
|
msgid "(no subdirectory)"
|
|
msgstr "(ei alikansiota)"
|
|
|
|
#: lazarusidestrconsts.dlgbckupsubdir
|
|
msgid "Same name (in subdirectory)"
|
|
msgstr "Sama nimi (alikansiossa)"
|
|
|
|
#: lazarusidestrconsts.dlgbehindmethods
|
|
msgid "Behind methods"
|
|
msgstr "Metodien takana"
|
|
|
|
#: lazarusidestrconsts.dlgblockgroupoptions
|
|
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
|
|
msgid "Selection"
|
|
msgstr "Valinta"
|
|
|
|
#: lazarusidestrconsts.dlgblockindent
|
|
msgid "Block indent (spaces)"
|
|
msgstr "Lohkon sisennys (välilyönnit)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentkeys
|
|
msgid "Block indent"
|
|
msgstr "Lohkon sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgblockindentlink
|
|
msgid "(edit keys)"
|
|
msgstr "(muokkausnäppäimet)"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypecopy
|
|
msgid "Space/tab as prev Line"
|
|
msgstr "Väli/tab kuin ed. rivi"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypepos
|
|
msgid "Position only"
|
|
msgstr "Vain sijainti"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypespace
|
|
msgid "Spaces"
|
|
msgstr "Välilyönnit"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabonly
|
|
msgid "Tabs, cut off"
|
|
msgstr "Tabulaattorit, leikkaa"
|
|
|
|
#: lazarusidestrconsts.dlgblockindenttypetabspace
|
|
msgid "Tabs, then spaces"
|
|
msgstr "Tabulaattorit, sitten välilyönnit"
|
|
|
|
#: lazarusidestrconsts.dlgblocktabindent
|
|
msgid "Block indent (tabs)"
|
|
msgstr "Lohkon sisennys (tabit)"
|
|
|
|
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
|
|
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
|
|
msgstr "Reuna voidaan asettaa ankkurointi-editorissa. Punainen viiva näytetään jos reuna > 0."
|
|
|
|
#: lazarusidestrconsts.dlgbrackethighlight
|
|
msgid "Bracket highlight"
|
|
msgstr "Sulkujen korostus"
|
|
|
|
#: lazarusidestrconsts.dlgbracketmatchgroup
|
|
msgid "Matching bracket pairs"
|
|
msgstr "Yhteensopivat sulkuparit"
|
|
|
|
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
|
|
msgid "You cannot use docked desktop in undocked environment and vice versa."
|
|
msgstr "Telakoitua työpäytää ei voi käyttää erillisten ikkunoiden kanssa ja päinvastoin."
|
|
|
|
#: lazarusidestrconsts.dlgcasesensitive
|
|
msgid "&Case sensitive"
|
|
msgstr "&Sama kirjainkoko"
|
|
|
|
#: lazarusidestrconsts.dlgccocaption
|
|
msgid "Checking compiler options"
|
|
msgstr "Tarkistetaan kääntäjän asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgccoorphanedfilefound
|
|
msgid "orphaned file found: %s"
|
|
msgstr "orpo tiedosto: %s"
|
|
|
|
#: lazarusidestrconsts.dlgccoresults
|
|
msgid "Results"
|
|
msgstr "Tulokset"
|
|
|
|
#: lazarusidestrconsts.dlgccotest
|
|
msgid "Test"
|
|
msgstr "Testi"
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompiler
|
|
msgid "Test: Checking compiler ..."
|
|
msgstr "Testi: Tarkistetaan kääntäjä ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
|
|
msgid "Test: Checking compiler configuration ..."
|
|
msgstr "Testi: Tarkistetaan kääntäjän asetukset ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilerdate
|
|
msgid "Test: Checking compiler date ..."
|
|
msgstr "Testi: Tarkistetaan kääntäjän päiväys ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
|
|
msgid "Test: Compiling an empty file ..."
|
|
msgstr "Testi: Käännetään tyhjä tiedosto ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestmissingppu
|
|
msgid "Test: Checking missing fpc ppu ..."
|
|
msgstr "Testi: Tarkistetaan puuttuvat FPC:n ppu:t ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotestsrcinppupaths
|
|
msgid "Test: Checking sources in fpc ppu search paths ..."
|
|
msgstr "Testi: Tarkistetaan lähdetiedostot FPC:n ppu-hakupoluista ..."
|
|
|
|
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
|
|
msgid "Test: Compiling an empty file"
|
|
msgstr "Testi: Käännetään tyhjä tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgccousingconfigfile
|
|
msgid "using config file %s"
|
|
msgstr "käytetään asetustiedostoa %s"
|
|
|
|
#: lazarusidestrconsts.dlgcdtclassorder
|
|
msgid "Class order"
|
|
msgstr "Luokkajärjestys"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlast
|
|
msgid "Last"
|
|
msgstr "Viimeinen"
|
|
|
|
#: lazarusidestrconsts.dlgcdtlower
|
|
msgid "lowercase"
|
|
msgstr "Pienet kirjaimet"
|
|
|
|
#: lazarusidestrconsts.dlgcdtpreview
|
|
msgid "Preview (max line length = 1)"
|
|
msgstr "Esikatselu (kun maksimi rivinpituus = 1)"
|
|
|
|
#: lazarusidestrconsts.dlgcdtreadprefix
|
|
msgid "Read prefix"
|
|
msgstr "'Read' etuliite"
|
|
|
|
#: lazarusidestrconsts.dlgcdtstoredpostfix
|
|
msgid "Stored postfix"
|
|
msgstr "'Stored' pääte"
|
|
|
|
#: lazarusidestrconsts.dlgcdtuppercase
|
|
msgid "UPPERCASE"
|
|
msgstr "ISOT KIRJAIMET"
|
|
|
|
#: lazarusidestrconsts.dlgcdtvariableprefix
|
|
msgid "Variable prefix"
|
|
msgstr "Muuttujan etuliite"
|
|
|
|
#: lazarusidestrconsts.dlgcdtwriteprefix
|
|
msgid "Write prefix"
|
|
msgstr "'Write' etuliite"
|
|
|
|
#: lazarusidestrconsts.dlgcentercursorline
|
|
msgid "Center cursor line"
|
|
msgstr "Keskitä aktiivinen rivi"
|
|
|
|
#: lazarusidestrconsts.dlgcharcasefileact
|
|
msgid "Save As - auto rename Pascal files lower case"
|
|
msgstr "Tiedoston nimen automaattinen muuntaminen pieneksi tallennettaessa"
|
|
|
|
#: lazarusidestrconsts.dlgcheckandautosavefiles
|
|
msgid "Check and Auto Save Files"
|
|
msgstr "Tiedostojen automaattinen tarkistus ja talletus"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
|
|
msgid "Check packages on form create"
|
|
msgstr "Tarkista paketit lomaketta luotaessa"
|
|
|
|
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
|
|
msgid "The form may require a package to work. Install such a package automatically."
|
|
msgstr "Lomake saattaa tarvita paketin toimiakseen. Asenna se automaattisesti."
|
|
|
|
#: lazarusidestrconsts.dlgchscodetempl
|
|
msgid "Choose code template file (*.dci)"
|
|
msgstr "Valitse koodimallinetiedosto (*.dci)"
|
|
|
|
#: lazarusidestrconsts.dlgclosebuttonsnotebook
|
|
msgid "Show close buttons in notebook"
|
|
msgstr "Näytä sulje-painike välilehdellä"
|
|
|
|
#: lazarusidestrconsts.dlgclrscheme
|
|
msgid "Color Scheme"
|
|
msgstr "Värikaava"
|
|
|
|
#: lazarusidestrconsts.dlgcmacro
|
|
msgid "C style macros (global)"
|
|
msgstr "C-tyyliset makrot (julkiset)"
|
|
|
|
#: lazarusidestrconsts.dlgcoansistr
|
|
msgctxt "lazarusidestrconsts.dlgcoansistr"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Käytä Ansi-merkkijonoja"
|
|
|
|
#: lazarusidestrconsts.dlgcoasmstyle
|
|
msgid "Assembler style"
|
|
msgstr "Assembler tyyli"
|
|
|
|
#: lazarusidestrconsts.dlgcocfgcmpmessages
|
|
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
|
|
msgid "Messages"
|
|
msgstr "Viestit"
|
|
|
|
#: lazarusidestrconsts.dlgcochecksandassertion
|
|
msgid "Checks and assertion"
|
|
msgstr "Tarkistukset ja varmistukset"
|
|
|
|
#: lazarusidestrconsts.dlgcocompilercommands
|
|
msgid "Compiler Commands"
|
|
msgstr "Kääntäjän komennot"
|
|
|
|
#: lazarusidestrconsts.dlgcocops
|
|
msgid "C style operators (*=, +=, /= and -=)"
|
|
msgstr "C-tyyliset operaattorit (*=, +=, /= and -=)"
|
|
|
|
#: lazarusidestrconsts.dlgcocreatemakefile
|
|
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Luo Make-tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugging
|
|
msgid "Debugging"
|
|
msgstr "Virheenjäljitys"
|
|
|
|
#: lazarusidestrconsts.dlgcodebugpath
|
|
msgid "Debugger path addition (none):"
|
|
msgstr "Virheenjäljittimen polun lisäys (ei mitään)"
|
|
|
|
#: lazarusidestrconsts.dlgcodecreation
|
|
msgid "Code Creation"
|
|
msgstr "Koodin luonti"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenableboth
|
|
msgid "Both"
|
|
msgstr "Molemmat"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablefold
|
|
msgid "Fold"
|
|
msgstr "Laskostus"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldenablehide
|
|
msgid "Hide"
|
|
msgstr "Piilota"
|
|
|
|
#: lazarusidestrconsts.dlgcodefoldpopuporder
|
|
msgid "Reverse fold-order in Popup"
|
|
msgstr "Käänteinen laskostusjärjestys popup-valikossa"
|
|
|
|
#: lazarusidestrconsts.dlgcogdb
|
|
msgid "Generate debugging info for GDB (slower / increases exe-size)"
|
|
msgstr "Lisää virheenjäljitystieto GDB:tä varten (hitaampi/isompi exe)"
|
|
|
|
#: lazarusidestrconsts.dlgcoheaptrc
|
|
msgid "Use Heaptrc unit (check for mem-leaks)"
|
|
msgstr "Käytä Heaptrc käännösyksikköä (tarkista muistivuodot)"
|
|
|
|
#: lazarusidestrconsts.dlgcoincfiles
|
|
msgid "Include files (-Fi):"
|
|
msgstr "Include tiedostot (-Fi):"
|
|
|
|
#: lazarusidestrconsts.dlgcoinfoforgdb
|
|
msgid "Info for GDB"
|
|
msgstr "Tieto GDB:lle"
|
|
|
|
#: lazarusidestrconsts.dlgcolibraries
|
|
msgid "Libraries (-Fl):"
|
|
msgstr "Kirjastot (-Fl):"
|
|
|
|
#: lazarusidestrconsts.dlgcolinking
|
|
msgid "Linking"
|
|
msgstr "Linkitys"
|
|
|
|
#: lazarusidestrconsts.dlgcoloadsavehint
|
|
msgid "Compiler options can be saved to an XML file."
|
|
msgstr "Kääntäjän asetukset voidaan tallettaa XML tiedostoon."
|
|
|
|
#: lazarusidestrconsts.dlgcolor
|
|
msgid "Color"
|
|
msgstr "Väri"
|
|
|
|
#: lazarusidestrconsts.dlgcolorlink
|
|
msgid "(Edit Color)"
|
|
msgstr "(Muokkaa väriä)"
|
|
|
|
#: lazarusidestrconsts.dlgcolornotmodified
|
|
msgid "Not modified"
|
|
msgstr "Ei muutettu"
|
|
|
|
#: lazarusidestrconsts.dlgcolors
|
|
msgid "Colors"
|
|
msgstr "Värit"
|
|
|
|
#: lazarusidestrconsts.dlgcommandlineparams
|
|
msgid "Command line parameters (without application name)"
|
|
msgstr "Komentorivin parametrit (ilman ohjelman omaa nimeä)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxdefault
|
|
msgid "Make default indent for new line if comment opens at column:"
|
|
msgstr "Sisennä uutta riviä oletuksen mukaan jos kommentti alkaa sarakkeesta:"
|
|
|
|
#: lazarusidestrconsts.dlgcommentalignmaxtoken
|
|
msgid "Limit indent to"
|
|
msgstr "Rajoita sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinue
|
|
msgid "Prefix comments on linebreak"
|
|
msgstr "Kommentille etuliite rivinvaihdossa"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematch
|
|
msgid "Match current line"
|
|
msgstr "Kuten nykyisellä rivillä"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
|
|
msgid "Match text including \"*\" of token \"(*\""
|
|
msgstr "Täsmää teksti mukaan lukien tunnuksen \"(*\" merkki \"*\""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchline
|
|
msgid "Match whole line"
|
|
msgstr "Täsmää koko rivi"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtext
|
|
msgid "Match text after token \"%s\""
|
|
msgstr "Täsmää teksti tunnuksen \"%s\" jälkeen"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
|
|
msgid "Match text including token \"%s\""
|
|
msgstr "Täsmää teksti mukaan lukien tunnus \"%s\""
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefix
|
|
msgid "Prefix new line"
|
|
msgstr "Uudelle riville etuliite"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
|
|
msgid "Align Prefix at indent of previous line"
|
|
msgstr "Kohdista etuliite edellisen sisennyksen mukaan"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
|
|
msgid "Align Prefix below start of comment on first comment line"
|
|
msgstr "Kohdista etuliite ensimmäisen kommenttirivin mukaan"
|
|
|
|
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
|
|
msgid "Do not indent prefix"
|
|
msgstr "Älä sisennä etuliitettä"
|
|
|
|
#: lazarusidestrconsts.dlgcommentindentgroupoptions
|
|
msgid "Comments"
|
|
msgstr "Kommentit"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalways
|
|
msgid "Extend, if matched or not matched"
|
|
msgstr "Laajenna, jos täsmää tai ei täsmää"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
|
|
msgid "Extend, if matched or not matched (not at EOL)"
|
|
msgstr "Laajenna, jos täsmää tai ei täsmää (ei rivin loppu)"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatch
|
|
msgid "Extend, if matched"
|
|
msgstr "Laajenna, jos täsmää"
|
|
|
|
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
|
|
msgid "Extend, if matched and caret in the middle of text (not at EOL)"
|
|
msgstr "Laajenna, jos täsmää ja osoitin on tekstissä (ei rivin loppu)"
|
|
|
|
#: lazarusidestrconsts.dlgcompilationandlinking
|
|
msgid "Compilation and Linking"
|
|
msgstr "Käännös ja Linkitys"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessage
|
|
msgid "Compiler messages"
|
|
msgstr "Kääntäjän viestit"
|
|
|
|
#: lazarusidestrconsts.dlgcompilermessages
|
|
msgid "Compiler messages language file (*.msg)"
|
|
msgstr "Kääntäjän viestien kielitiedosto (*.msg)"
|
|
|
|
#: lazarusidestrconsts.dlgcompileroptions
|
|
msgctxt "lazarusidestrconsts.dlgcompileroptions"
|
|
msgid "Compiler Options"
|
|
msgstr "Kääntäjän asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgcompleteproperties
|
|
msgid "Complete properties"
|
|
msgstr "Täydennyksen ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
|
|
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
|
|
msgstr "Hiirikursorin alla oleva komponentti valitaan ensin, sitten popup-valikon komennot vaikuttavat siihen."
|
|
|
|
#: lazarusidestrconsts.dlgconfigandtarget
|
|
msgid "Config and Target"
|
|
msgstr "Muoto ja kohde"
|
|
|
|
#: lazarusidestrconsts.dlgconfigfiles
|
|
msgid "Config files"
|
|
msgstr "Asetustiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgcootherdebugginginfo
|
|
msgid "Other debugging info"
|
|
msgstr "Muu virheenjäljitystieto"
|
|
|
|
#: lazarusidestrconsts.dlgcooverflow
|
|
msgid "Overflow"
|
|
msgstr "Ylivuoto"
|
|
|
|
#: lazarusidestrconsts.dlgcoparsing
|
|
msgid "Parsing"
|
|
msgstr "Jäsennys"
|
|
|
|
#: lazarusidestrconsts.dlgcopypastekeepfolds
|
|
msgid "Copy/Paste with fold info"
|
|
msgstr "Kopioi/Liitä laskostustiedon kanssa"
|
|
|
|
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
|
|
msgid "Copy word on copy none"
|
|
msgstr "Kopioi sana, kun valittuna ei mitään"
|
|
|
|
#: lazarusidestrconsts.dlgcorange
|
|
msgctxt "lazarusidestrconsts.dlgcorange"
|
|
msgid "Range"
|
|
msgstr "Alue"
|
|
|
|
#: lazarusidestrconsts.dlgcorelocatable
|
|
msgid "Relocatable"
|
|
msgstr "Paikkariippumaton"
|
|
|
|
#: lazarusidestrconsts.dlgcosetasdefault
|
|
msgid "Set compiler options as default"
|
|
msgstr "Kääntäjän asetukset oletuksiksi"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowerr
|
|
msgid "Show errors"
|
|
msgstr "Näytä virheet"
|
|
|
|
#: lazarusidestrconsts.dlgcoshowoptions
|
|
msgid "&Show Options"
|
|
msgstr "&Näytä asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgcosmartlinkable
|
|
msgid "Smart linkable"
|
|
msgstr "Älykkäästi linkittyvä"
|
|
|
|
#: lazarusidestrconsts.dlgcosources
|
|
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
|
|
msgstr "Muut lähdekoodit (.pp/.pas-tiedostot, vain IDE käyttää, ei kääntäjä)"
|
|
|
|
#: lazarusidestrconsts.dlgcostack
|
|
msgid "Stack"
|
|
msgstr "Pino"
|
|
|
|
#: lazarusidestrconsts.dlgcostrip
|
|
msgid "Strip symbols from executable"
|
|
msgstr "Poista symbolit suoritettavasta ohjelmasta"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltype
|
|
msgid "Type of debug info"
|
|
msgstr "Virheenjäljitystiedon tyyppi"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypeauto
|
|
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
|
|
msgid "Automatic"
|
|
msgstr "Automaattinen"
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2
|
|
msgid "Dwarf2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
|
|
msgid "Dwarf with sets"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypedwarf3
|
|
msgid "Dwarf3 (beta)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcosymboltypestabs
|
|
msgid "Stabs"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgcotrashvariables
|
|
msgid "Trash variables"
|
|
msgstr "Sotke muuttujat"
|
|
|
|
#: lazarusidestrconsts.dlgcounitstyle
|
|
msgid "Unit style"
|
|
msgstr "Käännösyksikön tyyli"
|
|
|
|
#: lazarusidestrconsts.dlgcovalgrind
|
|
msgid "Generate code for valgrind"
|
|
msgstr "Lisää koodi valgrind:ia varten"
|
|
|
|
#: lazarusidestrconsts.dlgcoverbosity
|
|
msgid "Verbosity"
|
|
msgstr "Monisanaisuus"
|
|
|
|
#: lazarusidestrconsts.dlgcppinline
|
|
msgid "C++ styled INLINE"
|
|
msgstr "C++ -tyylinen INLINE"
|
|
|
|
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
|
|
msgid "Ctrl-middle-click on tab closes all others"
|
|
msgstr "Ctrl-keskinäppäin-klikkaus välilehdellä sulkee kaikki muut"
|
|
|
|
#: lazarusidestrconsts.dlgcurlycommenttab
|
|
msgid "Curly { }"
|
|
msgstr "Aaltosulut { }"
|
|
|
|
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
|
|
msgid "Currently respected by messages window, jump history and search results."
|
|
msgstr "Nyt käytössä viesti-ikkunassa, hyppyhistoriassa ja hakutuloksissa."
|
|
|
|
#: lazarusidestrconsts.dlgcursorbeyondeol
|
|
msgid "Cursor beyond EOL"
|
|
msgstr "Kursori yli rivin lopun"
|
|
|
|
#: lazarusidestrconsts.dlgcursorgroupoptions
|
|
msgid "Cursor"
|
|
msgstr "Kursori"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipsselection
|
|
msgid "Cursor skips selection"
|
|
msgstr "Kursori ohittaa valinnan"
|
|
|
|
#: lazarusidestrconsts.dlgcursorskipstab
|
|
msgid "Cursor skips tabs"
|
|
msgstr "Kursori ohittaa tabulaattorit"
|
|
|
|
#: lazarusidestrconsts.dlgcustomext
|
|
msgid "User defined extension (.pp.xxx)"
|
|
msgstr "Käyttäjän määrittämä tarkennin (.pp.xxx)"
|
|
|
|
#: lazarusidestrconsts.dlgdebugdesktop
|
|
msgid "debug"
|
|
msgstr "virheenjäljitys"
|
|
|
|
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
|
|
msgid "Path Editor"
|
|
msgstr "Polkujen muokkain"
|
|
|
|
#: lazarusidestrconsts.dlgdebugtype
|
|
msgid "Debugger type and path"
|
|
msgstr "Virheenjäljittimen tyyppi ja polku"
|
|
|
|
#: lazarusidestrconsts.dlgdefaulteditorfont
|
|
msgid "Default editor font"
|
|
msgstr "Editorin oletuskirjasin"
|
|
|
|
#: lazarusidestrconsts.dlgdefvaluecolor
|
|
msgid "Default Value"
|
|
msgstr "Oletusarvo"
|
|
|
|
#: lazarusidestrconsts.dlgdeltemplate
|
|
msgid "Delete template "
|
|
msgstr "Poistetaan malline "
|
|
|
|
#: lazarusidestrconsts.dlgdesktopbuttons
|
|
msgid "Buttons - "
|
|
msgstr "Napit - "
|
|
|
|
#: lazarusidestrconsts.dlgdesktophints
|
|
msgid "Hints"
|
|
msgstr "Vihjeet"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopmenus
|
|
msgid "Menus - "
|
|
msgstr "Valikot -"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopname
|
|
msgid "Desktop name"
|
|
msgstr "Työpöydän nimi"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsexported
|
|
msgid "%d desktop(s) successfully exported to \"%s\""
|
|
msgstr "%d työpöytää vietiin onnistuneesti \"%s\":hen"
|
|
|
|
#: lazarusidestrconsts.dlgdesktopsimported
|
|
msgid "%d desktop(s) successfully imported from \"%s\""
|
|
msgstr "%d työpöytää tuotiin onnistuneesti \"%s\":sta"
|
|
|
|
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
|
|
msgid "Different values background"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdirection
|
|
msgid "Direction"
|
|
msgstr "Suunta"
|
|
|
|
#: lazarusidestrconsts.dlgdisableantialiasing
|
|
msgid "Disable anti-aliasing"
|
|
msgstr "Estä anti-alias"
|
|
|
|
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
|
|
msgid "Distance between grid points is the smallest step when moving a control."
|
|
msgstr "Ristikon pisteiden etäisyys on pienin askel komponenttia siirrettäessä."
|
|
|
|
#: lazarusidestrconsts.dlgdividercolordefault
|
|
msgid "Use right margin color"
|
|
msgstr "Käytä oikean marginaalin väriä"
|
|
|
|
#: lazarusidestrconsts.dlgdividerdrawdepth
|
|
msgid "Draw divider level"
|
|
msgstr "Piirrä jakajataso"
|
|
|
|
#: lazarusidestrconsts.dlgdividernestcolor
|
|
msgid "Nested line color"
|
|
msgstr "Sisennetyn rivin väri"
|
|
|
|
#: lazarusidestrconsts.dlgdividertopcolor
|
|
msgid "Line color"
|
|
msgstr "Viivan väri"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasbeginendname
|
|
msgid "Begin/End"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasprocedurename
|
|
msgid "Procedure/Function"
|
|
msgstr "Aliohjelma/funktio"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructglobalname
|
|
msgid "Class/Struct"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasstructlocalname
|
|
msgid "Class/Struct (local)"
|
|
msgstr "Class/Struct (paikallinen)"
|
|
|
|
#: lazarusidestrconsts.dlgdivpastryname
|
|
msgid "Try/Except"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasunitsectionname
|
|
msgid "Unit sections"
|
|
msgstr "Käännösyksikön osat"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasusesname
|
|
msgid "Uses clause"
|
|
msgstr "Uses-lause"
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarglobalname
|
|
msgid "Var/Type"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgdivpasvarlocalname
|
|
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (paikallinen)"
|
|
|
|
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
|
|
msgid "Draw the component's name below it."
|
|
msgstr "Näytä nimi komponentin alla."
|
|
|
|
#: lazarusidestrconsts.dlgedback
|
|
msgid "Back"
|
|
msgstr "Takaisin"
|
|
|
|
#: lazarusidestrconsts.dlgedbold
|
|
msgid "Bold"
|
|
msgstr "Lihavoitu"
|
|
|
|
#: lazarusidestrconsts.dlgedbsubdir
|
|
msgid "Sub directory"
|
|
msgstr "Alikansio"
|
|
|
|
#: lazarusidestrconsts.dlgedcodetempl
|
|
msgctxt "lazarusidestrconsts.dlgedcodetempl"
|
|
msgid "Code Templates"
|
|
msgstr "Koodimallit"
|
|
|
|
#: lazarusidestrconsts.dlgedcompleteblocks
|
|
msgid "Add close statement for Pascal blocks"
|
|
msgstr "Sulje automaattisesti Pascal-koodilohkot"
|
|
|
|
#: lazarusidestrconsts.dlgedcustomext
|
|
msgid "User defined extension"
|
|
msgstr "Käyttäjän määrittämä tarkennin"
|
|
|
|
#: lazarusidestrconsts.dlgeddelayinsec
|
|
msgid "(%s sec delay)"
|
|
msgstr "(%s sekunnin viive)"
|
|
|
|
#: lazarusidestrconsts.dlgeddisplay
|
|
msgid "Display"
|
|
msgstr "Näkymä"
|
|
|
|
#: lazarusidestrconsts.dlgedfiles
|
|
msgid "Editor Files"
|
|
msgstr "Editorin tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgedidcomlet
|
|
msgid "Identifier completion"
|
|
msgstr "Tunnisteen täydentäminen"
|
|
|
|
#: lazarusidestrconsts.dlgedinvert
|
|
msgid "Invert"
|
|
msgstr "Käännä ympäri"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
|
|
msgid "Ignore Locks, use longest unused editor"
|
|
msgstr "Ohita lukot, käytä pisinpään käyttämättä ollutta editoria"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
|
|
msgid "Ignore Locks, if editor is current"
|
|
msgstr "Ohita lukot, jos editori on aktiivinen"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
|
|
msgid "Ignore Locks, if editor in current window"
|
|
msgstr "Ohita lukot, jos editori on aktiivinen ikkuna"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
|
|
msgid "Locked, if text in view"
|
|
msgstr "Lukittu, jos tekstiä näkyvillä"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
|
|
msgid "Unlocked"
|
|
msgstr "Ei lukittu"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
|
|
msgid "Unlocked, if text in centered view"
|
|
msgstr "Ei lukittu, jos tekstiä keskitetyssä näkymässä"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
|
|
msgid "New tab, existing or new window"
|
|
msgstr "Uusi välilehti nykyiseen tai uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
|
|
msgid "New tab in new window"
|
|
msgstr "Uusi välilehti uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
|
|
msgid "New tab in existing window"
|
|
msgstr "Uusi välilehti nykyiseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
|
|
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
|
|
msgstr "Tämä valinta käyttää pisimpään käyttämätöntä tiedoston editoria, vaikka se olisi lukittu ja/tai kaipaisi vieritystä. Pisimpään käyttämättömän editorin tunnistus ei käytä fokusointi-järjestystä, vaikka niin olisi valittu asetuksessa \"sama kriteria järjestys\". Tämä valinta onnistuu aina, muita valintoja ei testata."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
|
|
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Tämä valinta testaa onko haluttu tiedosto aktiivisessa editorissa ja käyttää sitä jos näin oli, vaikka se olisi lukittu ja/tai kaipaisi vieritystä."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
|
|
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
|
|
msgstr "Tämä valinta testaa löytyykö halutulle tiedostolle editori nykyisessä ikkunassa ja käyttää sitä jos näin oli, vaikka se olisi lukittu ja/tai kaipaisi vieritystä."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
|
|
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
|
|
msgstr "Tämä valinta käyttää lukittua (ja vain lukittua) editoria, mikä ei kaipaa vieritystä hyppykohdan näyttämiseen (hyppykohta on jo näkyvissä)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlocked
|
|
msgid "This option will use any not locked Editor."
|
|
msgstr "Tämä valinta käyttää mitä hyvänsä ei-lukittua editoria."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
|
|
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
|
|
msgstr "Tämä valinta käyttää ei-lukittua editoria, mikä ei kaipaa vieritystä hyppykohdan näyttämiseen (hyppykohta on jo näkyvissä, pois lukien 2-5 riviä ylä/alareunassa)."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
|
|
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
|
|
msgstr "Tämä valinta avaa uuden välilehden nykyisessä tai uudessa ikkunassa, jos ei-lukittua välilehteä ei löydy. Tämä valinta onnistuu aina, muita valintoja ei testata."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
|
|
msgstr "Jos ei-lukittua välilehteä ei löydy, tämä valinta avaa uuden välilehden uudessa ikkunassa (vaikka toista ikkunaa oisi voinut käyttää). Tämä valinta onnistuu aina, muita valintoja ei testata."
|
|
|
|
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
|
|
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
|
|
msgstr "Jos ei-lukittua välilehteä ei löydy, tämä valinta avaa uuden välilehden vain olemassa olevaan ikkunaan. Välilehti avataan vain jos löytyy ikkuna, missä ei jo ole editoria halutulle tiedostolle."
|
|
|
|
#: lazarusidestrconsts.dlgedital
|
|
msgid "Italic"
|
|
msgstr "Kursivoitu"
|
|
|
|
#: lazarusidestrconsts.dlgeditorfontsize
|
|
msgid "Editor font size"
|
|
msgstr "Editorin kirjasinkoko"
|
|
|
|
#: lazarusidestrconsts.dlgeditoroptions
|
|
msgctxt "lazarusidestrconsts.dlgeditoroptions"
|
|
msgid "Editor options"
|
|
msgstr "Editorin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgeditschemdefaults
|
|
msgid "Scheme globals"
|
|
msgstr "Kaavan julkiset"
|
|
|
|
#: lazarusidestrconsts.dlgedmisc
|
|
msgid "Misc"
|
|
msgstr "Lisuke"
|
|
|
|
#: lazarusidestrconsts.dlgedoff
|
|
msgid "Off"
|
|
msgstr "Pois"
|
|
|
|
#: lazarusidestrconsts.dlgedon
|
|
msgid "On"
|
|
msgstr "Päällä"
|
|
|
|
#: lazarusidestrconsts.dlgedtabindent
|
|
msgid "Tab and Indent"
|
|
msgstr "Tab ja sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgedunder
|
|
msgid "Underline"
|
|
msgstr "Alleviivaus"
|
|
|
|
#: lazarusidestrconsts.dlgelementattributes
|
|
msgid "Element Attributes"
|
|
msgstr "Elementin määrite"
|
|
|
|
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
|
|
msgid "End key jumps to nearest end"
|
|
msgstr "End-näppäin hyppää lähimpään loppuun"
|
|
|
|
#: lazarusidestrconsts.dlgenvask
|
|
msgid "Ask"
|
|
msgstr "Kysy"
|
|
|
|
#: lazarusidestrconsts.dlgenvbackuphelpnote
|
|
msgid "Notes: Project files are all files in the project directory"
|
|
msgstr "Huomaa: Projektin tiedostoja ovat kaikki tiedostot projektikansiossa"
|
|
|
|
#: lazarusidestrconsts.dlgenvbckup
|
|
msgid "Backup"
|
|
msgstr "Varmistus"
|
|
|
|
#: lazarusidestrconsts.dlgenvfiles
|
|
msgid "Files"
|
|
msgstr "Tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgenvgrid
|
|
msgid "Grid"
|
|
msgstr "Ristikko"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguage
|
|
msgctxt "lazarusidestrconsts.dlgenvlanguage"
|
|
msgid "Language"
|
|
msgstr "Kieli"
|
|
|
|
#: lazarusidestrconsts.dlgenvlanguagehint
|
|
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
|
|
msgstr "Kaikkien IDE:n tekstien kieli. Käynnistä IDE uudelleen kielen vaihtamisen jälkeen."
|
|
|
|
#: lazarusidestrconsts.dlgenvlguidelines
|
|
msgid "Guide lines"
|
|
msgstr "Kohdistusviivat"
|
|
|
|
#: lazarusidestrconsts.dlgenvmisc
|
|
msgctxt "lazarusidestrconsts.dlgenvmisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Sekalaiset"
|
|
|
|
#: lazarusidestrconsts.dlgenvnone
|
|
msgctxt "lazarusidestrconsts.dlgenvnone"
|
|
msgid "None"
|
|
msgstr "Ei yhtään"
|
|
|
|
#: lazarusidestrconsts.dlgenvotherfiles
|
|
msgid "Other Files"
|
|
msgstr "Muut tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgenvproject
|
|
msgid "Tabs for project"
|
|
msgstr "Projektin välilehdet"
|
|
|
|
#: lazarusidestrconsts.dlgenvtype
|
|
msgctxt "lazarusidestrconsts.dlgenvtype"
|
|
msgid "Type"
|
|
msgstr "Tyyppi"
|
|
|
|
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
|
|
msgid "Focus messages at compilation"
|
|
msgstr "Fokusoi viesti-ikkuna käännettäessä"
|
|
|
|
#: lazarusidestrconsts.dlgextracharspacing
|
|
msgid "Extra char spacing"
|
|
msgstr "Merkkien välistys"
|
|
|
|
#: lazarusidestrconsts.dlgextralinespacing
|
|
msgid "Extra line spacing"
|
|
msgstr "Rivien välistys"
|
|
|
|
#: lazarusidestrconsts.dlgextsymb
|
|
msgid "Use external gdb debug symbols file"
|
|
msgstr "Käytä ulkoista gdb-symbolitiedostoa"
|
|
|
|
#: lazarusidestrconsts.dlgfileexts
|
|
msgid "File extensions"
|
|
msgstr "Tiedostopäätteet"
|
|
|
|
#: lazarusidestrconsts.dlgfiles
|
|
msgid "%s files"
|
|
msgstr "%s tiedostoa"
|
|
|
|
#: lazarusidestrconsts.dlgfilterall
|
|
msgid "All files"
|
|
msgstr "Kaikki tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
|
|
msgid "CodeTools template file"
|
|
msgstr "CodeTools-mallinetiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdcifile
|
|
msgid "DCI file"
|
|
msgstr "DCI tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiform
|
|
msgid "Delphi form"
|
|
msgstr "Delphi lomake"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphipackage
|
|
msgid "Delphi package"
|
|
msgstr "Delphi-paketti"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiproject
|
|
msgid "Delphi project"
|
|
msgstr "Delphi-projekti"
|
|
|
|
#: lazarusidestrconsts.dlgfilterdelphiunit
|
|
msgid "Delphi unit"
|
|
msgstr "Delphi-käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.dlgfilterexecutable
|
|
msgid "Executable"
|
|
msgstr "Suoritettava ohjelma"
|
|
|
|
#: lazarusidestrconsts.dlgfilterfpcmessagefile
|
|
msgid "FPC message file"
|
|
msgstr "FPC viestitiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterhtml
|
|
msgid "HTML files"
|
|
msgstr "HTML tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagesbitmap
|
|
msgid "Bitmap images"
|
|
msgstr "Bitmap kuvat"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespixmap
|
|
msgid "Pixmap images"
|
|
msgstr "Pixmap kuvat"
|
|
|
|
#: lazarusidestrconsts.dlgfilterimagespng
|
|
msgid "PNG images"
|
|
msgstr "PNG kuvat"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
|
|
msgid "Lazarus Desktop Settings"
|
|
msgstr "Lazaruksen työpöytäasetukset"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
|
|
msgid "Editor file types"
|
|
msgstr "Editorin tiedostojen tyypit"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusfile
|
|
msgid "Lazarus file"
|
|
msgstr "Lazarus-tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusform
|
|
msgid "Lazarus form"
|
|
msgstr "Lazarus-lomake"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusinclude
|
|
msgid "Lazarus include file"
|
|
msgstr "Lazarus include-tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusotherfile
|
|
msgid "Lazarus other file"
|
|
msgstr "Lazarus muu tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazaruspackage
|
|
msgid "Lazarus package"
|
|
msgstr "Lazarus-paketti"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusproject
|
|
msgid "Lazarus project"
|
|
msgstr "Lazarus-projekti"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
|
|
msgid "Lazarus project source"
|
|
msgstr "Lazarus-projektin lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarussession
|
|
msgid "Lazarus session"
|
|
msgstr "Lazarus istunto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterlazarusunit
|
|
msgid "Lazarus unit"
|
|
msgstr "Lazarus-käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.dlgfilterpascalfile
|
|
msgid "Pascal file"
|
|
msgstr "Pascal-tiedosto"
|
|
|
|
#: lazarusidestrconsts.dlgfilterprograms
|
|
msgid "Programs"
|
|
msgstr "Ohjelmat"
|
|
|
|
#: lazarusidestrconsts.dlgfilterxml
|
|
msgid "XML files"
|
|
msgstr "XML-tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgfindtextatcursor
|
|
msgid "Find text at cursor"
|
|
msgstr "Etsi tekstiä kursorin kohdalta"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunk
|
|
msgid "Chunk"
|
|
msgstr "Möhkäle"
|
|
|
|
#: lazarusidestrconsts.dlgfolddiffchunksect
|
|
msgid "Chunk section"
|
|
msgstr "Möhkäleosa"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlasp
|
|
msgid "ASP"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentti"
|
|
|
|
#: lazarusidestrconsts.dlgfoldhtmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
|
|
msgid "Node"
|
|
msgstr "Solmu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmitem
|
|
msgid "Item"
|
|
msgstr "Osa"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmlist
|
|
msgid "List <>"
|
|
msgstr "Luettelo <>"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlfmobject
|
|
msgid "Object (inherited, inline)"
|
|
msgstr "Objekti (periytynyt, inline)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldlocalpasvartype
|
|
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
|
|
msgid "Var/Type (local)"
|
|
msgstr "Var/Type (paikallinen)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasansicomment
|
|
msgid "Comment (* *)"
|
|
msgstr "Kommentti (* *)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasasm
|
|
msgid "Asm"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasbeginend
|
|
msgid "Begin/End (nested)"
|
|
msgstr "Begin/End (sisäkkäinen)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasborcomment
|
|
msgid "Comment { }"
|
|
msgstr "Kommentti { }"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpascase
|
|
msgid "Case"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclass
|
|
msgid "Class/Object"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasclasssection
|
|
msgid "public/private"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasexcept
|
|
msgid "Except/Finally"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasfordo
|
|
msgid "For/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifdef
|
|
msgid "{$IfDef}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasifthen
|
|
msgid "If/Then/Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasnestedcomment
|
|
msgid "Nested Comment"
|
|
msgstr "Sisäkkäinen kommentti"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocbeginend
|
|
msgid "Begin/End (procedure)"
|
|
msgstr "Begin/End (aliohjelma)"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprocedure
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Aliohjelma"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasprogram
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
|
|
msgid "Program"
|
|
msgstr "Ohjelma"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrecord
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
|
|
msgid "Record"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasrepeat
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
|
|
msgid "Repeat"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasslashcomment
|
|
msgid "Comment //"
|
|
msgstr "Kommentti //"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpastry
|
|
msgid "Try"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunit
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
|
|
msgid "Unit"
|
|
msgstr "Käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasunitsection
|
|
msgid "Unit section"
|
|
msgstr "Käännösyksikön osa"
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuserregion
|
|
msgid "{%Region}"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasuses
|
|
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpasvartype
|
|
msgid "Var/Type (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswhiledo
|
|
msgid "While/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldpaswithdo
|
|
msgid "With/Do"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcdata
|
|
msgid "CData"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlcomment
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
|
|
msgid "Comment"
|
|
msgstr "Kommentti"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmldoctype
|
|
msgid "DocType"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlnode
|
|
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
|
|
msgid "Node"
|
|
msgstr "Solmu"
|
|
|
|
#: lazarusidestrconsts.dlgfoldxmlprocess
|
|
msgid "Processing Instruction"
|
|
msgstr "Toimintaohjeet"
|
|
|
|
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
|
|
msgid "The running Lazarus instance cannot accept any files."
|
|
msgstr "Käynnissä oleva Lazarus ei huoli tiedostoja."
|
|
|
|
#: lazarusidestrconsts.dlgforecolor
|
|
msgid "Foreground"
|
|
msgstr "Edusta"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
|
|
msgid "Change Object Inspector contents on clicking form title bar"
|
|
msgstr "Muuta komponenttimuokkaimen sisältö kun otsikkopalkkia klikataan"
|
|
|
|
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
|
|
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
|
|
msgstr "Näytä lomakkeen ominaisuudet komponenttimuokkaimessa klikkaamalla otsikkopalkkia."
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
|
|
msgid "Procedure insert policy"
|
|
msgstr "Aliohjelman lisäyskäytäntö"
|
|
|
|
#: lazarusidestrconsts.dlgforwardprocskeeporder
|
|
msgid "Keep order of procedures"
|
|
msgstr "Säilytä aliohjelmien järjestys"
|
|
|
|
#: lazarusidestrconsts.dlgfpcexecutable
|
|
msgid "Compiler executable (e.g. %s)"
|
|
msgstr "Suoritettava kääntäjä (esim. %s)"
|
|
|
|
#: lazarusidestrconsts.dlgfpcsrcpath
|
|
msgid "FPC source directory"
|
|
msgstr "FPC:n lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.dlgframecolor
|
|
msgid "Text-mark"
|
|
msgstr "Tekstimerkki"
|
|
|
|
#: lazarusidestrconsts.dlgfrmeditor
|
|
msgid "Form Editor"
|
|
msgstr "Lomake-editori"
|
|
|
|
#: lazarusidestrconsts.dlgfrombeginning
|
|
msgid "From b&eginning"
|
|
msgstr "&Alusta"
|
|
|
|
#: lazarusidestrconsts.dlgfromcursor
|
|
msgid "&From cursor"
|
|
msgstr "&Kursorin kohdasta"
|
|
|
|
#: lazarusidestrconsts.dlggetposition
|
|
msgid "Get position"
|
|
msgstr "Hae sijainti"
|
|
|
|
#: lazarusidestrconsts.dlgglobal
|
|
msgid "&Global"
|
|
msgstr "&Julkinen"
|
|
|
|
#: lazarusidestrconsts.dlggprof
|
|
msgid "Generate code for gprof"
|
|
msgstr "Generoi koodi gprof:ia varten"
|
|
|
|
#: lazarusidestrconsts.dlggrabbercolor
|
|
msgid "Grabber color"
|
|
msgstr "Tarttujan väri"
|
|
|
|
#: lazarusidestrconsts.dlggrayeddesktopsundocked
|
|
msgid "Grayed desktops are for undocked environment."
|
|
msgstr "Harmaat työpöydät eivät käytä telakoitua ympäristöä."
|
|
|
|
#: lazarusidestrconsts.dlggridcolor
|
|
msgid "Grid color"
|
|
msgstr "Ristikon väri"
|
|
|
|
#: lazarusidestrconsts.dlggridconsistsofsmalldots
|
|
msgid "Grid consists of small dots which help aligning controls."
|
|
msgstr "Ristikko koostuu pienistä pisteistä, mitkä helpottavat komponenttien asemointia."
|
|
|
|
#: lazarusidestrconsts.dlggridx
|
|
msgid "Grid size X"
|
|
msgstr "Ristikon väli X"
|
|
|
|
#: lazarusidestrconsts.dlggridxhint
|
|
msgid "Horizontal grid step size"
|
|
msgstr "Ristikon askelväli vaakasuunnassa"
|
|
|
|
#: lazarusidestrconsts.dlggridy
|
|
msgid "Grid size Y"
|
|
msgstr "Ristikon väli Y"
|
|
|
|
#: lazarusidestrconsts.dlggridyhint
|
|
msgid "Vertical grid step size"
|
|
msgstr "Ristikon askelväli pystysuunnassa"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodeexplorer
|
|
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Koodin tutkija"
|
|
|
|
#: lazarusidestrconsts.dlggroupcodetools
|
|
msgid "Codetools"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlggroupdebugger
|
|
msgctxt "lazarusidestrconsts.dlggroupdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.dlggroupeditor
|
|
msgid "Editor"
|
|
msgstr "Editori"
|
|
|
|
#: lazarusidestrconsts.dlggroupenvironment
|
|
msgctxt "lazarusidestrconsts.dlggroupenvironment"
|
|
msgid "Environment"
|
|
msgstr "Käyttöympäristö"
|
|
|
|
#: lazarusidestrconsts.dlggroupundo
|
|
msgid "Group Undo"
|
|
msgstr "Kumoa ryhmänä"
|
|
|
|
#: lazarusidestrconsts.dlgguidelines
|
|
msgid "Show Guide Lines"
|
|
msgstr "Näytä kohdistusviivat"
|
|
|
|
#: lazarusidestrconsts.dlgguidelineshint
|
|
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
|
|
msgstr "Kun komponentti on vaaka- tai pystysuoraan linjassa toisen komponentin kanssa, näytetään sininen kohdistusviiva."
|
|
|
|
#: lazarusidestrconsts.dlggutter
|
|
msgctxt "lazarusidestrconsts.dlggutter"
|
|
msgid "Gutter"
|
|
msgstr "Reunapalkki"
|
|
|
|
#: lazarusidestrconsts.dlgguttercollapsedcolor
|
|
msgid "Collapsed"
|
|
msgstr "Supistettu"
|
|
|
|
#: lazarusidestrconsts.dlgguttercolor
|
|
msgid "Gutter Color"
|
|
msgstr "Reunapalkin väri"
|
|
|
|
#: lazarusidestrconsts.dlggutteredgecolor
|
|
msgid "Gutter Edge Color"
|
|
msgstr "Reunapalkin reunan väri"
|
|
|
|
#: lazarusidestrconsts.dlggutterseparatorindex
|
|
msgid "Gutter separator index"
|
|
msgstr "Reunapalkin erottimen indeksi"
|
|
|
|
#: lazarusidestrconsts.dlghalfpagescroll
|
|
msgid "Half page scroll"
|
|
msgstr "Puolen sivun vieritys"
|
|
|
|
#: lazarusidestrconsts.dlgheapandstacksize
|
|
msgid "Heap and stack sizes"
|
|
msgstr "Keon ja pinon koot"
|
|
|
|
#: lazarusidestrconsts.dlgheapsize
|
|
msgid "Heap size"
|
|
msgstr "Keon koko"
|
|
|
|
#: lazarusidestrconsts.dlgheightofonepropertyingrid
|
|
msgid "Height of one property in the grid."
|
|
msgstr "Taulukon yhden ominaisuuden korkeus."
|
|
|
|
#: lazarusidestrconsts.dlgheightpos
|
|
msgid "Height:"
|
|
msgstr "Korkeus:"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrun
|
|
msgid "Hide IDE windows on run"
|
|
msgstr "Piilota IDEn ikkunat ohjelmaa suoritettaessa"
|
|
|
|
#: lazarusidestrconsts.dlghideideonrunhint
|
|
msgid "Do not show the IDE at all while program is running."
|
|
msgstr "Älä näytä IDE:ä lainkaan kun ohjelma on käynnissä."
|
|
|
|
#: lazarusidestrconsts.dlghidesingletabinnotebook
|
|
msgid "Hide tab in single page windows"
|
|
msgstr "Piilota välilehti yksisivuisista ikkunoista"
|
|
|
|
#: lazarusidestrconsts.dlghighlightcolor
|
|
msgid "Highlight Color"
|
|
msgstr "Korostusväri"
|
|
|
|
#: lazarusidestrconsts.dlghighlightfontcolor
|
|
msgid "Highlight Font Color"
|
|
msgstr "Korostuksen fontin väri"
|
|
|
|
#: lazarusidestrconsts.dlghighlightleftofcursor
|
|
msgid "Left Of Cursor"
|
|
msgstr "Vasemmalla kursorista"
|
|
|
|
#: lazarusidestrconsts.dlghighlightrightofcursor
|
|
msgid "Right Of Cursor"
|
|
msgstr "Oikealla kursorista"
|
|
|
|
#: lazarusidestrconsts.dlghintsparametersendernotused
|
|
msgid "Show hints for parameter \"Sender\" not used"
|
|
msgstr "Näytä vihjeet käyttämättömästä \"Sender\" parametrista"
|
|
|
|
#: lazarusidestrconsts.dlghintsunused
|
|
msgid "Show hints for unused units in main"
|
|
msgstr "Näytä vihjeet käyttämättömästä käännösyksiköstä"
|
|
|
|
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
|
|
msgid "Home key jumps to nearest start"
|
|
msgstr "Home-näppäin sisentää mentäessä rivin alkuun"
|
|
|
|
#: lazarusidestrconsts.dlghostapplication
|
|
msgid "Host application"
|
|
msgstr "Isäntäsovellus"
|
|
|
|
#: lazarusidestrconsts.dlgidentifiercompletion
|
|
msgid "Identifier Completion"
|
|
msgstr "Tunnisteen täydentäminen"
|
|
|
|
#: lazarusidestrconsts.dlgidentifierpolicy
|
|
msgid "Identifier policy"
|
|
msgstr "Tunnistekäytäntö"
|
|
|
|
#: lazarusidestrconsts.dlgideoptions
|
|
msgid "IDE Options"
|
|
msgstr "IDEn asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockactive
|
|
msgid "Active $IFDEF code"
|
|
msgstr "Aktiivinen $IFDEF koodi"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblockinactive
|
|
msgid "Inactive $IFDEF code"
|
|
msgstr "Passiivinen $IFDEF koodi"
|
|
|
|
#: lazarusidestrconsts.dlgifdefblocktmpactive
|
|
msgid "Included mixed state $IFDEF code"
|
|
msgstr "Luettu sekoitettua $IFDEF koodia"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeactive
|
|
msgid "Active $IFDEF node"
|
|
msgstr "Aktiivinen $IFDEF solmu"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodeinactive
|
|
msgid "Inactive $IFDEF node"
|
|
msgstr "Passiivinen $IFDEF solmu"
|
|
|
|
#: lazarusidestrconsts.dlgifdefnodetmpactive
|
|
msgid "Included mixed state $IFDEF node"
|
|
msgstr "Luettu sekoitettua $IFDEF koodia"
|
|
|
|
#: lazarusidestrconsts.dlgimportdesktopexists
|
|
msgid ""
|
|
"A desktop with the same name already exists.\n"
|
|
"Please confirm the desktop name:\n"
|
|
msgstr ""
|
|
"Samanniminen työpöytä on jo olemassa.\n"
|
|
"Vahvista työpöydän nimi:\n"
|
|
|
|
#: lazarusidestrconsts.dlgincludesystemvariables
|
|
msgid "Include system variables"
|
|
msgstr "Ota järjestelmän muuttujat mukaan"
|
|
|
|
#: lazarusidestrconsts.dlgindentsindentgroupoptions
|
|
msgid "Indent"
|
|
msgstr "Sisennys"
|
|
|
|
#: lazarusidestrconsts.dlgindentstabsgroupoptions
|
|
msgid "Tabs"
|
|
msgstr "Tabulaattorit"
|
|
|
|
#: lazarusidestrconsts.dlginfrontofmethods
|
|
msgid "In front of methods"
|
|
msgstr "Metodien edellä"
|
|
|
|
#: lazarusidestrconsts.dlginitdoneonly
|
|
msgid "Constructor name must be 'init' (destructor must be 'done')"
|
|
msgstr "Constructor-nimen täytyy olla 'init' (destructor täytyy olla 'done')"
|
|
|
|
#: lazarusidestrconsts.dlginsertclassparts
|
|
msgid "Insert class parts"
|
|
msgstr "Lisää luokan osat"
|
|
|
|
#: lazarusidestrconsts.dlginsertimplementation
|
|
msgid "Implementation"
|
|
msgstr "Toteutus"
|
|
|
|
#: lazarusidestrconsts.dlginsertinterface
|
|
msgid "Interface"
|
|
msgstr "Rajapinta"
|
|
|
|
#: lazarusidestrconsts.dlginsertmethods
|
|
msgid "Insert method implementations"
|
|
msgstr "Lisää metodien toteutus"
|
|
|
|
#: lazarusidestrconsts.dlginsertsection
|
|
msgid "Insert into Uses section of"
|
|
msgstr "Lisää uses-lauseeseen: "
|
|
|
|
#: lazarusidestrconsts.dlginsspaceafter
|
|
msgid "Insert space after"
|
|
msgstr "Välilyönti seuraavien jälkeen"
|
|
|
|
#: lazarusidestrconsts.dlginsspacefront
|
|
msgid "Insert space in front of"
|
|
msgstr "Välilyönti ennen seuraavia"
|
|
|
|
#: lazarusidestrconsts.dlgintvinsec
|
|
msgid "Interval in secs"
|
|
msgstr "Aika sekunteina"
|
|
|
|
#: lazarusidestrconsts.dlgjumpingetc
|
|
msgid "Jumping (e.g. Method Jumping)"
|
|
msgstr "Hyppely (esim. metodeihin)"
|
|
|
|
#: lazarusidestrconsts.dlgjumptomethodbody
|
|
msgid "Jump directly to method body"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgkeepcursorx
|
|
msgid "Keep cursor X position"
|
|
msgstr "Säilytä kursorin X-koordinaatti"
|
|
|
|
#: lazarusidestrconsts.dlgkeylink
|
|
msgid "(Edit Key)"
|
|
msgstr "(Muokkaa näppäimiä)"
|
|
|
|
#: lazarusidestrconsts.dlgkeymapping
|
|
msgid "Key Mappings"
|
|
msgstr "Näppäinkomennot"
|
|
|
|
#: lazarusidestrconsts.dlgkeymappingerrors
|
|
msgid "Key mapping errors"
|
|
msgstr "Näppäinkartan virheet"
|
|
|
|
#: lazarusidestrconsts.dlgkeywordpolicy
|
|
msgid "Keyword policy"
|
|
msgstr "Avainsanakäytäntö"
|
|
|
|
#: lazarusidestrconsts.dlglabelgoto
|
|
msgid "Allow LABEL and GOTO"
|
|
msgstr "Salli LABEL ja GOTO"
|
|
|
|
#: lazarusidestrconsts.dlglang
|
|
msgctxt "lazarusidestrconsts.dlglang"
|
|
msgid "Language"
|
|
msgstr "Kieli"
|
|
|
|
#: lazarusidestrconsts.dlglast
|
|
msgid "Last (i.e. at end of source)"
|
|
msgstr "Viimeinen (esim. lähdekoodin lopussa)"
|
|
|
|
#: lazarusidestrconsts.dlglazarusdir
|
|
msgid "Lazarus directory (default for all projects)"
|
|
msgstr "Lazaruksen kansio (oletus kaikille projekteille)"
|
|
|
|
#: lazarusidestrconsts.dlgleftpos
|
|
msgid "Left:"
|
|
msgstr "Vasemmalta:"
|
|
|
|
#: lazarusidestrconsts.dlglefttopclr
|
|
msgid "Guide lines Left,Top"
|
|
msgstr "Ohjausviivat vasemmalla ja ylhäällä"
|
|
|
|
#: lazarusidestrconsts.dlglevel1opt
|
|
msgid "1 (quick, debugger friendly)"
|
|
msgstr "1 (nopea ja helppo virheenjäljittimelle)"
|
|
|
|
#: lazarusidestrconsts.dlglevel2opt
|
|
msgid "2 (-O1 + quick optimizations)"
|
|
msgstr "2 (-O1 + nopeita optimointeja)"
|
|
|
|
#: lazarusidestrconsts.dlglevel3opt
|
|
msgid "3 (-O2 + slow optimizations)"
|
|
msgstr "3 (-O2 + hitaita optimointeja)"
|
|
|
|
#: lazarusidestrconsts.dlglevel4opt
|
|
msgid "4 (-O3 + aggressive optimizations, beware)"
|
|
msgstr "4 (-O3 + rajuja optimointeja, varo)"
|
|
|
|
#: lazarusidestrconsts.dlglevelnoneopt
|
|
msgid "0 (no optimization)"
|
|
msgstr "0 (ei optimointia)"
|
|
|
|
#: lazarusidestrconsts.dlglinesplitting
|
|
msgid "Line Splitting"
|
|
msgstr "Rivin katkaisu"
|
|
|
|
#: lazarusidestrconsts.dlglinksmart
|
|
msgid "Link smart"
|
|
msgstr "Linkitä älykkäästi"
|
|
|
|
#: lazarusidestrconsts.dlglnumsbct
|
|
msgid "Display line numbers in run-time error backtraces"
|
|
msgstr "Näytä rivinumerot ajonaikaisissa virhelistauksissa"
|
|
|
|
#: lazarusidestrconsts.dlgmainmenu
|
|
msgid "Main Menu"
|
|
msgstr "Päävalikko"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewforms
|
|
msgid "View Project Forms"
|
|
msgstr "Näytä projektin lomakkeet"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewframes
|
|
msgid "View Project Frames"
|
|
msgstr "Näytä projektin kehykset"
|
|
|
|
#: lazarusidestrconsts.dlgmainviewunits
|
|
msgid "View Project Units"
|
|
msgstr "Näytä projektin käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.dlgmakeexecutable
|
|
msgid "\"Make\" executable"
|
|
msgstr "\"Make\" ohjelma"
|
|
|
|
#: lazarusidestrconsts.dlgmanagedesktops
|
|
msgid "Manage desktops"
|
|
msgstr "Hallinnoi työpöytiä"
|
|
|
|
#: lazarusidestrconsts.dlgmargingutter
|
|
msgid "Margin and gutter"
|
|
msgstr "Marginaali ja reunapalkki"
|
|
|
|
#: lazarusidestrconsts.dlgmarkercolor
|
|
msgid "Marker color"
|
|
msgstr "Merkattu väri"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupgroup
|
|
msgid "Highlight of Word under Caret"
|
|
msgstr "Tekstikursorin kohdalla olevan sanan korostus"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupoutline
|
|
msgid "Outline (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefined
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
|
|
msgid "User defined markup"
|
|
msgstr "Käyttäjän määrittämä merkintä"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
|
|
msgid "Delete"
|
|
msgstr "Poista"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
|
|
msgid "Delete list \"%s\"?"
|
|
msgstr "Poista luettelo \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
|
|
msgid "Add Word or Term"
|
|
msgstr "Lisää sana tai termi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
|
|
msgid "Remove Word or Term"
|
|
msgstr "Poista sana tai termi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
|
|
msgid "Toggle Word or Term"
|
|
msgstr "Vaihda sana tai termi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
|
|
msgid "Duplicate Term"
|
|
msgstr "Päällekkäinen termi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
|
|
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
|
|
msgstr "Termi %s on jo olemassa. Päällekkäisyydet poistetaan, kun luettelo tallennetaan."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
|
|
msgid "Add/Remove in all editors"
|
|
msgstr "Lisää/poista kaikissa editoreissa"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
|
|
msgid "Delete list"
|
|
msgstr "Tuhoa luettelo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
|
|
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
|
|
msgid "Name"
|
|
msgstr "Nimi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
|
|
msgid "Add list"
|
|
msgstr "Lisää luettelo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
|
|
msgid "Case sensitive"
|
|
msgstr "Sama kirjainkoko"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
|
|
msgid "Set bound at term end"
|
|
msgstr "Aseta raja termin loppuun"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
|
|
msgid "Set bound at term start"
|
|
msgstr "Aseta raja termin alkuun"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
|
|
msgid "Ignore bounds for terms longer than"
|
|
msgstr "Ohita rajat termille pitempi kuin"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
|
|
msgid "selection"
|
|
msgstr "Valinta"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
|
|
msgid "current word"
|
|
msgstr "nykyinen sana"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
|
|
msgid "Settings for terms added by key"
|
|
msgstr "Näppäimen asettaman termin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
|
|
msgid "Smart match selection bounds"
|
|
msgstr "Käsittele valinnan rajoja älykkäästi"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
|
|
msgid "New list"
|
|
msgstr "Uusi luettelo"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
|
|
msgid "No lists"
|
|
msgstr "Ei luetteloa"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
|
|
msgid "Select ..."
|
|
msgstr "Valitse ..."
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
|
|
msgid "Key Settings"
|
|
msgstr "Näppäinasetukset"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
|
|
msgid "Main settings"
|
|
msgstr "Pääasetukset"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordbracket
|
|
msgid "Word Brackets on caret (global)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordfulllen
|
|
msgid "Match word boundaries for words up to this length:"
|
|
msgstr "Käytä sanan rajoja tähän pituuteen saakka:"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnokeyword
|
|
msgid "Ignore keywords"
|
|
msgstr "Ohita avainsanat"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordnotimer
|
|
msgid "Disable timer for markup current word"
|
|
msgstr "Älä käytä ajastinta aktiivista sanaa merkittäessä"
|
|
|
|
#: lazarusidestrconsts.dlgmarkupwordtrim
|
|
msgid "Trim spaces (when highlighting current selection)"
|
|
msgstr "Karsi välilyönnit (kun korostetaan valinta)"
|
|
|
|
#: lazarusidestrconsts.dlgmaxcntr
|
|
msgid "Maximum counter"
|
|
msgstr "Suurin laskijanumero"
|
|
|
|
#: lazarusidestrconsts.dlgmaxlinelength
|
|
msgid "Max line length:"
|
|
msgstr "Suurin rivinpituus:"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentfiles
|
|
msgid "Max recent files"
|
|
msgstr "Tiedostoja muistetaan"
|
|
|
|
#: lazarusidestrconsts.dlgmaxrecentprojs
|
|
msgid "Max recent project files"
|
|
msgstr "Projekteja muistetaan"
|
|
|
|
#: lazarusidestrconsts.dlgmixmethodsandproperties
|
|
msgid "Mix methods and properties"
|
|
msgstr "Sekoita metodeja ja ominaisuuksia"
|
|
|
|
#: lazarusidestrconsts.dlgmouseaction
|
|
msgid "Mouse Action"
|
|
msgstr "Hiiritoiminto"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
|
|
msgid "Single"
|
|
msgstr "Yksittäinen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
|
|
msgid "Double"
|
|
msgstr "Kaksois"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn3
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
|
|
msgid "Triple"
|
|
msgstr "Kolmois"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtn4
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
|
|
msgid "Quad"
|
|
msgstr "Nelois"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnany
|
|
msgid "Any"
|
|
msgstr "Mikä vaan"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra1
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
|
|
msgid "Extra 1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnextra2
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
|
|
msgid "Extra 2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnleft
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
|
|
msgid "Left"
|
|
msgstr "Vasen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
|
|
msgid "Middle"
|
|
msgstr "Keskimmäinen"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
|
|
msgid "Make Fallback"
|
|
msgstr "Tee varasuunnitelma"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnright
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
|
|
msgid "Right"
|
|
msgstr "Oikea"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
|
|
msgid "Wheel down"
|
|
msgstr "Rulla alas"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
|
|
msgid "Wheel up"
|
|
msgstr "Rulla ylös"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcapture
|
|
msgid "Capture"
|
|
msgstr "Sieppaa"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcaretmove
|
|
msgid "Move Caret (extra)"
|
|
msgstr "Siirrä tekstikursoria (extra)"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptcheckupdown
|
|
msgid "Act on Mouse up"
|
|
msgstr "Toimi nostettaessa hiiren nappi"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescaction
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
|
|
msgid "Action"
|
|
msgstr "Toiminta"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdescbutton
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
|
|
msgid "Click"
|
|
msgstr "Klikkaus"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptdlgtitle
|
|
msgid "Edit Mouse"
|
|
msgstr "Muokkaa hiirtä"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrordup
|
|
msgid "Duplicate Entry"
|
|
msgstr "Päällekkäinen syöte"
|
|
|
|
#: lazarusidestrconsts.dlgmouseopterrorduptext
|
|
msgid "This entry conflicts with an existing entry"
|
|
msgstr "Tämä syöte on ristiriidassa toisen syötteen kanssa"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
|
|
msgid "Alt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadbtn
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
|
|
msgid "Button"
|
|
msgstr "Nappi"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcaret
|
|
msgid "Caret"
|
|
msgstr "Osoitin"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcontext
|
|
msgid "Context"
|
|
msgstr "Asiayhteys"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadcount
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
|
|
msgid "Click"
|
|
msgstr "Klikkaus"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
|
|
msgid "Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddesc
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
|
|
msgid "Action"
|
|
msgstr "Toiminta"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheaddir
|
|
msgid "Up/Down"
|
|
msgstr "Ylös/Alas"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadopt
|
|
msgid "Option"
|
|
msgstr "Asetus"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadorder
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
|
|
msgid "Order"
|
|
msgstr "Järjestys"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadpriority
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
|
|
msgid "Priority"
|
|
msgstr "Tärkeys"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptheadshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
|
|
msgid "Shift"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptions
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptions"
|
|
msgid "Mouse"
|
|
msgstr "Hiiri"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsadv
|
|
msgid "Advanced"
|
|
msgstr "Edistynyt"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptionsyncommand
|
|
msgid "IDE-Command"
|
|
msgstr "IDEn komento"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodalt
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
|
|
msgid "Alt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodctrl
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
|
|
msgid "Ctrl"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
|
|
msgid "n"
|
|
msgstr "e"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
|
|
msgid "-"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
|
|
msgid "Y"
|
|
msgstr "K"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmodshift
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
|
|
msgid "Shift"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
|
|
msgid "Y"
|
|
msgstr "K"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeall
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
|
|
msgid "All"
|
|
msgstr "Kaikki"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutter
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
|
|
msgid "Gutter"
|
|
msgstr "Reunapalkki"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
|
|
msgid "Line Changes"
|
|
msgstr "Rivimuutokset"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
|
|
msgid "Fold Tree"
|
|
msgstr "Laskosta puu"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
|
|
msgid "Collapsed [+]"
|
|
msgstr "Supistettu [+]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
|
|
msgid "Expanded [-]"
|
|
msgstr "Laajennettu [-]"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
|
|
msgid "Overview"
|
|
msgstr "Yleiskuva"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
|
|
msgid "Overview Mark"
|
|
msgstr "Yleiskuva merkki"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
|
|
msgid "Line Numbers"
|
|
msgstr "Rivinumerot"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodemain
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
|
|
msgid "Text"
|
|
msgstr "Teksti"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptnodeselect
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
|
|
msgid "Selection"
|
|
msgstr "Valinta"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptopt2label
|
|
msgid "Opt"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheract
|
|
msgid "Other actions using the same button"
|
|
msgstr "Muut toiminnot jotka käyttävät samaa nappia"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracthint
|
|
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
|
|
msgstr "Ne voidaan suorittaa riippuen muuntonäppäimestä, sijais-asetuksista, yksittäis/tupla, ylös/alas ..."
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
|
|
msgid "Filter Mod-Keys"
|
|
msgstr "Suodin muuntonapit"
|
|
|
|
#: lazarusidestrconsts.dlgmouseoptpriorlabel
|
|
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
|
|
msgid "Priority"
|
|
msgstr "Ensisijaisuus"
|
|
|
|
#: lazarusidestrconsts.dlgmsgs
|
|
msgctxt "lazarusidestrconsts.dlgmsgs"
|
|
msgid "Messages"
|
|
msgstr "Viestit"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
|
|
msgid "Debug"
|
|
msgstr "Virheenjäljitys"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
|
|
msgid "Error"
|
|
msgstr "Virhe"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
|
|
msgid "Fatal"
|
|
msgstr "Tuhoisa"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
|
|
msgid "Hint"
|
|
msgstr "Vihje"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
|
|
msgid "Important"
|
|
msgstr "Tärkeä"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
|
|
msgid "Normal"
|
|
msgstr "Normaali"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
|
|
msgid "Note"
|
|
msgstr "Huom."
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
|
|
msgid "Panic"
|
|
msgstr "Paniikki"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
|
|
msgid "Time and statistics"
|
|
msgstr "Aika ja tilastot"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
|
|
msgid "Verbose"
|
|
msgstr "Monisanainen"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
|
|
msgid "Verbose 2"
|
|
msgstr "Monisanainen 2"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
|
|
msgid "Verbose 3"
|
|
msgstr "Monisanainen 3"
|
|
|
|
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
|
|
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
|
|
msgid "Warning"
|
|
msgstr "Varoitus"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretcolumnmode
|
|
msgid "Multi-caret (column-select) move with cursor"
|
|
msgstr "Moni-osoitin (sarakevalinta) siirrä kursorin mukana"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretmode
|
|
msgid "Multi-caret move with cursor"
|
|
msgstr "Moni-osoitin siirrä kursorin mukana"
|
|
|
|
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
|
|
msgid "Enable multi caret for column selection"
|
|
msgstr "Salli moni-osoitin sarakevalintaan"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances
|
|
msgid "Multiple Lazarus instances"
|
|
msgstr "Useita Lazarus instansseja"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
|
|
msgid "always start a new instance"
|
|
msgstr "käynnistä aina uusi instanssi"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
|
|
msgid "do not allow multiple instances"
|
|
msgstr "älä salli useita instansseja"
|
|
|
|
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
|
|
msgid "open files in a running instance"
|
|
msgstr "avaa tiedostot käynnissä olevassa instanssissa"
|
|
|
|
#: lazarusidestrconsts.dlgmultiselect
|
|
msgid "Multi Select"
|
|
msgstr "Monivalinta"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessgroup
|
|
msgid "Find Editor for Jump Targets"
|
|
msgstr "Etsi hyppykohteen editori"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorder
|
|
msgid "Order to use for editors matching the same criteria"
|
|
msgstr "Järjestys editoreille, jotka täyttävät saman ehdon"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
|
|
msgid "Most recent focused editor for this file"
|
|
msgstr "Tämän tiedoston viimeisin aktiivinen editori"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
|
|
msgid "Editor (for file) in most recent focused window"
|
|
msgstr "Editori (tiedostolle) viimeisessä valitussa ikkunassa"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinaccesstype
|
|
msgid "Priority list of criteria to choose an editor:"
|
|
msgstr "Tärkeysjärjestys ehdoille editorin valitsemiseksi:"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwinoptions
|
|
msgid "Pages and Windows"
|
|
msgstr "Välilehdet ja ikkunat"
|
|
|
|
#: lazarusidestrconsts.dlgmultiwintabgroup
|
|
msgid "Notebook Tabs"
|
|
msgstr "Editorin välilehdet"
|
|
|
|
#: lazarusidestrconsts.dlgnaming
|
|
msgid "Naming"
|
|
msgstr "Nimeäminen"
|
|
|
|
#: lazarusidestrconsts.dlgnewdesktop
|
|
msgid "New desktop ..."
|
|
msgstr "Uusi työpöytä ..."
|
|
|
|
#: lazarusidestrconsts.dlgnoautomaticrenaming
|
|
msgid "No automatic renaming"
|
|
msgstr "Ei automaattista nimeämistä"
|
|
|
|
#: lazarusidestrconsts.dlgnoavailableunits
|
|
msgid "No available units to add."
|
|
msgstr "Ei ole lisättäviä käännösyksiköitä."
|
|
|
|
#: lazarusidestrconsts.dlgnobrackethighlight
|
|
msgid "No Highlight"
|
|
msgstr "Ei korostusta"
|
|
|
|
#: lazarusidestrconsts.dlgnotebooktabpos
|
|
msgid "Source notebook tabs position"
|
|
msgstr "Lähdekoodieditorin välilehtien paikka"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlineafter
|
|
msgid "Do not split line after"
|
|
msgstr "Rivi ei katkea, kun sitä edeltää"
|
|
|
|
#: lazarusidestrconsts.dlgnotsplitlinefront
|
|
msgid "Do not split line in front of"
|
|
msgstr "Rivi ei katkea, kun sitä seuraa"
|
|
|
|
#: lazarusidestrconsts.dlgobjinsp
|
|
msgctxt "lazarusidestrconsts.dlgobjinsp"
|
|
msgid "Object Inspector"
|
|
msgstr "Komponenttimuokkain"
|
|
|
|
#: lazarusidestrconsts.dlgoiitemheight
|
|
#, fuzzy
|
|
#| msgid "Item height"
|
|
msgid "Item height (0 = auto)"
|
|
msgstr "Rivin korkeus"
|
|
|
|
#: lazarusidestrconsts.dlgoimiscellaneous
|
|
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Sekalaiset"
|
|
|
|
#: lazarusidestrconsts.dlgoispeedsettings
|
|
msgid "Speed settings"
|
|
msgstr "Nopeusasetukset"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
|
|
msgid "Use default Delphi settings"
|
|
msgstr "Käytä Delphin oletusasetuksia"
|
|
|
|
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
|
|
msgid "Use default Lazarus settings"
|
|
msgstr "Käytä Lazaruksen oletusasetuksia"
|
|
|
|
#: lazarusidestrconsts.dlgoptimizationlevels
|
|
msgid "Optimization levels"
|
|
msgstr "Optimointitasot"
|
|
|
|
#: lazarusidestrconsts.dlgotheroptimizations
|
|
msgid "Other optimizations"
|
|
msgstr "Muut optimoinnit"
|
|
|
|
#: lazarusidestrconsts.dlgotherunitfiles
|
|
msgid "Other unit files (-Fu):"
|
|
msgstr "Muut käännösyksiköt (-Fu):"
|
|
|
|
#: lazarusidestrconsts.dlgoverwriteblock
|
|
msgid "Overwrite block"
|
|
msgstr "Ylikirjoita lohko"
|
|
|
|
#: lazarusidestrconsts.dlgoverwritedesktop
|
|
msgid ""
|
|
"Desktop with the name \"%s\" was found.\n"
|
|
"Should the old desktop be overwritten?\n"
|
|
msgstr ""
|
|
"Löytyi työpöytä nimellä \"%s\".\n"
|
|
"Korvataanko vanha työpöytä?\n"
|
|
|
|
#: lazarusidestrconsts.dlgpalhints
|
|
msgid "Hints for component palette"
|
|
msgstr "Vihjetekstit komponenttipaletille"
|
|
|
|
#: lazarusidestrconsts.dlgpasext
|
|
msgid "Default Pascal extension"
|
|
msgstr "Pascalin tiedostopäätteen oletus"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywords
|
|
msgid "Highlight control statements as keywords"
|
|
msgstr "Korosta ohjauskäskyt avainsanoina"
|
|
|
|
#: lazarusidestrconsts.dlgpasextkeywordsgroup
|
|
msgid "Extended Pascal Keyword Options"
|
|
msgstr "Laajennetut Pascalin avainsanojen asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmarkup
|
|
msgid "Markup (on caret)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsmatches
|
|
msgid "Matching Keywords"
|
|
msgstr "Täsmäävät avainsanat"
|
|
|
|
#: lazarusidestrconsts.dlgpaskeywordsoutline
|
|
msgid "Outline"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpassoptslinker
|
|
msgid "Pass options to linker with \"-k\", delimiter is space"
|
|
msgstr "Välitä asetukset linkittäjälle \"-k\" optiolla, erota välilyönnillä"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywords
|
|
msgid "Highlight \"String\" keyword(s)"
|
|
msgstr "Korosta \"String\" avainsana(t)"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
|
|
msgid "Default"
|
|
msgstr "Oletus"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
|
|
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
|
|
msgid "None"
|
|
msgstr "Ei yhtään"
|
|
|
|
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
|
|
msgid "Only \"String\""
|
|
msgstr "Vain \"String\""
|
|
|
|
#: lazarusidestrconsts.dlgpersistentblock
|
|
msgid "Persistent block"
|
|
msgstr "Pysyvä lohko"
|
|
|
|
#: lazarusidestrconsts.dlgpersistentcursor
|
|
msgid "Persistent cursor"
|
|
msgstr "Pysyvä kursori"
|
|
|
|
#: lazarusidestrconsts.dlgpoapplication
|
|
msgid "Application"
|
|
msgstr "Sovellus"
|
|
|
|
#: lazarusidestrconsts.dlgpoasinvoker
|
|
msgid "as invoker (asInvoker)"
|
|
msgstr "kuten käynnistäjällä (asInvoker)"
|
|
|
|
#: lazarusidestrconsts.dlgpoclearicon
|
|
msgid "&Clear Icon"
|
|
msgstr "&Poista kuvake"
|
|
|
|
#: lazarusidestrconsts.dlgpocreateappbundle
|
|
msgid "Create Application Bundle"
|
|
msgstr "Tee \"Application Bundle\""
|
|
|
|
#: lazarusidestrconsts.dlgpodefaulticon
|
|
msgid "Load &Default"
|
|
msgstr "Lataa &oletus"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawareness
|
|
msgid "DPI awareness"
|
|
msgstr "DPI tietoisuus"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoff
|
|
msgid "off"
|
|
msgstr "pois"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
|
|
msgid "Vista-8: off, 8.1+: per monitor"
|
|
msgstr "Vista-8: pois, 8.1+: per monitori"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
|
|
msgid "Vista-8: on, 8.1+: per monitor"
|
|
msgstr "Vista-8: päällä, 8.1+: per monitori"
|
|
|
|
#: lazarusidestrconsts.dlgpodpiawarenesson
|
|
msgid "on"
|
|
msgstr "päällä"
|
|
|
|
#: lazarusidestrconsts.dlgpoexecutionlevel
|
|
msgid "Execution Level"
|
|
msgstr "Suoritustaso"
|
|
|
|
#: lazarusidestrconsts.dlgpofroms
|
|
msgid "Forms"
|
|
msgstr "Lomakkeet"
|
|
|
|
#: lazarusidestrconsts.dlgpohighestavailable
|
|
msgid "highest available (highestAvailable)"
|
|
msgstr "korkein saatavilla (highestAvailable)"
|
|
|
|
#: lazarusidestrconsts.dlgpoi18n
|
|
msgid "i18n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpoicon
|
|
msgid "Icon:"
|
|
msgstr "Kuvake:"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondesc
|
|
msgid "(size: %d:%d, bpp: %d)"
|
|
msgstr "(koko: %d:%d, bpp: %d)"
|
|
|
|
#: lazarusidestrconsts.dlgpoicondescnone
|
|
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
|
|
msgid "(none)"
|
|
msgstr "(ei mitään)"
|
|
|
|
#: lazarusidestrconsts.dlgpoloadicon
|
|
msgid "&Load Icon"
|
|
msgstr "&Lataa kuvake"
|
|
|
|
#: lazarusidestrconsts.dlgpomisc
|
|
msgctxt "lazarusidestrconsts.dlgpomisc"
|
|
msgid "Miscellaneous"
|
|
msgstr "Sekalaiset"
|
|
|
|
#: lazarusidestrconsts.dlgporequireadministrator
|
|
msgid "require administrator (requireAdministrator)"
|
|
msgstr "tarvitsee admin-oikeudet (requireAdministrator)"
|
|
|
|
#: lazarusidestrconsts.dlgporesources
|
|
msgid "Resources"
|
|
msgstr "Resurssit"
|
|
|
|
#: lazarusidestrconsts.dlgposaveicon
|
|
msgid "&Save Icon"
|
|
msgstr "&Tallenna kuvake"
|
|
|
|
#: lazarusidestrconsts.dlgposavesession
|
|
msgid "Session"
|
|
msgstr "Istunto"
|
|
|
|
#: lazarusidestrconsts.dlgpotitle
|
|
msgid "Title:"
|
|
msgstr "Nimi:"
|
|
|
|
#: lazarusidestrconsts.dlgpouiaccess
|
|
msgid "UI Access (uiAccess)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpouseappbundle
|
|
msgid "Use Application Bundle for running and debugging"
|
|
msgstr "Käytä \"Application Bundle\" ajoon ja virheiden jäljitykseen"
|
|
|
|
#: lazarusidestrconsts.dlgpouselclscaling
|
|
msgid "Use LCL scaling (Hi-DPI)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.dlgpousemanifest
|
|
msgid "Use manifest resource (and enable themes)"
|
|
msgstr "Käytä manifest-tiedostoa (ja salli teemat)"
|
|
|
|
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
|
|
msgid "Prefer double-click over single-click"
|
|
msgstr "Käytä mieluummin kaksois- kuin yhtä klikkausta"
|
|
|
|
#: lazarusidestrconsts.dlgpriorities
|
|
msgid "Priorities"
|
|
msgstr "Tärkeydet"
|
|
|
|
#: lazarusidestrconsts.dlgproject
|
|
msgctxt "lazarusidestrconsts.dlgproject"
|
|
msgid "Project"
|
|
msgstr "Projekti"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptions
|
|
msgid "Project Options"
|
|
msgstr "Projektin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgprojectoptionsfor
|
|
msgid "Options for Project: %s"
|
|
msgstr "Projektin %s asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgprojfiles
|
|
msgid "Project Files"
|
|
msgstr "Projektin tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgpromptonreplace
|
|
msgid "&Prompt on replace"
|
|
msgstr "&Vahvista muutokset"
|
|
|
|
#: lazarusidestrconsts.dlgpropertycompletion
|
|
msgid "Property completion"
|
|
msgstr "Ominaisuuksien täydennys"
|
|
|
|
#: lazarusidestrconsts.dlgpropnamecolor
|
|
msgid "Property Name"
|
|
msgstr "Ominaisuuden nimi"
|
|
|
|
#: lazarusidestrconsts.dlgqopenlastprj
|
|
msgid "Open last project and packages at start"
|
|
msgstr "Avaa viime projektit ja paketit alussa"
|
|
|
|
#: lazarusidestrconsts.dlgqshowborderspacing
|
|
msgid "Show border spacing"
|
|
msgstr "Näytä reuna-alue"
|
|
|
|
#: lazarusidestrconsts.dlgqshowgrid
|
|
msgid "Show grid"
|
|
msgstr "Näytä ristikko"
|
|
|
|
#: lazarusidestrconsts.dlgqsnaptogrid
|
|
msgid "Snap to grid"
|
|
msgstr "Asemoi ristikon avulla"
|
|
|
|
#: lazarusidestrconsts.dlgreallydeletedesktop
|
|
msgid "Really delete desktop \"%s\"?"
|
|
msgstr "Poistetaanko työpöytä \"%s\" todella?"
|
|
|
|
#: lazarusidestrconsts.dlgreferencecolor
|
|
msgid "Reference"
|
|
msgstr "Viittaus"
|
|
|
|
#: lazarusidestrconsts.dlgregularexpressions
|
|
msgid "Regular e&xpressions"
|
|
msgstr "&Säännölliset lausekkeet"
|
|
|
|
#: lazarusidestrconsts.dlgrenamedesktop
|
|
msgid "Rename desktop"
|
|
msgstr "Nimeä työpöytä"
|
|
|
|
#: lazarusidestrconsts.dlgreplaceall
|
|
msgid "Replace &All"
|
|
msgstr "Korvaa &kaikki"
|
|
|
|
#: lazarusidestrconsts.dlgreplacewith
|
|
msgid "&Replace with"
|
|
msgstr "&Korvaava"
|
|
|
|
#: lazarusidestrconsts.dlgreport
|
|
msgid "Report"
|
|
msgstr "Raportti"
|
|
|
|
#: lazarusidestrconsts.dlgrightbottomclr
|
|
msgid "Guide lines Right,Bottom"
|
|
msgstr "Ohjausviivat oikealla ja alhaalla"
|
|
|
|
#: lazarusidestrconsts.dlgrightclickselects
|
|
msgid "Right click selects"
|
|
msgstr "Valinta hiiren oikealla napilla"
|
|
|
|
#: lazarusidestrconsts.dlgrightmargin
|
|
msgid "Right margin"
|
|
msgstr "Oikea marginaali"
|
|
|
|
#: lazarusidestrconsts.dlgroworkingdirectory
|
|
msgid "Working directory"
|
|
msgstr "Työhakemisto"
|
|
|
|
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
|
|
msgid "Select grandchildren"
|
|
msgstr "Valitse lapsenlapset"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandcreationcolor
|
|
msgid "Rubberband Creation"
|
|
msgstr "Kuminauhojen luonti"
|
|
|
|
#: lazarusidestrconsts.dlgruberbandselectioncolor
|
|
msgid "Rubberband Selection"
|
|
msgstr "Kuminauhojen valinta"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancemodalerror
|
|
msgid ""
|
|
"The running Lazarus instance cannot accept any files.\n"
|
|
"Do you want to open them in a new IDE instance?\n"
|
|
"\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Käynnissä oleva Lazarus ei huoli tiedostoja.\n"
|
|
"Haluatko avata ne uudessa instanssissa?\n"
|
|
"\n"
|
|
"%s\n"
|
|
|
|
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
|
|
msgid "Lazarus instance is running but not responding."
|
|
msgstr "Lazarus instanssi on käynnissä muttei vastaa."
|
|
|
|
#: lazarusidestrconsts.dlgrunodisplay
|
|
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
msgstr "Näyttö (ei win32:lle, esim. 198.112.45.11:0, x.org:1, hydra:0.1)"
|
|
|
|
#: lazarusidestrconsts.dlgrunoenvironment
|
|
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
|
|
msgid "Environment"
|
|
msgstr "Käyttöympäristö"
|
|
|
|
#: lazarusidestrconsts.dlgrunolocal
|
|
msgid "Local"
|
|
msgstr "Paikallinen"
|
|
|
|
#: lazarusidestrconsts.dlgrunosystemvariables
|
|
msgid "System variables"
|
|
msgstr "Järjestelmän muuttujat"
|
|
|
|
#: lazarusidestrconsts.dlgrunousedisplay
|
|
msgid "Use display"
|
|
msgstr "Käytä näyttöä"
|
|
|
|
#: lazarusidestrconsts.dlgrunouseroverrides
|
|
msgid "User overrides"
|
|
msgstr "Käyttäjän määrittelemät"
|
|
|
|
#: lazarusidestrconsts.dlgrunparameters
|
|
msgid "Run Parameters"
|
|
msgstr "Suoritusparametrit"
|
|
|
|
#: lazarusidestrconsts.dlgsavecurrentdesktopas
|
|
msgid "Save current desktop as"
|
|
msgstr "Tallenna nykyinen työpöytä nimellä"
|
|
|
|
#: lazarusidestrconsts.dlgsavedlinecolor
|
|
msgid "Saved line"
|
|
msgstr "Tallennettu rivi"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfo
|
|
msgid "Save editor info for closed files"
|
|
msgstr "Tallenna editorin tiedot suljetusta tiedostosta"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfohint
|
|
msgid "The files are available in the \"Open Recent\" history list."
|
|
msgstr "Tiedostot löytyvät \"Avaa esillä ollut\" historialuettelosta."
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoproject
|
|
msgid "Save editor info only for project files"
|
|
msgstr "Tallenna editorin tiedot vain projektin tiedostoista"
|
|
|
|
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
|
|
msgid "Only files that belong to this project."
|
|
msgstr "Vain tähän projektiin kuuluvat tiedostot."
|
|
|
|
#: lazarusidestrconsts.dlgscrollbyoneless
|
|
msgid "Scroll by one less"
|
|
msgstr "Vieritä yksi vähemmän"
|
|
|
|
#: lazarusidestrconsts.dlgscrollgroupoptions
|
|
msgid "Scrolling"
|
|
msgstr "Vieritys"
|
|
|
|
#: lazarusidestrconsts.dlgscrollhint
|
|
msgctxt "lazarusidestrconsts.dlgscrollhint"
|
|
msgid "Show scroll hint"
|
|
msgstr "Näytä vieritysvihjeet"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendfile
|
|
msgid "Scroll past end of file"
|
|
msgstr "Vieritä tiedostoa sen lopun yli"
|
|
|
|
#: lazarusidestrconsts.dlgscrollpastendline
|
|
msgid "Caret past end of line"
|
|
msgstr "Kursori liikkuu yli rivin lopun"
|
|
|
|
#: lazarusidestrconsts.dlgseachdirectorynotfound
|
|
msgid "Search directory \"%s\" not found."
|
|
msgstr "Etsittävää hakemistoa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.dlgsearchabort
|
|
msgid "Search terminated by user."
|
|
msgstr "Käyttäjä keskeytti etsinnän"
|
|
|
|
#: lazarusidestrconsts.dlgsearchcaption
|
|
msgid "Searching ..."
|
|
msgstr "Etsitään ..."
|
|
|
|
#: lazarusidestrconsts.dlgsearchpaths
|
|
msgid "Paths"
|
|
msgstr "Hakupolut"
|
|
|
|
#: lazarusidestrconsts.dlgsearchscope
|
|
msgid "Search scope"
|
|
msgstr "Etsinnän ulottuvuus"
|
|
|
|
#: lazarusidestrconsts.dlgselectallchildcontrols
|
|
msgid "Select all child controls together with their parent."
|
|
msgstr "Valitse kaikki lapsikontrollit emokontrollin kanssa."
|
|
|
|
#: lazarusidestrconsts.dlgselectedtext
|
|
msgid "&Selected text"
|
|
msgstr "&Valittu teksti"
|
|
|
|
#: lazarusidestrconsts.dlgsetactivedesktop
|
|
msgid "Set active"
|
|
msgstr "Aseta aktiiviseksi"
|
|
|
|
#: lazarusidestrconsts.dlgsetallelementdefault
|
|
msgid "Set all elements to default"
|
|
msgstr "Aseta kaikki elementit oletusarvoon"
|
|
|
|
#: lazarusidestrconsts.dlgsetelementdefault
|
|
msgid "Set element to default"
|
|
msgstr "Aseta elementti oletusarvoon"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariable
|
|
msgid "Set property Variable"
|
|
msgstr "Muuttuja ominaisuuden asettajassa"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariablehint
|
|
msgid "The parameter name for the default setter procedure."
|
|
msgstr "Oletus asettaja-aliohjelman parametrin nimi."
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
|
|
msgid "is prefix"
|
|
msgstr "on etuliite"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
|
|
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
|
|
msgstr "Kun valittu, \"Muuttuja ominaisuuden asettajassa\" on etuliite. Muuten se on kiinteä nimi."
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
|
|
msgid "use const"
|
|
msgstr "käytä const"
|
|
|
|
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
|
|
msgid "If checked, the setter parameter is marked with \"const\"."
|
|
msgstr "Kun valittu, asettajan parametriin lisätään \"const\"."
|
|
|
|
#: lazarusidestrconsts.dlgshowallunits
|
|
msgid "Show all units"
|
|
msgstr "Näytä kaikki käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
|
|
msgid "Show captions of non-visual components"
|
|
msgstr "Näytä ei-näkyvien komponenttien otsikko"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompiledprocedures
|
|
msgid "Show compiled procedures"
|
|
msgstr "Näytä käännetyt aliohjelmat"
|
|
|
|
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Näytä rivinumerot"
|
|
|
|
#: lazarusidestrconsts.dlgshowconditionals
|
|
msgid "Show conditionals"
|
|
msgstr "Näytä ehdolliset"
|
|
|
|
#: lazarusidestrconsts.dlgshowdebuginfo
|
|
msgid "Show debug info"
|
|
msgstr "Näytä virheenjäljitystieto"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhints
|
|
msgid "Show designer hints"
|
|
msgstr "Näytä lomake-editorin vihjeet"
|
|
|
|
#: lazarusidestrconsts.dlgshowdesignerhintshint
|
|
msgid "Hint shows control's position or size while moving or resizing it."
|
|
msgstr "Kun kontrollia liikutetaan tai sen kokoa muutetaan, vihje näyttää sen sijainnin tai koon."
|
|
|
|
#: lazarusidestrconsts.dlgshoweverything
|
|
msgid "Show everything"
|
|
msgstr "Näytä kaikki (hidas)"
|
|
|
|
#: lazarusidestrconsts.dlgshowexecutableinfo
|
|
msgid "Show executable info (Win32 only)"
|
|
msgstr "Näytä ohjelman tiedot (vain Win32)"
|
|
|
|
#: lazarusidestrconsts.dlgshowfilenameincaption
|
|
msgid "Show file name in caption"
|
|
msgstr "Näytä tiedoston nimi otsikossa"
|
|
|
|
#: lazarusidestrconsts.dlgshowgeneralinfo
|
|
msgid "Show general info"
|
|
msgstr "Näytä yleistä tietoa"
|
|
|
|
#: lazarusidestrconsts.dlgshowgutterhints
|
|
msgid "Show gutter hints"
|
|
msgstr "Näytä reunapalkin vihjeet"
|
|
|
|
#: lazarusidestrconsts.dlgshowhint
|
|
msgctxt "lazarusidestrconsts.dlgshowhint"
|
|
msgid "Show hints"
|
|
msgstr "Näytä vihjeet"
|
|
|
|
#: lazarusidestrconsts.dlgshowingwindows
|
|
msgid "Showing Windows"
|
|
msgstr "Näytetään ikkunoita"
|
|
|
|
#: lazarusidestrconsts.dlgshowlinenumbers
|
|
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
|
|
msgid "Show line numbers"
|
|
msgstr "Näytä rivinumerot"
|
|
|
|
#: lazarusidestrconsts.dlgshowmessagesicons
|
|
msgid "Show Messages Icons"
|
|
msgstr "Näytä viestien kuvakkeet"
|
|
|
|
#: lazarusidestrconsts.dlgshownotes
|
|
msgid "Show notes"
|
|
msgstr "Näytä muistutukset"
|
|
|
|
#: lazarusidestrconsts.dlgshowsummary
|
|
msgid "Show summary"
|
|
msgstr "Näytä yhteenveto"
|
|
|
|
#: lazarusidestrconsts.dlgshowtriedfiles
|
|
msgid "Show tried files"
|
|
msgstr "Näytä kokeillut tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgshowusedfiles
|
|
msgid "Show used files"
|
|
msgstr "Näytä käytetyt tiedostot"
|
|
|
|
#: lazarusidestrconsts.dlgshowwarnings
|
|
msgid "Show warnings"
|
|
msgstr "Näytä varoitukset"
|
|
|
|
#: lazarusidestrconsts.dlgsingletaskbarbutton
|
|
msgid "Show single button in TaskBar"
|
|
msgstr "Näytä yksi nappi tehtäväpalkissa"
|
|
|
|
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
|
|
msgid "Skip forward class declarations"
|
|
msgstr "Ohita luokkien etukäteen esittely"
|
|
|
|
#: lazarusidestrconsts.dlgslashcommenttab
|
|
msgid "Slash //"
|
|
msgstr "Kauttaviiva //"
|
|
|
|
#: lazarusidestrconsts.dlgsmarttabs
|
|
msgid "Smart tabs"
|
|
msgstr "Älykäs tabulointi"
|
|
|
|
#: lazarusidestrconsts.dlgsmbbehind
|
|
msgid "Symbol behind (.pp~)"
|
|
msgstr "Symboli perään (.pp~)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbcounter
|
|
msgid "Counter (.pp;1)"
|
|
msgstr "Laskijanumero (.pp;1)"
|
|
|
|
#: lazarusidestrconsts.dlgsmbfront
|
|
msgid "Symbol in front (.~pp)"
|
|
msgstr "Symboli eteen (.~pp)"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelines
|
|
msgid "Snap to Guide Lines"
|
|
msgstr "Kiinnity kohdistusviivojen avulla"
|
|
|
|
#: lazarusidestrconsts.dlgsnapguidelineshint
|
|
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
|
|
msgstr "Kun kontrolli on melkein linjassa toisen kontrollin kanssa, se napsahtaa samaan linjaan."
|
|
|
|
#: lazarusidestrconsts.dlgsourceedittabmultiline
|
|
msgid "Multiline tabs"
|
|
msgstr "Moniriviset tabit"
|
|
|
|
#: lazarusidestrconsts.dlgspacenotcosmos
|
|
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
|
|
msgid "Space"
|
|
msgstr "Välilyönnit"
|
|
|
|
#: lazarusidestrconsts.dlgspbhints
|
|
msgid "Hints for main speed buttons (open, save, ...)"
|
|
msgstr "Vihjetekstit työkalupainikkeille"
|
|
|
|
#: lazarusidestrconsts.dlgsrcedit
|
|
msgctxt "lazarusidestrconsts.dlgsrcedit"
|
|
msgid "Source Editor"
|
|
msgstr "Lähdekoodieditori"
|
|
|
|
#: lazarusidestrconsts.dlgsrorigin
|
|
msgid "Origin"
|
|
msgstr "Lähtöpiste"
|
|
|
|
#: lazarusidestrconsts.dlgstacksize
|
|
msgid "Stack size"
|
|
msgstr "Pinon koko"
|
|
|
|
#: lazarusidestrconsts.dlgstatickeyword
|
|
msgid "Static keyword in objects"
|
|
msgstr "Static avainsana objekteissa"
|
|
|
|
#: lazarusidestrconsts.dlgstopafternrerr
|
|
msgid "Stop after number of errors:"
|
|
msgstr "Pysäytä virhemäärän jälkeen:"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoappend
|
|
msgid "Append text to close string"
|
|
msgstr "Lisää teksti merkkijonon loppuun"
|
|
|
|
#: lazarusidestrconsts.dlgstringautoprefix
|
|
msgid "Prefix string on new line"
|
|
msgstr "Lisää merkkijonoon etuliite uudella rivillä"
|
|
|
|
#: lazarusidestrconsts.dlgstringbreakindenttab
|
|
msgid "String ''"
|
|
msgstr "Merkkijono ''"
|
|
|
|
#: lazarusidestrconsts.dlgstringenableautocontinue
|
|
msgid "Extend strings on linebreak"
|
|
msgstr "Laajenna merkkijonot rivinvaihdossa"
|
|
|
|
#: lazarusidestrconsts.dlgsubpropcolor
|
|
msgid "SubProperties"
|
|
msgstr "Aliominaisuudet"
|
|
|
|
#: lazarusidestrconsts.dlgsyntaxoptions
|
|
msgid "Syntax options"
|
|
msgstr "Kieliopin asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgtabindent
|
|
msgid "Tab indents blocks"
|
|
msgstr "Tabulaattori sisentää lohkoa"
|
|
|
|
#: lazarusidestrconsts.dlgtabnumbersnotebook
|
|
msgid "Show tab numbers in notebook"
|
|
msgstr "Näytä välilehtien numerot editorissa"
|
|
|
|
#: lazarusidestrconsts.dlgtabstospaces
|
|
msgid "Tabs to spaces"
|
|
msgstr "Tabuloinnit välilyönneiksi"
|
|
|
|
#: lazarusidestrconsts.dlgtabwidths
|
|
msgctxt "lazarusidestrconsts.dlgtabwidths"
|
|
msgid "Tab widths"
|
|
msgstr "Tabuloinnin leveydet"
|
|
|
|
#: lazarusidestrconsts.dlgtargetcpufamily
|
|
msgid "Target CPU family"
|
|
msgstr "CPU-perhe"
|
|
|
|
#: lazarusidestrconsts.dlgtargetos
|
|
msgctxt "lazarusidestrconsts.dlgtargetos"
|
|
msgid "Target OS"
|
|
msgstr "Kohdekäyttöjärjestelmä"
|
|
|
|
#: lazarusidestrconsts.dlgtargetplatform
|
|
msgid "Target platform"
|
|
msgstr "Kohdealusta"
|
|
|
|
#: lazarusidestrconsts.dlgtargetproc
|
|
msgid "Target processor"
|
|
msgstr "Prosessori"
|
|
|
|
#: lazarusidestrconsts.dlgtargetspecificoptions
|
|
msgid "Target-specific options"
|
|
msgstr "Kohderiippuvaiset asetukset"
|
|
|
|
#: lazarusidestrconsts.dlgtestprjdir
|
|
msgid "Directory for building test projects"
|
|
msgstr "Kansio testiprojektien kokoamiseen"
|
|
|
|
#: lazarusidestrconsts.dlgtexttofind
|
|
msgid "&Text to find"
|
|
msgstr "&Etsittävä"
|
|
|
|
#: lazarusidestrconsts.dlgtoggledebugdesktop
|
|
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
|
|
msgid "Toggle as debug desktop"
|
|
msgstr "Vaihda debug-työpöydäksi"
|
|
|
|
#: lazarusidestrconsts.dlgtopinfohint
|
|
msgid "Current Class/Proc Hint"
|
|
msgstr "Nykyisen luokan/metodin vihje"
|
|
|
|
#: lazarusidestrconsts.dlgtoppos
|
|
msgid "Top:"
|
|
msgstr "Ylhäältä:"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaption
|
|
msgid "Trim spaces style"
|
|
msgstr "Välilyöntien siistimistyyli"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
|
|
msgid "Caret or Edit"
|
|
msgstr "Osoitin tekstin päällä"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeeditline
|
|
msgid "Line Edited"
|
|
msgstr "Riviä muokattu"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
|
|
msgid "Leave line"
|
|
msgstr "Jätetään rivi"
|
|
|
|
#: lazarusidestrconsts.dlgtrimspacetypeposonly
|
|
msgid "Position Only"
|
|
msgstr "Vain sijainti"
|
|
|
|
#: lazarusidestrconsts.dlgtrimtrailingspaces
|
|
msgid "Trim trailing spaces"
|
|
msgstr "Poista välilyönnit rivin lopusta"
|
|
|
|
#: lazarusidestrconsts.dlgundoaftersave
|
|
msgid "Undo after save"
|
|
msgstr "Kumoa talletuksen jälkeen"
|
|
|
|
#: lazarusidestrconsts.dlgundogroupoptions
|
|
msgid "Undo / Redo"
|
|
msgstr "Kumoa / Tee uudelleen"
|
|
|
|
#: lazarusidestrconsts.dlgundolimit
|
|
msgid "Undo limit"
|
|
msgstr "Kumoamisen rajat"
|
|
|
|
#: lazarusidestrconsts.dlgunitdepcaption
|
|
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Käännösyksikön riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.dlgunitdeprefresh
|
|
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
|
|
msgid "Refresh"
|
|
msgstr "Päivitä"
|
|
|
|
#: lazarusidestrconsts.dlgunitoutp
|
|
msgid "Unit output directory (-FU):"
|
|
msgstr "Käännöshakemisto (-FU):"
|
|
|
|
#: lazarusidestrconsts.dlgunsavedlinecolor
|
|
msgid "Unsaved line"
|
|
msgstr "Tallentamaton rivi"
|
|
|
|
#: lazarusidestrconsts.dlgusecodefolding
|
|
msgid "Code Folding"
|
|
msgstr "Koodin laskostus"
|
|
|
|
#: lazarusidestrconsts.dlgusecustomconfig
|
|
msgid "Use additional compiler config file"
|
|
msgstr "Käytä ylimääräisiä kääntäjän asetuksia"
|
|
|
|
#: lazarusidestrconsts.dlgusedividerdraw
|
|
msgid "Divider Drawing"
|
|
msgstr "Jakajan piirto"
|
|
|
|
#: lazarusidestrconsts.dlgusefpccfg
|
|
msgid "Use standard compiler config file (fpc.cfg)"
|
|
msgstr "Käytä standardia kääntäjän asetustiedostoa (fpc.cfg)"
|
|
|
|
#: lazarusidestrconsts.dlguselaunchingapp
|
|
msgid "Use launching application"
|
|
msgstr "Käytä käynnistävää ohjelmaa"
|
|
|
|
#: lazarusidestrconsts.dlguseminimumime
|
|
msgid "IME handled by System"
|
|
msgstr "Järjestelmän hoitama IME"
|
|
|
|
#: lazarusidestrconsts.dlguserschemeerror
|
|
msgid "Failed to load user-scheme file %s"
|
|
msgstr "Käyttäjän kaavan %s lataaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.dlguseschemedefaults
|
|
msgid "Use (and edit) global scheme settings"
|
|
msgstr "Käytä (ja muokkaa) julkista kaavaa"
|
|
|
|
#: lazarusidestrconsts.dlguseschemelocal
|
|
msgid "Use local scheme settings"
|
|
msgstr "Käytä paikallista kaavaa"
|
|
|
|
#: lazarusidestrconsts.dlgusesyntaxhighlight
|
|
msgid "Use syntax highlight"
|
|
msgstr "Käytä kieliopin korostusta"
|
|
|
|
#: lazarusidestrconsts.dlgusetabshistory
|
|
msgid "Use tab history when closing tabs"
|
|
msgstr "Käytä välilehden historiaa suljettaessa"
|
|
|
|
#: lazarusidestrconsts.dlguseunitcaption
|
|
msgid "Add unit to Uses section"
|
|
msgstr "Lisää käännösyksikkö Uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.dlgvaluecolor
|
|
msgctxt "lazarusidestrconsts.dlgvaluecolor"
|
|
msgid "Value"
|
|
msgstr "Arvo"
|
|
|
|
#: lazarusidestrconsts.dlgverbosity
|
|
msgid "Verbosity during compilation:"
|
|
msgstr "Kääntäjän viestien määrä:"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblegutter
|
|
msgid "Visible gutter"
|
|
msgstr "Reunapalkki näkyy"
|
|
|
|
#: lazarusidestrconsts.dlgvisiblerightmargin
|
|
msgid "Visible right margin"
|
|
msgstr "Oikea marginaali näkyy"
|
|
|
|
#: lazarusidestrconsts.dlgwholewordsonly
|
|
msgid "&Whole words only"
|
|
msgstr "Vain &kokonaiset sanat"
|
|
|
|
#: lazarusidestrconsts.dlgwidthpos
|
|
msgid "Width:"
|
|
msgstr "Leveys:"
|
|
|
|
#: lazarusidestrconsts.dlgwin32guiapp
|
|
msgid "Win32 gui application"
|
|
msgstr "Windows graafinen ohjelma"
|
|
|
|
#: lazarusidestrconsts.dlgwindow
|
|
msgid "Window"
|
|
msgstr "Ikkuna"
|
|
|
|
#: lazarusidestrconsts.dlgwinpos
|
|
msgid "Window positions"
|
|
msgstr "Ikkunoiden sijainnit"
|
|
|
|
#: lazarusidestrconsts.dlgwordexceptions
|
|
msgid "Exceptions"
|
|
msgstr "Poikkeukset"
|
|
|
|
#: lazarusidestrconsts.dlgwordspolicies
|
|
msgctxt "lazarusidestrconsts.dlgwordspolicies"
|
|
msgid "Words"
|
|
msgstr "Sanat"
|
|
|
|
#: lazarusidestrconsts.dlgwrdpreview
|
|
msgctxt "lazarusidestrconsts.dlgwrdpreview"
|
|
msgid "Preview"
|
|
msgstr "Esikatselu"
|
|
|
|
#: lazarusidestrconsts.dlgwritefpclogo
|
|
msgid "Write FPC logo"
|
|
msgstr "Kirjoita FPC-logo"
|
|
|
|
#: lazarusidestrconsts.fdinvalidmultiselectiontext
|
|
msgid "Multiselected components must be of a single form."
|
|
msgstr "Valittujen komponenttien pitää olla samanlaisia."
|
|
|
|
#: lazarusidestrconsts.fdmalignmenu
|
|
msgid "Align ..."
|
|
msgstr "Kohdista ..."
|
|
|
|
#: lazarusidestrconsts.fdmdeleteselection
|
|
msgid "Delete Selection"
|
|
msgstr "Poista valittu"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorhorizontal
|
|
msgid "Mirror Horizontal"
|
|
msgstr "Peilaa vaaka-akselilla"
|
|
|
|
#: lazarusidestrconsts.fdmmirrorvertical
|
|
msgid "Mirror Vertical"
|
|
msgstr "Peilaa pystyakselilla"
|
|
|
|
#: lazarusidestrconsts.fdmorderbackone
|
|
msgid "Back One"
|
|
msgstr "Yksi taaksepäin"
|
|
|
|
#: lazarusidestrconsts.fdmorderforwardone
|
|
msgid "Forward One"
|
|
msgstr "Yksi eteenpäin"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetoback
|
|
msgid "Move to Back"
|
|
msgstr "Siirrä taaimmaksi"
|
|
|
|
#: lazarusidestrconsts.fdmordermovetofront
|
|
msgid "Move to Front"
|
|
msgstr "Siirrä päällimmäksi"
|
|
|
|
#: lazarusidestrconsts.fdmresetmenu
|
|
msgid "Reset ..."
|
|
msgstr "Nollaa ..."
|
|
|
|
#: lazarusidestrconsts.fdmsaveformasxml
|
|
msgid "Save Form as XML"
|
|
msgstr "Tallenna lomake XML-tiedostona"
|
|
|
|
#: lazarusidestrconsts.fdmscalemenu
|
|
msgid "Scale ..."
|
|
msgstr "Skaalaa ..."
|
|
|
|
#: lazarusidestrconsts.fdmscaleword
|
|
msgid "Scale"
|
|
msgstr "Skaalaa"
|
|
|
|
#: lazarusidestrconsts.fdmselectall
|
|
msgctxt "lazarusidestrconsts.fdmselectall"
|
|
msgid "Select All"
|
|
msgstr "Valitse kaikki"
|
|
|
|
#: lazarusidestrconsts.fdmsizemenu
|
|
msgid "Size ..."
|
|
msgstr "Koko ..."
|
|
|
|
#: lazarusidestrconsts.fdmsizeword
|
|
msgid "Size"
|
|
msgstr "Koko"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptogridoption
|
|
msgid "Option: Snap to grid"
|
|
msgstr "Sijoita ristikon pisteisiin"
|
|
|
|
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
|
|
msgid "Option: Snap to guide lines"
|
|
msgstr "Sijoita kohdistusviivojen mukaan"
|
|
|
|
#: lazarusidestrconsts.fdmzorder
|
|
msgid "Z-order"
|
|
msgstr "Z-järjestys"
|
|
|
|
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
|
|
msgid "On Both Sides"
|
|
msgstr "Molemmin puolin"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnclearhint
|
|
msgid "Clear all snapshots"
|
|
msgstr "Tyhjennä kaikki pikakuvat"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnenablehint
|
|
msgid "Toggle view snapshot or current"
|
|
msgstr "Vaihda pikakuvan ja nykyisen välillä"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnmakesnaphint
|
|
msgid "Take Snapshot"
|
|
msgstr "Ota pikakuva"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnpowerhint
|
|
msgid "Switch on/off automatic snapshots"
|
|
msgstr "Kytke päälle/pois automaattiset pikakuvat"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnremovehint
|
|
msgid "Remove selected entry"
|
|
msgstr "Poista valittu kohta"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowhisthint
|
|
msgid "View history"
|
|
msgstr "Näytä historia"
|
|
|
|
#: lazarusidestrconsts.histdlgbtnshowsnaphint
|
|
msgid "View Snapshots"
|
|
msgstr "Näytä pikakuvat"
|
|
|
|
#: lazarusidestrconsts.histdlgcolumnloc
|
|
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
|
|
msgid "Location"
|
|
msgstr "Sijainti"
|
|
|
|
#: lazarusidestrconsts.histdlgcolumntime
|
|
msgid "Time"
|
|
msgstr "Aika"
|
|
|
|
#: lazarusidestrconsts.histdlgformname
|
|
msgctxt "lazarusidestrconsts.histdlgformname"
|
|
msgid "History"
|
|
msgstr "Historia"
|
|
|
|
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
|
|
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
|
|
msgstr "0 = ei, 1 = piirrä jakoviivat vain ylätasolle, 2 = piirrä viivat kahdelle ensimmäiselle tasolle, ..."
|
|
|
|
#: lazarusidestrconsts.lisa2paddfiles
|
|
msgid "Add Files"
|
|
msgstr "Lisää tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisa2paddfilestopackage
|
|
msgid "Add Files to Package"
|
|
msgstr "Lisää tiedostot pakettiin"
|
|
|
|
#: lazarusidestrconsts.lisa2paddtopackage
|
|
msgid "Add to package"
|
|
msgstr "Lisää pakettiin"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousancestortype
|
|
msgid "Ambiguous Ancestor Type"
|
|
msgstr "Ristiriitainen kantatyyppi"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousclassname
|
|
msgid "Ambiguous Class Name"
|
|
msgstr "Ristiriitainen luokan nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pambiguousunitname
|
|
msgid "Ambiguous Unit Name"
|
|
msgstr "Ristiriitainen käännösyksikön nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pancestortype
|
|
msgid "Ancestor Type"
|
|
msgstr "Kantatyyppi"
|
|
|
|
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Pascal-käännösyksiköllä pitää olla pääte .pp tai .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2pbrokendependencies
|
|
msgid "Broken Dependencies"
|
|
msgstr "Rikkinäisiä riippuvuuksia"
|
|
|
|
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
|
|
msgid "Class Name already exists"
|
|
msgstr "Luokan nimi on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewcomp
|
|
msgid "Create New Component"
|
|
msgstr "Luo uusi komponentti"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewfile
|
|
msgid "Create New File"
|
|
msgstr "Luo uusi tietosto"
|
|
|
|
#: lazarusidestrconsts.lisa2pcreatenewreq
|
|
msgid "Create New Requirement"
|
|
msgstr "Luo uusi riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lisa2pdependency
|
|
msgid "Dependency"
|
|
msgstr "Riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lisa2pexistingfile2
|
|
msgid "Existing file: \"%s\""
|
|
msgstr "Olemassaoleva tiedosto: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexists
|
|
msgid "File already exists"
|
|
msgstr "Tiedosto on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
|
|
msgid "File \"%s\" already exists in the package."
|
|
msgstr "Tiedosto \"%s\" on jo paketissa."
|
|
|
|
#: lazarusidestrconsts.lisa2pfileisused
|
|
msgid "File is used"
|
|
msgstr "Tiedosto on käytössä"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilename2
|
|
msgid "Filename"
|
|
msgstr "Tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pfilenotunit
|
|
msgid "File not unit"
|
|
msgstr "Tiedosto ei ole käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisa2piconandsize
|
|
msgid "Icon (maximum 24x24):"
|
|
msgstr "Kuvake (maximi 24x24):"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidancestortype
|
|
msgid "Invalid Ancestor Type"
|
|
msgstr "Kelvoton kantatyyppi"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
|
|
msgid "Invalid Circular Dependency"
|
|
msgstr "Kelvoton kehäriippuvuus"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidclassname
|
|
msgid "Invalid Class Name"
|
|
msgstr "Kelvoton luokan nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfile
|
|
msgid "Invalid file"
|
|
msgstr "Kelvoton tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Kelvoton tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pinvalidunitname
|
|
msgid "Invalid Unit Name"
|
|
msgstr "Kelvoton käännösyksikön nimi"
|
|
|
|
#: lazarusidestrconsts.lisa2pisnotavalidunitname
|
|
msgid "\"%s\" is not a valid unit name."
|
|
msgstr "\"%s\" ei ole kelvollinen käännösyksikön nimi."
|
|
|
|
#: lazarusidestrconsts.lisa2pnewclassname
|
|
msgid "New class name:"
|
|
msgstr "Uusi luokan nimi:"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewcomponent
|
|
msgctxt "lazarusidestrconsts.lisa2pnewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Uusi komponentti"
|
|
|
|
#: lazarusidestrconsts.lisa2pnewfile
|
|
msgid "New File"
|
|
msgstr "Uusi tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
|
|
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
|
|
msgstr "Riippuvuuden \"%s\" pakettia ei löydy. %sValitse olemassaoleva paketti."
|
|
|
|
#: lazarusidestrconsts.lisa2ppackageorproject
|
|
msgid "Package/Project"
|
|
msgstr "Paketti/Projekti"
|
|
|
|
#: lazarusidestrconsts.lisa2ppagenametoolong
|
|
msgid "Page Name too long"
|
|
msgstr "Sivun nimi on liian pitkä"
|
|
|
|
#: lazarusidestrconsts.lisa2ppalettepage
|
|
msgid "Palette Page:"
|
|
msgstr "Palettisivu:"
|
|
|
|
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
|
|
msgid "Pascal units must have the extension .pp or .pas"
|
|
msgstr "Pascal-käännösyksikön pääte on joko .pp tai .pas"
|
|
|
|
#: lazarusidestrconsts.lisa2psavefiledialog
|
|
msgid "Save file dialog"
|
|
msgstr "Tiedoston tallennusikkuna"
|
|
|
|
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
|
|
msgid "Shorten or expand filename"
|
|
msgstr "Supista tai laajenna tiedostonimeä"
|
|
|
|
#: lazarusidestrconsts.lisa2pshowall
|
|
msgctxt "lazarusidestrconsts.lisa2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Näytä kaikki"
|
|
|
|
#: lazarusidestrconsts.lisa2pswitchpaths
|
|
msgid "Switch Paths"
|
|
msgstr "Vaihda tiedostopolkua"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
|
|
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Kantatyypillä \"%s\" on sama nimi kuin %skäännösyksiköllä \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
|
|
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Kantatyyppi \"%s\" ei ole kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
|
|
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
|
|
msgstr "Luokalla \"%s\" ja kantatyypillä \"%s\" on sama nimi."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
|
|
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
|
|
msgstr "Luokka \"%s\" on jo%sPaketissa %s%sTiedostossa: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
|
|
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
|
|
msgstr "Luokalla \"%s\" on sama nimi kuin%skäännösyksiköllä \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
|
|
msgid "The class name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Luokan nimi \"%s\" ei ole kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
|
|
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
|
|
msgstr "Tiedosto \"%s\" on osa nykyistä projektia.%sOn huono idea jakaa tiedosto projektin ja paketin kesken."
|
|
|
|
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
|
|
msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
|
|
msgstr "Tiedoston nimi \"%s\" on ristiriitainen, koska paketilla ei ole vielä oletushakemistoa.%sMäärittele koko polku tiedostolle."
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maximiversio \"%s\" on kelvoton.%sKäytä muotoa iso.pieni.julkaisu.käännös%sEsim.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximiversio on pienempi kuin Minimiversio."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
|
|
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimiversio \"%s\" on kelvoton.%sKäytä muotoa iso.pieni.julkaisu.käännös%sEsim.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
|
|
msgid "The package already has a dependency on the package \"%s\"."
|
|
msgstr "Paketilla on jo riippuvuus pakettiin \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
|
|
msgid "The page name \"%s\" is too long (max 100 chars)."
|
|
msgstr "Sivun nimi \"%s\" on liian pitkä (max 100 merkkiä)."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
|
|
msgid "The unitname \"%s\" already exists in the package:%s%s"
|
|
msgstr "Käännösyksikkö \"%s\" on jo paketissa:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
|
|
msgid "The unitname \"%s\" already exists in this package."
|
|
msgstr "Käännösyksikkö \"%s\" on jo tässä paketissa."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
|
|
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
|
|
msgstr "Käännösyksikön \"%s\"%sja tiedoston \"%s\" nimet eroavat."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
|
|
msgid "The unit name \"%s\" does not correspond to the filename."
|
|
msgstr "Käännösyksikön nimi \"%s\" ei vastaa tiedoston nimeä."
|
|
|
|
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
|
|
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
|
|
msgstr "Käännösyksikön nimi \"%s\" on sama kuin rekisteröidyllä komponentilla.%sSen käyttö voi aiheuttaa outoja virheitä."
|
|
|
|
#: lazarusidestrconsts.lisa2punitfilename2
|
|
msgid "Unit File Name:"
|
|
msgstr "Käännösyksikön tiedostonimi:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitname
|
|
msgid "Unit Name:"
|
|
msgstr "Käännösyksikön nimi:"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnamealreadyexists
|
|
msgid "Unitname already exists"
|
|
msgstr "Käännösyksikkö on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisa2punitnameinvalid
|
|
msgid "Unit Name Invalid"
|
|
msgstr "Kelvoton käännösyksikön nimi"
|
|
|
|
#: lazarusidestrconsts.lisabandonchanges
|
|
msgid "Abandon changes?"
|
|
msgstr "Hylkää muutokset?"
|
|
|
|
#: lazarusidestrconsts.lisabort
|
|
msgctxt "lazarusidestrconsts.lisabort"
|
|
msgid "Abort"
|
|
msgstr "Keskeytä"
|
|
|
|
#: lazarusidestrconsts.lisabortall
|
|
msgid "Abort all"
|
|
msgstr "Keskeytä kaikki"
|
|
|
|
#: lazarusidestrconsts.lisabortallloading
|
|
msgid "Abort all loading"
|
|
msgstr "Keskeytä kaikki lataus"
|
|
|
|
#: lazarusidestrconsts.lisaborted
|
|
msgid "Aborted"
|
|
msgstr "Keskeytetty "
|
|
|
|
#: lazarusidestrconsts.lisabortloadingproject
|
|
msgid "Abort loading project"
|
|
msgstr "Keskeytä projektin lataaminen"
|
|
|
|
#: lazarusidestrconsts.lisabortwholeloading
|
|
msgid "Abort whole loading"
|
|
msgstr "Keskeytä lataus kokonaan"
|
|
|
|
#: lazarusidestrconsts.lisabout
|
|
msgctxt "lazarusidestrconsts.lisabout"
|
|
msgid "About"
|
|
msgstr "Tietoja"
|
|
|
|
#: lazarusidestrconsts.lisabout2
|
|
msgid "About %s"
|
|
msgstr "Tietoja %s"
|
|
|
|
#: lazarusidestrconsts.lisaboutdocumentation
|
|
msgid "Documentation:"
|
|
msgstr "Dokumentaatio:"
|
|
|
|
#: lazarusidestrconsts.lisaboutide
|
|
msgid "About IDE"
|
|
msgstr "Tietoja IDE:sta"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarus
|
|
msgid "About Lazarus"
|
|
msgstr "Tietoja Lazaruksesta"
|
|
|
|
#: lazarusidestrconsts.lisaboutlazarusmsg
|
|
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
|
|
msgstr "Lisenssi: GPL/LGPL. Katso Lazaruksen ja Free Pascalin lähdekoodeista tarkemmat lisenssit.%sLazarus on IDE, millä voi tehdä graafisia ja komentorivisovelluksia Free Pascal -kielellä. Free Pascal on (Object) Pascal kääntäjä, joka toimii mm. Windows, Linux, Mac OS X, FreeBSD ym. käyttöjärjestelmissä.%sLazarus on puuttuva lenkki, joka sallii ohjelmoinnin kaikille em. alustoille Delphin kaltaisessa ympäristössä. IDE on RAD-työkalu, missä mukana on lomakeiden suunnittelu.%sLazaruksen kasvaessa tarvitsemme lisää kehittäjiä."
|
|
|
|
#: lazarusidestrconsts.lisaboutnocontributors
|
|
msgid "Cannot find contributors list."
|
|
msgstr "Avustajaluetteloa ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisaboutofficial
|
|
msgid "Official:"
|
|
msgstr "Virallinen:"
|
|
|
|
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
|
|
msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
|
|
msgstr "%s ei voi sisltää TControl:ia.%sSiellä voi olla vain ei-visuaalisia komponentteja."
|
|
|
|
#: lazarusidestrconsts.lisacknowledgements
|
|
msgid "Acknowledgements"
|
|
msgstr "Kiitokset"
|
|
|
|
#: lazarusidestrconsts.lisaction
|
|
msgid "Action:"
|
|
msgstr "Toiminta:"
|
|
|
|
#: lazarusidestrconsts.lisactions
|
|
msgid "Actions:"
|
|
msgstr "Toiminnat:"
|
|
|
|
#: lazarusidestrconsts.lisactivate
|
|
msgid "Activate"
|
|
msgstr "Aktivoi"
|
|
|
|
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
|
|
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
|
|
msgstr "Salli etsintäoperandit (mm * ja ?)"
|
|
|
|
#: lazarusidestrconsts.lisactivateselected
|
|
msgid "Activate Selected"
|
|
msgstr "Aktivoi valitut"
|
|
|
|
#: lazarusidestrconsts.lisactive
|
|
msgid "Active"
|
|
msgstr "Aktiivinen"
|
|
|
|
#: lazarusidestrconsts.lisactivefilter
|
|
msgid "Active Filter"
|
|
msgstr "Aktiivinen suodatin"
|
|
|
|
#: lazarusidestrconsts.lisadd
|
|
msgctxt "lazarusidestrconsts.lisadd"
|
|
msgid "Add"
|
|
msgstr "Lisää"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefine
|
|
msgid "Add defines simulating Delphi7"
|
|
msgstr "Lisää määritteitä, mitkä simuloivat Delphi7"
|
|
|
|
#: lazarusidestrconsts.lisadddelphidefinehint
|
|
msgid "Useful when the code has checks for supported compiler versions"
|
|
msgstr "Hyödyllinen kun koodissa on tarkistuksia tuetulle kääntäjälle"
|
|
|
|
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
|
|
msgid "Added missing object \"%s\" to pascal source."
|
|
msgstr "Lisätty puuttuva objekti \"%s\" Pascal lähdekoodiin."
|
|
|
|
#: lazarusidestrconsts.lisaddedpropertysfors
|
|
msgid "Added property \"%s\" for %s."
|
|
msgstr "Lisätty ominaisuus \"%s\" %s:hen."
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8
|
|
msgid "Add -FcUTF8"
|
|
msgstr "Lisää -FcUTF8"
|
|
|
|
#: lazarusidestrconsts.lisaddfcutf8hint
|
|
msgid "May be needed if source files have non-ansistring literals."
|
|
msgstr "Voidaan tarvita jos lähdekoodissa on muita kuin ansistring vakioita."
|
|
|
|
#: lazarusidestrconsts.lisaddfilesindirectory
|
|
msgid "Add Files in Directory"
|
|
msgstr "Lisää hakemiston tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisaddfilter
|
|
msgid "Add Filter ..."
|
|
msgstr "Lisää suodatin ..."
|
|
|
|
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
|
|
msgid "Addition does not fit the current message"
|
|
msgstr "Lisäys ei mahdu nykyiseen viestiin"
|
|
|
|
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
|
|
msgid "Addition fits the current message"
|
|
msgstr "Lisäys mahtuu nykyiseen viestiin"
|
|
|
|
#: lazarusidestrconsts.lisadditions
|
|
msgid "Additions"
|
|
msgstr "Lisäykset"
|
|
|
|
#: lazarusidestrconsts.lisaddkeyworddo
|
|
msgid "Add keyword \"do\""
|
|
msgstr "Lisää avainsana \"do\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
|
|
msgid "Add new build mode, copying settings from \"%s\""
|
|
msgstr "Lisää uusi koontamoodi, kopioi asetukset täältä: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaddnewmacro
|
|
msgid "Add new macro"
|
|
msgstr "Lisää uusi makro"
|
|
|
|
#: lazarusidestrconsts.lisaddnewset
|
|
msgid "Add new set"
|
|
msgstr "Lisää uusi set"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagerequirement
|
|
msgid "Add package requirement?"
|
|
msgstr "Lisää pakettiriippuvuus?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
|
|
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
|
|
msgstr "Lisää paketti asennettujen pakettien luetteloon (yhdistä --build-ide:n kanssa kootaksesi IDE:n)."
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject
|
|
msgid "Add package %s to project?"
|
|
msgstr "Lisää paketti %s projektiin?"
|
|
|
|
#: lazarusidestrconsts.lisaddpackagetoproject2
|
|
msgid "Add package to project"
|
|
msgstr "Lisää paketti projektiin"
|
|
|
|
#: lazarusidestrconsts.lisaddparameterbrackets
|
|
msgid "Add parameter brackets"
|
|
msgstr "Lisää parametrin sulkeet"
|
|
|
|
#: lazarusidestrconsts.lisaddress
|
|
msgid "Address:"
|
|
msgstr "Osoite:"
|
|
|
|
#: lazarusidestrconsts.lisaddressbreakpoint
|
|
msgid "&Address Breakpoint ..."
|
|
msgstr "&Osoite-keskeytyskohta ..."
|
|
|
|
#: lazarusidestrconsts.lisaddtoincludesearchpath
|
|
msgid "Add to include search path?"
|
|
msgstr "Lisätäänkö include-hakupolkuun?"
|
|
|
|
#: lazarusidestrconsts.lisaddtoproject
|
|
msgid "Add %s to project?"
|
|
msgstr "Lisätäänkö %s projektiin?"
|
|
|
|
#: lazarusidestrconsts.lisaddtostartupcomponents
|
|
msgid "Add to startup components?"
|
|
msgstr "Lisää käynnistyskomponentteihin?"
|
|
|
|
#: lazarusidestrconsts.lisaddtounitsearchpath
|
|
msgid "Add to unit search path?"
|
|
msgstr "Lisätäänkö käännösyksikköjen hakupolkuun?"
|
|
|
|
#: lazarusidestrconsts.lisaddunitinterfaces
|
|
msgid "Add unit interfaces"
|
|
msgstr "Lisää käännösyksikön rajapinnat"
|
|
|
|
#: lazarusidestrconsts.lisaddunitnotrecommended
|
|
msgid "Add unit (not recommended)"
|
|
msgstr "Lisää käännösyksikkö (ei suositella)"
|
|
|
|
#: lazarusidestrconsts.lisaddvaluetomacro
|
|
msgid "Add value to macro %s"
|
|
msgstr "Lisää arvo makroon %s"
|
|
|
|
#: lazarusidestrconsts.lisaf2paddfiletoapackage
|
|
msgid "Add File to Package"
|
|
msgstr "Lisää tiedosto pakettiin"
|
|
|
|
#: lazarusidestrconsts.lisaf2pdestinationpackage
|
|
msgid "Destination package"
|
|
msgstr "Kohdepaketti"
|
|
|
|
#: lazarusidestrconsts.lisaf2pfiletype
|
|
msgid "File type"
|
|
msgstr "Tiedoston tyyppi"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackage
|
|
msgid "Invalid Package"
|
|
msgstr "Kelvoton paketti"
|
|
|
|
#: lazarusidestrconsts.lisaf2pinvalidpackageid
|
|
msgid "Invalid package ID: \"%s\""
|
|
msgstr "Kelvoton paketin ID: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackageisreadonly
|
|
msgid "Package is read only"
|
|
msgstr "Pakettia voidaan vain lukea"
|
|
|
|
#: lazarusidestrconsts.lisaf2ppackagenotfound
|
|
msgid "Package \"%s\" not found."
|
|
msgstr "Pakettia \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.lisaf2pshowall
|
|
msgctxt "lazarusidestrconsts.lisaf2pshowall"
|
|
msgid "Show all"
|
|
msgstr "Näytä kaikki"
|
|
|
|
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
|
|
msgid "The package %s is read only."
|
|
msgstr "Pakettia %s voidaan vain lukea."
|
|
|
|
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
|
|
msgid "A file \"%s\" already exists.%sReplace it?"
|
|
msgstr "Tiedosto \"%s\" on jo olemassa.%sKorvataanko se? "
|
|
|
|
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
|
|
msgid "A filter with the name \"%s\" already exists."
|
|
msgstr "Suodatin nimellä \"%s\" on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
|
|
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
|
|
msgstr "Siivouksen jälkeen (kaikki tai yleiset tiedostot), vaihda automaattisiivoukseen"
|
|
|
|
#: lazarusidestrconsts.lisalignment
|
|
msgid "Alignment"
|
|
msgstr "Kohdistus"
|
|
|
|
#: lazarusidestrconsts.lisallblockslooksok
|
|
msgid "All blocks look ok."
|
|
msgstr "Kaikki lohkorakenteet vaikuttavat hyviltä."
|
|
|
|
#: lazarusidestrconsts.lisallbuildmodes
|
|
msgid "<All build modes>"
|
|
msgstr "<Kaikki koontamoodit>"
|
|
|
|
#: lazarusidestrconsts.lisallinheritedoptions
|
|
msgid "All inherited options"
|
|
msgstr "Kaikki periytyvät asetukset"
|
|
|
|
#: lazarusidestrconsts.lisalloptions
|
|
msgid "All Options"
|
|
msgstr "Kaikki asetukset"
|
|
|
|
#: lazarusidestrconsts.lisallowfunctio
|
|
msgid "Allow Function Calls"
|
|
msgstr "Salli funktiokutsut"
|
|
|
|
#: lazarusidestrconsts.lisallowsearchingformultiplelines
|
|
msgid "Allow searching for multiple lines"
|
|
msgstr "Salli etsintä monelta riviltä"
|
|
|
|
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
|
|
msgid "All parameters of this function are already set at this call. Nothing to add."
|
|
msgstr "Kaikki tämän funktion parametrit on jo asetettu. Ei lisättävää."
|
|
|
|
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
|
|
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
|
|
msgstr "Kaikki muutokset tiedostoon \"%s\"%smenetetään ja se avataan uudestaan."
|
|
|
|
#: lazarusidestrconsts.lisalpha
|
|
msgid "Alpha"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisalternativekey
|
|
msgid "Alternative key"
|
|
msgstr "Vaihtoehtoinen näppäin"
|
|
|
|
#: lazarusidestrconsts.lisalternativekeyor2keysequence
|
|
msgid "Alternative key (or 2 key sequence)"
|
|
msgstr "Vaihtoehtoinen näppäin (tai 2 peräkkäistä yhdistelmää)"
|
|
|
|
#: lazarusidestrconsts.lisalways
|
|
msgid "Always"
|
|
msgstr "Aina"
|
|
|
|
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
|
|
msgid "Always convert suggested default file name to lowercase"
|
|
msgstr "Muuta ehdotettu oletusnimi pieniksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
|
|
msgid "Always draw selected items focused"
|
|
msgstr "Näytä aina valitut kohdat fokusoituna"
|
|
|
|
#: lazarusidestrconsts.lisalwaysignore
|
|
msgid "Always ignore"
|
|
msgstr "Jätä aina huomiotta"
|
|
|
|
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
|
|
msgid "A macro with this name already exists."
|
|
msgstr "Tämän niminen makro on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefound
|
|
msgid "Ambiguous file found"
|
|
msgstr "Ristiriitainen tiedosto löytyi"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
|
|
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
|
|
msgstr "Ristiriitainen tiedosto löytyi: \"%s\"%smikä voi sekoittua tähän: \"%s\"%sPoistetaanko?"
|
|
|
|
#: lazarusidestrconsts.lisambiguousfilesfound
|
|
msgid "Ambiguous files found"
|
|
msgstr "Ristiriitaisia tiedostoja löytyi"
|
|
|
|
#: lazarusidestrconsts.lisambiguousunitfound
|
|
msgid "Ambiguous unit found"
|
|
msgstr "Ristiriitainen käännösyksikkö löytyi"
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtobottomside
|
|
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ankkuroi alareuna sisarusten alareunaan. Käytä BorderSpacing välimatkan säätämiseen. Sisarusten BorderSpacing ei vaikuta."
|
|
|
|
#: lazarusidestrconsts.lisanchorbottomtotopside
|
|
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ankkuroi alareuna sisarusten yläreunaan. Välimatka säädetään sekä tämän kontrollin että sisarusten BorderSpacing ominaisuudella."
|
|
|
|
#: lazarusidestrconsts.lisanchoreditornocontrolselected
|
|
msgid "Anchor Editor - no control selected"
|
|
msgstr "Ankkuri - ei yhtään komponenttia valittuna"
|
|
|
|
#: lazarusidestrconsts.lisanchorenabledhint
|
|
msgid "Enabled = Include %s in Anchors"
|
|
msgstr "Sallitu = ota %s mukaan ankkureihin"
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttoleftside
|
|
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ankkuroi vasen reuna sisarusten vasempaan reunaan. Käytä BorderSpacing välimatkan säätämiseen. Sisarusten BorderSpacing ei vaikuta."
|
|
|
|
#: lazarusidestrconsts.lisanchorlefttorightside
|
|
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ankkuroi vasen reuna sisarusten oikeaan reunaan. Välimatka säädetään sekä tämän kontrollin että sisarusten BorderSpacing ominaisuudella."
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttoleftside
|
|
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ankkuroi oikea reuna sisarusten vasempaan reunaan. Välimatka säädetään sekä tämän kontrollin että sisarusten BorderSpacing ominaisuudella."
|
|
|
|
#: lazarusidestrconsts.lisanchorrighttorightside
|
|
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ankkuroi oikea reuna sisarusten oikeaan reunaan. Käytä BorderSpacing välimatkan säätämiseen. Sisarusten BorderSpacing ei vaikuta."
|
|
|
|
#: lazarusidestrconsts.lisanchorsof
|
|
msgid "Anchors of %s"
|
|
msgstr "%s:n ankkuri"
|
|
|
|
#: lazarusidestrconsts.lisanchorsofselectedcontrols
|
|
msgid "Anchors of selected controls"
|
|
msgstr "Valittujen kontrollien ankkurit"
|
|
|
|
#: lazarusidestrconsts.lisanchortoptobottomside
|
|
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
|
|
msgstr "Ankkuroi yläreuna sisarusten alareunaan. Välimatka säädetään sekä tämän kontrollin että sisarusten BorderSpacing ominaisuudella."
|
|
|
|
#: lazarusidestrconsts.lisanchortoptotopside
|
|
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
|
|
msgstr "Ankkuroi yläreuna sisarusten yläreunaan. Käytä BorderSpacing välimatkan säätämiseen. Sisarusten BorderSpacing ei vaikuta."
|
|
|
|
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
|
|
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
|
|
msgstr "Virhe esiintyi, kun avattiin projektia %s!%sAvataanko tämä projekti uudelleen?"
|
|
|
|
#: lazarusidestrconsts.lisapplicationclassname
|
|
msgid "&Application class name"
|
|
msgstr "&Sovelluksen luokan nimi"
|
|
|
|
#: lazarusidestrconsts.lisapplicationprogramdescriptor
|
|
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
|
|
msgstr "Graafinen Free Pascal -ohjelma käyttäen monen ympäristön LCL GUI-kirjastoa."
|
|
|
|
#: lazarusidestrconsts.lisapply
|
|
msgctxt "lazarusidestrconsts.lisapply"
|
|
msgid "Apply"
|
|
msgstr "Käytä"
|
|
|
|
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
|
|
msgid "apply build flags (-B) to dependencies too"
|
|
msgstr "käytä koontalippuja (-B) myös riippuvuuksiin"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventions
|
|
msgid "Apply conventions"
|
|
msgstr "Käytännöt"
|
|
|
|
#: lazarusidestrconsts.lisapplyconventionshint
|
|
msgid "Adjust name extension and character case for platform and file type."
|
|
msgstr "Muuta nimen liite ja kirjainkoko alustan ja tiedostotyypin mukaan."
|
|
|
|
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
|
|
msgid "A project unit can not be used by other packages/projects"
|
|
msgstr "Projektin käännösyksikköä ei voi käyttää muihin projekteihin/paketteihin"
|
|
|
|
#: lazarusidestrconsts.lisaroundborderspacehint
|
|
msgid "Borderspace around the control. The other four borderspaces are added to this value."
|
|
msgstr "Reuna-alue kontrollin ympärillä. Muut neljä reuna-aluetta lisätään tähän arvoon."
|
|
|
|
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
|
|
msgid "Ask before replacing each found text"
|
|
msgstr "Varmista korvataanko löydetty teksti"
|
|
|
|
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
|
|
msgid "Ask before saving project's session"
|
|
msgstr "Kysy ennen projekti-istunnon talletusta"
|
|
|
|
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
|
|
msgid "Ask for component name after putting it on a designer form."
|
|
msgstr "Kysy komponentin nimi, kun se on laitettu lomake-editorille."
|
|
|
|
#: lazarusidestrconsts.lisaskforfilenameonnewfile
|
|
msgid "Ask for file name on new file"
|
|
msgstr "Kysy tiedoston nimi uutta tiedostoa luotaessa"
|
|
|
|
#: lazarusidestrconsts.lisasknameoncreate
|
|
msgid "Ask name on create"
|
|
msgstr "Kysy nimi luotaessa"
|
|
|
|
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
|
|
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
|
msgstr "Hyödyllinen asetus Windowsissa on: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheight
|
|
msgid "Automatically adjust IDE main window height"
|
|
msgstr "Säädä IDE pääikkunan korkeus automaattisesti"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
|
|
msgid "Show complete component palette"
|
|
msgstr "Näytä koko komponenttipaletti"
|
|
|
|
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
|
|
msgid "If component palette spans over more lines, show them all and not only one."
|
|
msgstr "Jos komponenttipaletti menee monelle riville, näytä kaikki rivit."
|
|
|
|
#: lazarusidestrconsts.lisautocheckmodifiedfiles
|
|
msgid "Automatically check (select) modified files"
|
|
msgstr "Automaattisesti valitse muuttuneet tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionoff
|
|
msgid "Auto completion: off"
|
|
msgstr "Automaattinen täydennys: pois"
|
|
|
|
#: lazarusidestrconsts.lisautocompletionon
|
|
msgid "Auto completion: on"
|
|
msgstr "Automaattinen täydennys: päällä"
|
|
|
|
#: lazarusidestrconsts.lisautocontinueafter
|
|
msgid "Auto continue after:"
|
|
msgstr "Jatka sen jälkeen kun:"
|
|
|
|
#: lazarusidestrconsts.lisautomarkup
|
|
msgid "Markup and Matches"
|
|
msgstr "Merkintä ja osumat"
|
|
|
|
#: lazarusidestrconsts.lisautomatic
|
|
msgctxt "lazarusidestrconsts.lisautomatic"
|
|
msgid "Automatic"
|
|
msgstr "Automaattinen"
|
|
|
|
#: lazarusidestrconsts.lisautomatically
|
|
msgid "Automatically"
|
|
msgstr "Automaattisesti"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
|
|
msgid "Automatically convert .lfm files to .lrs resource files"
|
|
msgstr "Automaattisesti muunna .lfm tiedostot .lrs resurssitiedostoiksi"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyignoreforselection
|
|
msgid "do not complete selection"
|
|
msgstr "älä täydennä valintaa"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
|
|
msgid "Automatically invoke after point"
|
|
msgstr "Valinnat esiin automaattisesti pisteen jälkeen"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonlinebreak
|
|
msgid "line break"
|
|
msgstr "rivin vaihto"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonspace
|
|
msgid "space"
|
|
msgstr "välilyönti"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyontab
|
|
msgid "tab"
|
|
msgstr "tabulaattori"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyonwordend
|
|
msgid "word end"
|
|
msgstr "sanan loppu"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyremovecharacter
|
|
msgid "do not add character"
|
|
msgstr "älä lisää merkkiä"
|
|
|
|
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
|
|
msgid "Automatically use single possible identifier"
|
|
msgstr "Käytä ainutta tarjolla olevaa tunnistetta automaattisesti"
|
|
|
|
#: lazarusidestrconsts.lisautomaticfeatures
|
|
msgid "Completion and Hints"
|
|
msgstr "Koodin täydennys ja vihjeet"
|
|
|
|
#: lazarusidestrconsts.lisautoshowobjectinspector
|
|
msgid "Auto show"
|
|
msgstr "Näytä automaattisesti"
|
|
|
|
#: lazarusidestrconsts.lisavailableforinstallation
|
|
msgid "Available for installation"
|
|
msgstr "Asennettavissa"
|
|
|
|
#: lazarusidestrconsts.lisavailableprojectbuildmodes
|
|
msgid "Available project build modes:"
|
|
msgstr "Projektin koontamoodit:"
|
|
|
|
#: lazarusidestrconsts.lisbackupchangedfiles
|
|
msgid "Make backup of changed files"
|
|
msgstr "Tee varmuuskopio muuttuneista tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lisbackupfilefailed
|
|
msgid "Backup file failed"
|
|
msgstr "Varmuuskopiointi epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisbackuphint
|
|
msgid "Creates a Backup directory under project directory"
|
|
msgstr "Luo varmuushakemiston projektihakemiston alle"
|
|
|
|
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
|
|
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
|
|
msgstr "Paketin nimen muuttaminen rikkoo riippuvuuksia. Muutetaanko myös riippuvuudet?%s'Kyllä' muuttaa kaikki listan riippuvuudet.%s'Ohita' rikkoo ne."
|
|
|
|
#: lazarusidestrconsts.lisbegins
|
|
msgid "begins"
|
|
msgstr "alkaa"
|
|
|
|
#: lazarusidestrconsts.lisbehindrelated
|
|
msgid "Behind related"
|
|
msgstr "Samankaltaisten jälkeen"
|
|
|
|
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
|
|
msgid "be less verbose, can be given multiple times"
|
|
msgstr "vähemmän monisanainen, voidaan antaa monta kertaa"
|
|
|
|
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
|
|
msgid "be more verbose, can be given multiple times"
|
|
msgstr "enemmän monisanainen, voidaan antaa monta kertaa"
|
|
|
|
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
|
|
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
|
|
msgstr "Näkyy parhaiten, kun asentaa HTML komponentin kuten turbopoweriprodsgn"
|
|
|
|
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
|
|
msgid "Always build before run"
|
|
msgstr "Kokoa aina ennen suoritusta"
|
|
|
|
#: lazarusidestrconsts.lisbfbuildcommand
|
|
msgid "Build Command"
|
|
msgstr "Koontakomento"
|
|
|
|
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
|
|
msgid "On build project execute the Build File command instead"
|
|
msgstr "Projektia kootessa suorita tiedoston käännöskomento"
|
|
|
|
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
|
|
msgid "On run project execute the Run File command instead"
|
|
msgstr "Projektia ajettaessa suorita tiedoston ajokomento"
|
|
|
|
#: lazarusidestrconsts.lisbfruncommand
|
|
msgid "Run Command"
|
|
msgstr "Suorita komento"
|
|
|
|
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
|
|
msgid "When this file is active in source editor"
|
|
msgstr "Kun tämä tiedosto on aktiivinen editorissa"
|
|
|
|
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
|
|
msgid "Working directory (leave empty for file path)"
|
|
msgstr "Työhakemisto (tyhjä = tiedoston polku)"
|
|
|
|
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
|
|
msgid "Bold non default values"
|
|
msgstr "Lihavoi muutetut arvot"
|
|
|
|
#: lazarusidestrconsts.lisborderspace
|
|
msgid "Border space"
|
|
msgstr "Reuna-alue"
|
|
|
|
#: lazarusidestrconsts.lisbottom
|
|
msgctxt "lazarusidestrconsts.lisbottom"
|
|
msgid "Bottom"
|
|
msgstr "Alhaalla"
|
|
|
|
#: lazarusidestrconsts.lisbottomborderspacespinedithint
|
|
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
|
|
msgstr "Alapuolen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen."
|
|
|
|
#: lazarusidestrconsts.lisbottomgroupboxcaption
|
|
msgid "Bottom anchoring"
|
|
msgstr "Alaosan ankkurointi"
|
|
|
|
#: lazarusidestrconsts.lisbottoms
|
|
msgid "Bottoms"
|
|
msgstr "Alareunat"
|
|
|
|
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Tämä on naapurikontrolli, mihin alareuna on ankkuroitu. Tyhjä tarkoittaa ankkurointia Delphi-tyyliin (BorderSpacing and ReferenceSide eivät vaikuta)."
|
|
|
|
#: lazarusidestrconsts.lisbottomspaceequally
|
|
msgid "Bottom space equally"
|
|
msgstr "Tasaa välit alhaalla"
|
|
|
|
#: lazarusidestrconsts.lisbreak
|
|
msgctxt "lazarusidestrconsts.lisbreak"
|
|
msgid "Break"
|
|
msgstr "Keskeytä"
|
|
|
|
#: lazarusidestrconsts.lisbreakpointproperties
|
|
msgid "Breakpoint Properties"
|
|
msgstr "Keskeytyskohdan ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lisbtnadd
|
|
msgctxt "lazarusidestrconsts.lisbtnadd"
|
|
msgid "&Add"
|
|
msgstr "&Lisää"
|
|
|
|
#: lazarusidestrconsts.lisbtnclose
|
|
msgctxt "lazarusidestrconsts.lisbtnclose"
|
|
msgid "&Close"
|
|
msgstr "&Sulje"
|
|
|
|
#: lazarusidestrconsts.lisbtndelete
|
|
msgctxt "lazarusidestrconsts.lisbtndelete"
|
|
msgid "&Delete"
|
|
msgstr "&Poista"
|
|
|
|
#: lazarusidestrconsts.lisbtndlgadd
|
|
msgid "&Add ..."
|
|
msgstr "&Lisää ..."
|
|
|
|
#: lazarusidestrconsts.lisbtndlgreplace
|
|
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
|
|
msgid "&Replace ..."
|
|
msgstr "&Etsi ja korvaa ..."
|
|
|
|
#: lazarusidestrconsts.lisbtnenabled
|
|
msgctxt "lazarusidestrconsts.lisbtnenabled"
|
|
msgid "&Enabled"
|
|
msgstr "&Sallittu"
|
|
|
|
#: lazarusidestrconsts.lisbtnfind
|
|
msgid "&Find"
|
|
msgstr "&Etsi"
|
|
|
|
#: lazarusidestrconsts.lisbtnquit
|
|
msgctxt "lazarusidestrconsts.lisbtnquit"
|
|
msgid "&Quit"
|
|
msgstr "&Lopeta"
|
|
|
|
#: lazarusidestrconsts.lisbtnremove
|
|
msgctxt "lazarusidestrconsts.lisbtnremove"
|
|
msgid "&Remove"
|
|
msgstr "&Poista"
|
|
|
|
#: lazarusidestrconsts.lisbtnreplace
|
|
msgid "&Replace"
|
|
msgstr "&Korvaa"
|
|
|
|
#: lazarusidestrconsts.lisbuild
|
|
msgctxt "lazarusidestrconsts.lisbuild"
|
|
msgid "Build"
|
|
msgstr "Kokoa"
|
|
|
|
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
|
|
msgid "build all files of project/package/IDE"
|
|
msgstr "kokoa kaikki projektin/paketin/IDEn tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisbuildcaption
|
|
msgctxt "lazarusidestrconsts.lisbuildcaption"
|
|
msgid "Build"
|
|
msgstr "Kokoa"
|
|
|
|
#: lazarusidestrconsts.lisbuildfollowingmodes
|
|
msgid "Build the following modes"
|
|
msgstr "Kokoa seuraavat moodit"
|
|
|
|
#: lazarusidestrconsts.lisbuildide
|
|
msgid "Build IDE"
|
|
msgstr "Kokoa IDE"
|
|
|
|
#: lazarusidestrconsts.lisbuildidewithpackages
|
|
msgid "build IDE with packages"
|
|
msgstr "kokoa IDE paketteineen"
|
|
|
|
#: lazarusidestrconsts.lisbuilding
|
|
msgid "Building"
|
|
msgstr "Kokoaminen"
|
|
|
|
#: lazarusidestrconsts.lisbuildinglazarusfailed
|
|
msgid "Building Lazarus failed"
|
|
msgstr "Lazaruksen kokoaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisbuildmode
|
|
msgid "Build Mode: %s"
|
|
msgstr "Koontamoodi: %s"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
|
|
msgid "Differences between build modes"
|
|
msgstr "Koontamoodien erot"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
|
|
msgid "Differences from other build modes"
|
|
msgstr "Erot muihin koontamoodeihin"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodediffmode
|
|
msgid "Mode:"
|
|
msgstr "Moodi:"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodeintitleinexample
|
|
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
|
|
msgstr "Otsikko tehtäväpalkissa näyttää esim.: project1.lpi - Release - Lazarus"
|
|
|
|
#: lazarusidestrconsts.lisbuildmodes
|
|
msgid "Build modes"
|
|
msgstr "Koontamoodit"
|
|
|
|
#: lazarusidestrconsts.lisbuildnewproject
|
|
msgid "Build new project"
|
|
msgstr "Kokoa uusi projekti"
|
|
|
|
#: lazarusidestrconsts.lisbuildnumber
|
|
msgid "Build number"
|
|
msgstr "Koontanumero"
|
|
|
|
#: lazarusidestrconsts.lisbuildstage
|
|
msgctxt "lazarusidestrconsts.lisbuildstage"
|
|
msgid "Build"
|
|
msgstr "Kokoa"
|
|
|
|
#: lazarusidestrconsts.lisbusy
|
|
msgid "Busy"
|
|
msgstr "Varattu"
|
|
|
|
#: lazarusidestrconsts.lisbyte
|
|
msgid "%s byte"
|
|
msgstr "%s tavu"
|
|
|
|
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
|
|
msgid "Calling %s to create Makefile from %s failed."
|
|
msgstr "%s:n kutsuminen Makefile luomiseksi %s:sta epäonnistui."
|
|
|
|
#: lazarusidestrconsts.liscallstacknotevaluated
|
|
msgid "Stack not evaluated"
|
|
msgstr "Pinoa ei arvioitu"
|
|
|
|
#: lazarusidestrconsts.liscancel
|
|
msgctxt "lazarusidestrconsts.liscancel"
|
|
msgid "Cancel"
|
|
msgstr "Peru"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingthiscomponent
|
|
msgid "Cancel loading this component"
|
|
msgstr "Peru tämän komponentin lataaminen"
|
|
|
|
#: lazarusidestrconsts.liscancelloadingunit
|
|
msgid "Cancel loading unit"
|
|
msgstr "Peruuta käännösyksikön lataus"
|
|
|
|
#: lazarusidestrconsts.liscancelrenaming
|
|
msgid "Cancel renaming"
|
|
msgstr "Peru uudelleennimeäminen"
|
|
|
|
#: lazarusidestrconsts.liscannotcompileproject
|
|
msgid "Cannot compile project"
|
|
msgstr "Ei voi kääntää projektia"
|
|
|
|
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
|
|
msgid "Cannot copy top level component."
|
|
msgstr "Päätason komponenttia ei voida kopioida"
|
|
|
|
#: lazarusidestrconsts.liscannotcreatefile
|
|
msgid "Cannot create file \"%s\""
|
|
msgstr "Ei voi luoda tiedostoa \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotexecute
|
|
msgid "cannot execute \"%s\""
|
|
msgstr "ei voi suorittaa \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfind
|
|
msgid "Cannot find %s"
|
|
msgstr "Ei löydy %s"
|
|
|
|
#: lazarusidestrconsts.liscannotfindexecutable
|
|
msgid "cannot find executable \"%s\""
|
|
msgstr "ei löydy ohjelmaa \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscannotfindlazarusstarter
|
|
msgid "Cannot find Lazarus starter:%s%s"
|
|
msgstr "Lazaruksen käynnistäjää:%s%s ei löydy"
|
|
|
|
#: lazarusidestrconsts.liscannotfindunit
|
|
msgid "Cannot find unit %s"
|
|
msgstr "Ei löydy käännösyksikköä %s"
|
|
|
|
#: lazarusidestrconsts.liscannotopenform
|
|
msgid "Cannot open form \"%s\"."
|
|
msgstr "Ei voi avata lomaketta \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsaveform
|
|
msgid "Cannot save form \"%s\"."
|
|
msgstr "Ei voi tallentaa lomaketta \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannotsubstitutemacros
|
|
msgid "Cannot substitute macro \"%s\"."
|
|
msgstr "Ei voi korvata makroa \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
|
|
msgid "Cannot test the compiler while debugging or compiling."
|
|
msgstr "Kääntäjää ei voi testata virheenjäljityksen tai käännöksen aikana."
|
|
|
|
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
|
|
msgid "Can only change the class of TComponents."
|
|
msgstr "Vain TComponent:sta periytyvän luokka voidaan vaihtaa."
|
|
|
|
#: lazarusidestrconsts.liscantfindavalidppu
|
|
msgid "Can't find a valid %s.ppu"
|
|
msgstr "Ei löydy kelvollista %s.ppu"
|
|
|
|
#: lazarusidestrconsts.liscaptioncomparefiles
|
|
msgid "Compare files (not for creating patches)"
|
|
msgstr "Vertaa tiedostoja (ei patch-korjauksia varten)"
|
|
|
|
#: lazarusidestrconsts.liscbpfiles
|
|
msgid "%s (%s files)"
|
|
msgstr "%s (%s tiedostoa)"
|
|
|
|
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
|
|
msgid "Really delete %s source files%s%s"
|
|
msgstr "Poistetaanko todella %s lähdekooditiedostoa%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccdchangeclassof
|
|
msgid "Change Class of %s"
|
|
msgstr "Vaihda %s:n luokka"
|
|
|
|
#: lazarusidestrconsts.lisccdnoclass
|
|
msgid "no class"
|
|
msgstr "ei luokkaa"
|
|
|
|
#: lazarusidestrconsts.lisccoambiguouscompiler
|
|
msgid "Ambiguous compiler"
|
|
msgstr "Ristiriitainen kääntäjä"
|
|
|
|
#: lazarusidestrconsts.lisccochecktestdir
|
|
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
|
|
msgstr "Tarkista testihakemisto kohdasta %sTyökalut -> Asetukset -> Tiedostot -> Kansio testiprojektien kokoamiseen"
|
|
|
|
#: lazarusidestrconsts.lisccocompilernotanexe
|
|
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
|
|
msgstr "Kääntäjä \"%s\" ei ole suoritettava ohjelma.%sYksityiskohdat: %s"
|
|
|
|
#: lazarusidestrconsts.lisccocontains
|
|
msgid "contains "
|
|
msgstr "sisältää "
|
|
|
|
#: lazarusidestrconsts.lisccocopyoutputtocliboard
|
|
msgid "Copy output to clipboard"
|
|
msgstr "Kopioi tuloste leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisccodatesdiffer
|
|
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
|
|
msgstr "FPC:n .ppu-tiedostojen aikaleimat eroavat yli tunnilla.%sSe voi tarkoittaa, että ne ovat kahdesta eri asennuksesta.%sTiedosto1: %s%sTiedosto2: %s"
|
|
|
|
#: lazarusidestrconsts.lisccoerrorcaption
|
|
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
|
|
msgid "Error"
|
|
msgstr "Virhe"
|
|
|
|
#: lazarusidestrconsts.lisccoerrormsg
|
|
msgid "ERROR: "
|
|
msgstr "VIRHE: "
|
|
|
|
#: lazarusidestrconsts.lisccofpcunitpathhassource
|
|
msgid "FPC unit path contains a source: "
|
|
msgstr "FPC:n käännösyksikköjen polku sisältää lähdekoodia: "
|
|
|
|
#: lazarusidestrconsts.lisccohasnewline
|
|
msgid "new line symbols"
|
|
msgstr "rivinvaihtosymbolit"
|
|
|
|
#: lazarusidestrconsts.lisccohintmsg
|
|
msgid "HINT: "
|
|
msgstr "VIHJE:"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidcompiler
|
|
msgid "Invalid compiler"
|
|
msgstr "Kelvoton kääntäjä:"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidsearchpath
|
|
msgid "Invalid search path"
|
|
msgstr "Kelvoton hakupolku"
|
|
|
|
#: lazarusidestrconsts.lisccoinvalidtestdir
|
|
msgid "Invalid Test Directory"
|
|
msgstr "Kelvoton testihakemisto"
|
|
|
|
#: lazarusidestrconsts.lisccomissingunit
|
|
msgid "Missing unit"
|
|
msgstr "Puuttuva käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisccomsgppunotfound
|
|
msgid "compiled FPC unit not found: %s.ppu"
|
|
msgstr "FPC-käännösyksikköä: %s.ppu ei löydy käännettynä"
|
|
|
|
#: lazarusidestrconsts.lisccomultiplecfgfound
|
|
msgid "multiple compiler configs found: "
|
|
msgstr "Löytyi monta kääntäjän asetusta:"
|
|
|
|
#: lazarusidestrconsts.liscconocfgfound
|
|
msgid "no fpc.cfg found"
|
|
msgstr "fpc.cfg ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisccononascii
|
|
msgid "non ASCII"
|
|
msgstr "ei ole ASCII"
|
|
|
|
#: lazarusidestrconsts.lisccoppuexiststwice
|
|
msgid "ppu exists twice: %s, %s"
|
|
msgstr "ppu löytyy kahdesta paikasta: %s, %s"
|
|
|
|
#: lazarusidestrconsts.lisccoppunotfounddetailed
|
|
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
|
|
msgstr "FPC käännösyksikköä: %s.ppu ei löydy käännettynä.%sSe tavallisesti tarkoittaa että tiedostossa fpc.cfg on virhe tai FPC:n asennus on rikki."
|
|
|
|
#: lazarusidestrconsts.lisccoppuolderthancompiler
|
|
msgid "There is a .ppu file older than the compiler itself:%s%s"
|
|
msgstr "Löytyi itse kääntäjää vanhempi .ppu-tiedosto:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisccoseveralcompilers
|
|
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
|
|
msgstr "Polussa on monta Free Pascal -kääntäjää.%s%s%sEhkä unohdit poistaa vanhan kääntäjän?"
|
|
|
|
#: lazarusidestrconsts.lisccoskip
|
|
msgid "Skip"
|
|
msgstr "Ohita"
|
|
|
|
#: lazarusidestrconsts.lisccospecialcharacters
|
|
msgid "special characters"
|
|
msgstr "erikoismerkit"
|
|
|
|
#: lazarusidestrconsts.lisccotestssuccess
|
|
msgid "All tests succeeded."
|
|
msgstr "Kaikki testit menivät läpi."
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestfile
|
|
msgid "Unable to create Test File"
|
|
msgstr "Testitiedoston luonti ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
|
|
msgid "Unable to create Test Pascal file \"%s\"."
|
|
msgstr "Pascal-testitiedoston \"%s\" luonti ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisccounusualchars
|
|
msgid "unusual characters"
|
|
msgstr "epätavallisia merkkejä"
|
|
|
|
#: lazarusidestrconsts.lisccowarningcaption
|
|
msgctxt "lazarusidestrconsts.lisccowarningcaption"
|
|
msgid "Warning"
|
|
msgstr "Varoitus"
|
|
|
|
#: lazarusidestrconsts.lisccowarningmsg
|
|
msgid "WARNING: "
|
|
msgstr "VAROITUS:"
|
|
|
|
#: lazarusidestrconsts.lisccowrongpathdelimiter
|
|
msgid "wrong path delimiter"
|
|
msgstr "Väärä polkuerotin"
|
|
|
|
#: lazarusidestrconsts.liscecategories
|
|
msgid "Categories"
|
|
msgstr "Luokat"
|
|
|
|
#: lazarusidestrconsts.liscecomplexitygroup
|
|
msgid "Complexity"
|
|
msgstr "Monimutkaisuus"
|
|
|
|
#: lazarusidestrconsts.lisceconstants
|
|
msgid "Constants"
|
|
msgstr "Vakiot"
|
|
|
|
#: lazarusidestrconsts.lisceemptyblocks
|
|
msgid "Empty blocks"
|
|
msgstr "Tyhjät lohkot"
|
|
|
|
#: lazarusidestrconsts.lisceemptyclasssections
|
|
msgid "Empty class sections"
|
|
msgstr "Luokkien tyhjät osat"
|
|
|
|
#: lazarusidestrconsts.lisceemptygroup
|
|
msgid "Empty constructs"
|
|
msgstr "Tyhjät rakenteet"
|
|
|
|
#: lazarusidestrconsts.lisceemptyprocedures
|
|
msgid "Empty procedures"
|
|
msgstr "Tyhjät aliohjelmat"
|
|
|
|
#: lazarusidestrconsts.liscefilter
|
|
msgid "(filter)"
|
|
msgstr "(suodatin)"
|
|
|
|
#: lazarusidestrconsts.liscefollowcursor
|
|
msgid "Follow cursor"
|
|
msgstr "Seuraa kursoria"
|
|
|
|
#: lazarusidestrconsts.liscein
|
|
msgid "%s in %s"
|
|
msgstr "%s %s:ssa"
|
|
|
|
#: lazarusidestrconsts.lisceisarootcontrol
|
|
msgid "Is a root control"
|
|
msgstr "On juurikontrolli"
|
|
|
|
#: lazarusidestrconsts.liscelongparamlistcount
|
|
msgid "Parameters count treated as \"many\""
|
|
msgstr "Parametrien määrä tulkitaan \"monta\""
|
|
|
|
#: lazarusidestrconsts.liscelongprocedures
|
|
msgid "Long procedures"
|
|
msgstr "Pitkät proceduurit"
|
|
|
|
#: lazarusidestrconsts.liscelongproclinecount
|
|
msgid "Line count of procedure treated as \"long\""
|
|
msgstr "Proceduurin rivimäärä tulkitaan \"pitkä\""
|
|
|
|
#: lazarusidestrconsts.liscemanynestedprocedures
|
|
msgid "Many nested procedures"
|
|
msgstr "Monta sisäkkäistä proceduuria"
|
|
|
|
#: lazarusidestrconsts.liscemanyparameters
|
|
msgid "Many parameters"
|
|
msgstr "Monta parametria"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowcategories
|
|
msgid "Show Categories"
|
|
msgstr "Näytä luokat"
|
|
|
|
#: lazarusidestrconsts.liscemodeshowsourcenodes
|
|
msgid "Show Source Nodes"
|
|
msgstr "Näytä lähdesolmut"
|
|
|
|
#: lazarusidestrconsts.liscenestedproccount
|
|
msgid "Nested procedures count treated as \"many\""
|
|
msgstr "Sisäkkäisten proceduurien määrä tulkitaan \"monta\""
|
|
|
|
#: lazarusidestrconsts.liscenteralostwindow
|
|
msgid "Center a lost window"
|
|
msgstr "Keskitä hävinnyt ikkuna"
|
|
|
|
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
|
|
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Keskitä kontrolli vaakatasossa suhteessa annettuun naapuriin. BorderSpacing ei huomioida."
|
|
|
|
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
|
|
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
|
|
msgstr "Keskitä kontrolli pystytasossa suhteessa annettuun naapuriin. BorderSpacing ei huomioida."
|
|
|
|
#: lazarusidestrconsts.liscenterform
|
|
msgid "Center Form"
|
|
msgstr "Keskitä lomake"
|
|
|
|
#: lazarusidestrconsts.liscenterinwindow
|
|
msgid "Center in window"
|
|
msgstr "Keskelle ikkunaa"
|
|
|
|
#: lazarusidestrconsts.liscenters
|
|
msgid "Centers"
|
|
msgstr "Keskilinjat"
|
|
|
|
#: lazarusidestrconsts.lisceomode
|
|
msgid "Preferred exhibition mode"
|
|
msgstr "Suositeltu näytösmoodi"
|
|
|
|
#: lazarusidestrconsts.lisceomodecategory
|
|
msgid "Category"
|
|
msgstr "Luokka"
|
|
|
|
#: lazarusidestrconsts.lisceomodesource
|
|
msgctxt "lazarusidestrconsts.lisceomodesource"
|
|
msgid "Source"
|
|
msgstr "Lähde"
|
|
|
|
#: lazarusidestrconsts.lisceoneveronlymanually
|
|
msgid "Never, only manually"
|
|
msgstr "Ei koskaan, vain erikseen käskettäessä."
|
|
|
|
#: lazarusidestrconsts.lisceonlyusedincategorymode
|
|
msgid "Only used in category mode"
|
|
msgstr "Käytetään vain luokka-tilassa"
|
|
|
|
#: lazarusidestrconsts.lisceoonidle
|
|
msgid "On idle"
|
|
msgstr "Tyhjäkäynnillä"
|
|
|
|
#: lazarusidestrconsts.lisceorefreshautomatically
|
|
msgid "Refresh automatically"
|
|
msgstr "Päivitä automaattisesti"
|
|
|
|
#: lazarusidestrconsts.lisceothergroup
|
|
msgctxt "lazarusidestrconsts.lisceothergroup"
|
|
msgid "Other"
|
|
msgstr "Muu"
|
|
|
|
#: lazarusidestrconsts.lisceoupdate
|
|
msgid "Update"
|
|
msgstr "Päivitä"
|
|
|
|
#: lazarusidestrconsts.lisceowhenswitchingfile
|
|
msgid "When switching file in source editor"
|
|
msgstr "Kun vaihdetaan tiedostoa editorissa"
|
|
|
|
#: lazarusidestrconsts.lisceprocedures
|
|
msgid "Procedures"
|
|
msgstr "Proceduurit"
|
|
|
|
#: lazarusidestrconsts.lisceproperties
|
|
msgctxt "lazarusidestrconsts.lisceproperties"
|
|
msgid "Properties"
|
|
msgstr "Ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
|
|
msgid "Published properties without default"
|
|
msgstr "Julkiset ominaisuudet ilman oletusarvoa"
|
|
|
|
#: lazarusidestrconsts.lisceshowcodeobserver
|
|
msgid "Show observations about"
|
|
msgstr "Näytä havainnot :"
|
|
|
|
#: lazarusidestrconsts.liscestylegroup
|
|
msgctxt "lazarusidestrconsts.liscestylegroup"
|
|
msgid "Style"
|
|
msgstr "Tyyli"
|
|
|
|
#: lazarusidestrconsts.liscesurrounding
|
|
msgid "Surrounding"
|
|
msgstr "Ympäröivä"
|
|
|
|
#: lazarusidestrconsts.liscetodos
|
|
msgid "ToDos"
|
|
msgstr "ToDot"
|
|
|
|
#: lazarusidestrconsts.liscetypes
|
|
msgid "Types"
|
|
msgstr "Tyypit"
|
|
|
|
#: lazarusidestrconsts.lisceunnamedconstants
|
|
msgid "Unnamed constants"
|
|
msgstr "Nimeämättömät vakiot"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedmembers
|
|
msgid "Unsorted members"
|
|
msgstr "Järjestämättömät jäsenet"
|
|
|
|
#: lazarusidestrconsts.lisceunsortedvisibility
|
|
msgid "Unsorted visibility"
|
|
msgstr "Järjestämätön näkyvyys"
|
|
|
|
#: lazarusidestrconsts.lisceuses
|
|
msgctxt "lazarusidestrconsts.lisceuses"
|
|
msgid "Uses"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscevariables
|
|
msgid "Variables"
|
|
msgstr "Muuttujat"
|
|
|
|
#: lazarusidestrconsts.liscewrongindentation
|
|
msgid "Wrong indentation"
|
|
msgstr "Väärä sisennys"
|
|
|
|
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
|
|
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
|
|
msgstr "Keskeytys tapahtui poistettaessa%s\"%s:%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfecancelloadingthisresource
|
|
msgid "Cancel loading this resource"
|
|
msgstr "Peruuta tämän resurssin lataaminen"
|
|
|
|
#: lazarusidestrconsts.liscfeclassnotfound
|
|
msgid "%s%sClass \"%s\" not found."
|
|
msgstr "%s%sLuokkaa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.liscfecomponent
|
|
msgid "%s%sComponent: %s:%s"
|
|
msgstr "%s%sKomponentti: %s:%s"
|
|
|
|
#: lazarusidestrconsts.liscfecomponentclass
|
|
msgid "%s%sComponent Class: %s"
|
|
msgstr "%s%sKomponenttiluokka: %s"
|
|
|
|
#: lazarusidestrconsts.liscfecontinueloading
|
|
msgid "Continue loading"
|
|
msgstr "Jatka lataamista"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
|
|
msgid "Do not know how to copy this form editing selection"
|
|
msgstr "Lomakken valinnan kopiointi ei onnistu"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
|
|
msgid "Do not know how to cut this form editing selection"
|
|
msgstr "Lomakken valinnan leikkaus ei onnistu"
|
|
|
|
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
|
|
msgid "Do not know how to delete this form editing selection"
|
|
msgstr "Lomakken valinnan poistaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
|
|
msgid "Error creating component"
|
|
msgstr "Virhe luotaessa komponenttia"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
|
|
msgid "Error creating component: %s%s%s"
|
|
msgstr "Virhe luotaessa komponenttia: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
|
|
msgid "Error destroying component"
|
|
msgstr "Virhe tuhottaessa komponenttia"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
|
|
msgid "Error destroying component of type %s of unit %s:%s%s"
|
|
msgstr "Virhe tuhottaessa %s tyyppistä komponenttia käännösyksikössä %s:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediator
|
|
msgid "Error destroying mediator"
|
|
msgstr "Virhe välittäjän tuhoamisessa"
|
|
|
|
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
|
|
msgid "Error destroying mediator %s of unit %s:%s%s"
|
|
msgstr "Virhe välittäjän %s käännösyksikössä %s:%s%s tuhoamisessa"
|
|
|
|
#: lazarusidestrconsts.liscfeerrorreading
|
|
msgid "Error reading %s"
|
|
msgstr "Virhe luettaessa %s"
|
|
|
|
#: lazarusidestrconsts.liscfeinfile
|
|
msgid "In file %s"
|
|
msgstr "Tiedostossa %s"
|
|
|
|
#: lazarusidestrconsts.liscfeinvalidcomponentowner
|
|
msgid "Invalid component owner"
|
|
msgstr "Kelvoton komponentin omistaja"
|
|
|
|
#: lazarusidestrconsts.liscferoot
|
|
msgid "%sRoot=%s:%s"
|
|
msgstr "%sJuuri=%s:%s"
|
|
|
|
#: lazarusidestrconsts.liscfestopallloading
|
|
msgid "Stop all loading"
|
|
msgstr "Lopeta kaikki lataaminen"
|
|
|
|
#: lazarusidestrconsts.liscfestream
|
|
msgid "%sStream=%s"
|
|
msgstr "%sVuo=%s"
|
|
|
|
#: lazarusidestrconsts.liscfestreamposition
|
|
msgid "%s%sStream position: %s"
|
|
msgstr "%s%sVuon paikka: %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
|
|
msgid "TCustomFormEditor.CreateNonFormForm already exists"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
|
|
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
|
|
msgstr "TCustomFormEditor.CreateNonFormForm tuntematon tyyppi %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
|
|
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
|
|
msgstr "TCustomFormEditor.DeleteComponent Missä on TCustomNonFormDesignerForm? %s"
|
|
|
|
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
|
|
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
|
|
msgstr "TCustomFormEditor.RegisterDesignerMediator on jo rekisteröity: %s"
|
|
|
|
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
|
|
msgstr "Luokan \"%s\" komponenttieditori on aiheuttanut virheen:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
|
|
msgid "The component of type %s failed to set its owner to %s:%s"
|
|
msgstr "Tyyppiä %s oleva komponentti ei pystynyt asettamaan omistajaksi %s:%s"
|
|
|
|
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
|
|
msgid "Unable to clear the form editing selection%s%s"
|
|
msgstr "Lomakkeen muokkauksen valintaa%s%s ei voi nollata"
|
|
|
|
#: lazarusidestrconsts.lischange
|
|
msgctxt "lazarusidestrconsts.lischange"
|
|
msgid "Change"
|
|
msgstr "Muuta"
|
|
|
|
#: lazarusidestrconsts.lischangebuildmode
|
|
msgid "Change build mode"
|
|
msgstr "Vaihda koontamoodi"
|
|
|
|
#: lazarusidestrconsts.lischangeclass
|
|
msgid "Change Class"
|
|
msgstr "Vaihda luokka"
|
|
|
|
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
|
|
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
|
|
msgstr "Muutettu %s koordinaatti (%s) arvosta \"%d\" arvoon \"%d\" %s:n sisällä."
|
|
|
|
#: lazarusidestrconsts.lischangeencoding
|
|
msgid "Change Encoding"
|
|
msgstr "Vaihda merkkikoodaus"
|
|
|
|
#: lazarusidestrconsts.lischangefile
|
|
msgid "Change file"
|
|
msgstr "Muuta tiedosto"
|
|
|
|
#: lazarusidestrconsts.lischangeparent
|
|
msgid "Change Parent"
|
|
msgstr "Vaihda emokontrollia"
|
|
|
|
#: lazarusidestrconsts.lischangeswerenotsaved
|
|
msgid "Changes were not saved"
|
|
msgstr "Muutoksia ei talletettu"
|
|
|
|
#: lazarusidestrconsts.lischangetounix
|
|
msgid "Change to Unix /"
|
|
msgstr "Vaihda Unixin /"
|
|
|
|
#: lazarusidestrconsts.lischangetowindows
|
|
msgid "Change to Windows \\"
|
|
msgstr "Vaihda Windowsin \\"
|
|
|
|
#: lazarusidestrconsts.lischaracter
|
|
msgid "Character"
|
|
msgstr "Merkki"
|
|
|
|
#: lazarusidestrconsts.lischaractermap
|
|
msgid "Character Map"
|
|
msgstr "Merkkitaulukko"
|
|
|
|
#: lazarusidestrconsts.lischeckall
|
|
msgid "Check All"
|
|
msgstr "Ruksaa kaikki"
|
|
|
|
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
|
|
msgid "Check for disk file changes via content rather than timestamp"
|
|
msgstr "Tarkista tiedoston muutos sisällön eikä aikaleiman perusteella"
|
|
|
|
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
|
|
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
|
|
msgstr ". Tarkista luoko paketti %s %s.ppu:n, tarkista ettei mikään poista tätä tiedostoa ja tarkista ettei usealla paketilla ole oikeutta käännösyksikköön."
|
|
|
|
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
|
|
msgid ". Check if package %s is in the dependencies"
|
|
msgstr ". Tarkista onko riippuvuus pakettiin %s määritelty"
|
|
|
|
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
|
|
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
|
|
msgstr "tarkista onko lähdekoodin seuraava tunnus 'end'. Jos ei, palauta rivinloppu + end; + rivinloppu."
|
|
|
|
#: lazarusidestrconsts.lischeckoptions
|
|
msgid "Check options"
|
|
msgstr "Tarkista asetukset"
|
|
|
|
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
|
|
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
|
|
msgstr ". Tarkista paketin %s hakupolku, yritä puhdasta uudelleen käännöstä, tarkista toteutuksen uses lauseet."
|
|
|
|
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
|
|
msgid "Check the next token in source and add a semicolon if needed."
|
|
msgstr "Tarkista seuraava lähdekoodin tunnus ja lisää puolipiste tarvittaessa."
|
|
|
|
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
|
|
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
|
|
msgstr "%s Tarkista kohde (OS, CPU, LCL widget type). Ehkä paketti pitää kääntää uudelleen kohteelle tai asettaa projektille uusi kohde."
|
|
|
|
#: lazarusidestrconsts.lischeckuncheckall
|
|
msgid "Check/uncheck all"
|
|
msgstr "Valitse/poista valinta, kaikki"
|
|
|
|
#: lazarusidestrconsts.lischooseadifferentname
|
|
msgid "Choose a different name"
|
|
msgstr "Valitse toisenlainen nimi"
|
|
|
|
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
|
|
msgid "Choose a file with CodeTools templates"
|
|
msgstr "Valitse CodeTools-mallitiedosto"
|
|
|
|
#: lazarusidestrconsts.lischooseafpdoclink
|
|
msgid "Choose a FPDoc link"
|
|
msgstr "Valitse FPDoc-linkki"
|
|
|
|
#: lazarusidestrconsts.lischooseakey
|
|
msgid "Choose a key ..."
|
|
msgstr "Valitse näppäin ..."
|
|
|
|
#: lazarusidestrconsts.lischooseanameforthecomponent
|
|
msgid "Choose a name for the component"
|
|
msgstr "Valitse komponentille nimi"
|
|
|
|
#: lazarusidestrconsts.lischooseanexamplefile
|
|
msgid "Choose an example file"
|
|
msgstr "Valitse esimerkkitiedosto"
|
|
|
|
#: lazarusidestrconsts.lischooseanfpcmessagefile
|
|
msgid "Choose an FPC message file"
|
|
msgstr "Valitse FPC-viestitiedosto"
|
|
|
|
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
|
|
msgid "Choose a Pascal file for indentation examples"
|
|
msgstr "Valitse sisennysesimerkiksi Pascal-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilerexecutable
|
|
msgid "Choose compiler executable (%s)"
|
|
msgstr "Valitse kääntäjä (%s)"
|
|
|
|
#: lazarusidestrconsts.lischoosecompilermessages
|
|
msgid "Choose compiler messages file"
|
|
msgstr "Valitse tiedosto kääntäjän viesteille"
|
|
|
|
#: lazarusidestrconsts.lischoosedebuggerexecutable
|
|
msgid "Choose debugger executable"
|
|
msgstr "Valitse virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphipackage
|
|
msgid "Choose Delphi package (*.dpk)"
|
|
msgstr "Valitse Delphi-paketti (*.dpk)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiproject
|
|
msgid "Choose Delphi project (*.dpr)"
|
|
msgstr "Valitse Delphi-projekti (*.dpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosedelphiunit
|
|
msgid "Choose Delphi unit (*.pas)"
|
|
msgstr "Valitse Delphi-käännösyksikkö (*.pas)"
|
|
|
|
#: lazarusidestrconsts.lischoosedirectory
|
|
msgid "Choose directory"
|
|
msgstr "Valitse hakemisto"
|
|
|
|
#: lazarusidestrconsts.lischooseexecutable
|
|
msgid "Choose an executable"
|
|
msgstr "Valitse ohjelma"
|
|
|
|
#: lazarusidestrconsts.lischoosefpcsourcedir
|
|
msgid "Choose FPC source directory"
|
|
msgstr "Valitse FPC:n lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lischooselazarussourcedirectory
|
|
msgid "Choose Lazarus Directory"
|
|
msgstr "Valitse Lazaruksen kansio"
|
|
|
|
#: lazarusidestrconsts.lischoosemakeexecutable
|
|
msgid "Choose \"make\" executable"
|
|
msgstr "Valitse \"make\" ohjelma"
|
|
|
|
#: lazarusidestrconsts.lischoosename
|
|
msgid "Choose name"
|
|
msgstr "Valitse nimi"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
|
|
msgid "Choose one of these items to create a new File"
|
|
msgstr "Valitse jokin näistä kohteista uudeksi tiedostoksi"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
|
|
msgid "Choose one of these items to create a new Package"
|
|
msgstr "Valitse jokin näistä kohteista uudeksi paketiksi"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
|
|
msgid "Choose one of these items to create a new Project"
|
|
msgstr "Valitse jokin näistä kohteista uudeksi projektiksi"
|
|
|
|
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
|
|
msgid "Choose one of these items to inherit from an existing one"
|
|
msgstr "Valitse jokin näistä kohteista periytettäväksi olemassa olevasta"
|
|
|
|
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
|
|
msgid "Choose program source (*.pp,*.pas,*.lpr)"
|
|
msgstr "Valitse ohjelman lähdekoodi (*.pp,*.pas,*.lpr)"
|
|
|
|
#: lazarusidestrconsts.lischoosestructuretoencloseselection
|
|
msgid "Choose structure to enclose selection"
|
|
msgstr "Valitse kapseloiva rakenne"
|
|
|
|
#: lazarusidestrconsts.lischoosetestbuilddir
|
|
msgid "Choose the directory for tests"
|
|
msgstr "Valitse hakemisto testeille"
|
|
|
|
#: lazarusidestrconsts.liscirculardependencydetected
|
|
msgid "Circular dependency detected"
|
|
msgstr "Kehäriippuvuus havaittu"
|
|
|
|
#: lazarusidestrconsts.lisclass
|
|
msgid "&Class"
|
|
msgstr "&Luokka"
|
|
|
|
#: lazarusidestrconsts.lisclasscompletion
|
|
msgid "Class Completion"
|
|
msgstr "Luokan täydennys"
|
|
|
|
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
|
|
msgid "Classes and properties exist. Values were not checked."
|
|
msgstr "Luokkia ja ominaisuuksia on. Arvoja ei tarkistettu."
|
|
|
|
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
|
|
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
|
|
msgstr "Luokka \"%s\" ei ole rekisteröity komponentti-luokka.%sLiittäminen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisclassnotfound
|
|
msgid "Class not found"
|
|
msgstr "Luokkaa ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisclassnotfoundat
|
|
msgid "Class %s not found at %s(%s,%s)"
|
|
msgstr "Luokkaa %s ei löydy: %s(%s,%s)"
|
|
|
|
#: lazarusidestrconsts.lisclassofmethodnotfound
|
|
msgid "Class \"%s\" of method \"%s\" not found."
|
|
msgstr "Metodin \"%s\" luokkaa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.liscldirclean
|
|
msgid "Clean"
|
|
msgstr "Siivoa"
|
|
|
|
#: lazarusidestrconsts.liscldircleandirectory
|
|
msgid "Clean Directory"
|
|
msgstr "Siivoa hakemisto"
|
|
|
|
#: lazarusidestrconsts.liscldircleansubdirectories
|
|
msgid "Clean sub directories"
|
|
msgstr "Siivoa alihakemistot"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepalltextfiles
|
|
msgid "Keep all text files"
|
|
msgstr "Säilytä kaikki tekstitiedostot"
|
|
|
|
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
|
|
msgid "Keep files matching filter"
|
|
msgstr "Säilytä suodattimen mukaiset tiedostot"
|
|
|
|
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
|
|
msgid "Remove files matching filter"
|
|
msgstr "Poista suodattimen mukaiset tiedostot"
|
|
|
|
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
|
|
msgid "Simple Syntax (e.g. * instead of .*)"
|
|
msgstr "Yksinkertainen kielioppi (kuten * eikä .*)"
|
|
|
|
#: lazarusidestrconsts.liscleanall
|
|
msgid "Clean all"
|
|
msgstr "Siivoa kaikki"
|
|
|
|
#: lazarusidestrconsts.liscleancommonfiles
|
|
msgid "Clean common files"
|
|
msgstr "Siivoa yleiset tiedostot"
|
|
|
|
#: lazarusidestrconsts.liscleanlazarussource
|
|
msgid "Clean Lazarus Source"
|
|
msgstr "Siivoa Lazaruksen lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.liscleanonlyonce
|
|
msgid "Switch after building to automatically"
|
|
msgstr "Kokoamisen jälkeen valitse 'Automaattisesti'"
|
|
|
|
#: lazarusidestrconsts.liscleanup
|
|
msgid "Clean up"
|
|
msgstr "Siivoa"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liscleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Siivoa ja kokoa"
|
|
|
|
#: lazarusidestrconsts.liscleanupandbuildproject
|
|
msgid "Clean up and build project"
|
|
msgstr "Siivoa ja kokoa projekti"
|
|
|
|
#: lazarusidestrconsts.liscleanuppackage
|
|
msgid "Clean up package \"%s\"."
|
|
msgstr "Siivoa paketti \"%s\"."
|
|
|
|
#: lazarusidestrconsts.liscleanupunitpath
|
|
msgid "Clean up unit path?"
|
|
msgstr "Siivotaanko käännösyksikköjen polku?"
|
|
|
|
#: lazarusidestrconsts.lisclear
|
|
msgid "Clear"
|
|
msgstr "Tyhjennä"
|
|
|
|
#: lazarusidestrconsts.liscleardirectory
|
|
msgid "Clear Directory?"
|
|
msgstr "Tyhjennä hakemisto?"
|
|
|
|
#: lazarusidestrconsts.lisclearthefilterforoptions
|
|
msgid "Clear the filter for options"
|
|
msgstr "Tyhjennä asetusten suodatin"
|
|
|
|
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
|
|
msgid "Click here to browse the file"
|
|
msgstr "Klikkaa tästä selataksesi tiedostoa"
|
|
|
|
#: lazarusidestrconsts.lisclicktoseethechoices
|
|
msgid "Click to see the choices"
|
|
msgstr "Klikkaa nähdäksesi valinnat"
|
|
|
|
#: lazarusidestrconsts.lisclicktoselectpalettepage
|
|
msgid "Click to Select Palette Page"
|
|
msgstr "Klikkaa valitaksesi paletin sivu"
|
|
|
|
#: lazarusidestrconsts.lisclone
|
|
msgid "Clone"
|
|
msgstr "Kloonaa"
|
|
|
|
#: lazarusidestrconsts.lisclose
|
|
msgctxt "lazarusidestrconsts.lisclose"
|
|
msgid "Close"
|
|
msgstr "Sulje"
|
|
|
|
#: lazarusidestrconsts.liscloseall
|
|
msgctxt "lazarusidestrconsts.liscloseall"
|
|
msgid "Close All"
|
|
msgstr "Sulje kaikki"
|
|
|
|
#: lazarusidestrconsts.liscloseallchecked
|
|
msgid "Close All Checked"
|
|
msgstr "Sulje kaikki ruksatut"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsclose
|
|
msgid "Close files"
|
|
msgstr "Sulje tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabshide
|
|
msgctxt "lazarusidestrconsts.lisclosealltabshide"
|
|
msgid "Hide window"
|
|
msgstr "Piilota ikkuna"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabsquestion
|
|
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
|
|
msgstr "Suljetaan koodieditorin ikkuna. Tahdotko sulkea kaikki tiedostot vai piilottaa ikkunan?"
|
|
|
|
#: lazarusidestrconsts.lisclosealltabstitle
|
|
msgid "Close Source Editor Window"
|
|
msgstr "Sulje koodieditorin ikkuna"
|
|
|
|
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
|
|
msgid "LCL Interface specific options:"
|
|
msgstr "LCL-rajapintaan liittyvät asetukset:"
|
|
|
|
#: lazarusidestrconsts.liscmparameter
|
|
msgid "Parameter"
|
|
msgstr "Parametri"
|
|
|
|
#: lazarusidestrconsts.liscmplstcomponents
|
|
msgctxt "lazarusidestrconsts.liscmplstcomponents"
|
|
msgid "Components"
|
|
msgstr "Komponentit"
|
|
|
|
#: lazarusidestrconsts.liscmplstinheritance
|
|
msgid "Inheritance"
|
|
msgstr "Periytyvyys"
|
|
|
|
#: lazarusidestrconsts.liscmplstlist
|
|
msgid "List"
|
|
msgstr "Luettelo"
|
|
|
|
#: lazarusidestrconsts.liscmplstpalette
|
|
msgid "Palette"
|
|
msgstr "Paletti"
|
|
|
|
#: lazarusidestrconsts.liscmppages
|
|
msgid "Pages"
|
|
msgstr "Sivut"
|
|
|
|
#: lazarusidestrconsts.liscmppalettevisible
|
|
msgid "Palette is &visible"
|
|
msgstr "Paletti &näytetään"
|
|
|
|
#: lazarusidestrconsts.liscmprestoredefaults
|
|
msgid "&Restore defaults"
|
|
msgstr "&Palauta oletukset"
|
|
|
|
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
|
|
msgid "Ambiguous additional compiler config file"
|
|
msgstr "Toinen ristiriitainen kääntäjän asetustiedosto"
|
|
|
|
#: lazarusidestrconsts.liscocallon
|
|
msgid "Call on:"
|
|
msgstr "Kutsu kun:"
|
|
|
|
#: lazarusidestrconsts.liscoclickokifaresuretodothat
|
|
msgid "%s%sClick OK if you definitely want to do that."
|
|
msgstr "%s%sKlikkaa OK jos olet varma."
|
|
|
|
#: lazarusidestrconsts.liscocommand
|
|
msgctxt "lazarusidestrconsts.liscocommand"
|
|
msgid "Command:"
|
|
msgstr "Komento:"
|
|
|
|
#: lazarusidestrconsts.liscode
|
|
msgid "Code"
|
|
msgstr "Koodi"
|
|
|
|
#: lazarusidestrconsts.liscodebrowser
|
|
msgctxt "lazarusidestrconsts.liscodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Koodin selain"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogcaption
|
|
msgid "Code creation options"
|
|
msgstr "Koodin generointi asetukset"
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialogclasssection
|
|
msgid "Class section"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodecreationdialoglocation
|
|
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
|
|
msgid "Location"
|
|
msgstr "Sijainti"
|
|
|
|
#: lazarusidestrconsts.liscodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Koodin tutkija"
|
|
|
|
#: lazarusidestrconsts.liscodegenerationoptions
|
|
msgid "Code generation options"
|
|
msgstr "Koodin generoinnin asetukset"
|
|
|
|
#: lazarusidestrconsts.liscodehelpaddpathbutton
|
|
msgid "Add path"
|
|
msgstr "Lisää polku"
|
|
|
|
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
|
|
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
|
|
msgid "Browse"
|
|
msgstr "Selaa"
|
|
|
|
#: lazarusidestrconsts.liscodehelpconfirmreplace
|
|
msgid "Confirm replace"
|
|
msgstr "Varmista korvaaminen"
|
|
|
|
#: lazarusidestrconsts.liscodehelpcreatebutton
|
|
msgid "Create help item"
|
|
msgstr "Luo ohje"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdeletepathbutton
|
|
msgid "Remove path"
|
|
msgstr "Poista polku"
|
|
|
|
#: lazarusidestrconsts.liscodehelpdescrtag
|
|
msgid "Description"
|
|
msgstr "Selitys"
|
|
|
|
#: lazarusidestrconsts.liscodehelperrorstag
|
|
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
|
|
msgid "Errors"
|
|
msgstr "Virheet"
|
|
|
|
#: lazarusidestrconsts.liscodehelpexampletag
|
|
msgid "Example"
|
|
msgstr "Esimerkki"
|
|
|
|
#: lazarusidestrconsts.liscodehelpgroupbox
|
|
msgid "FPDoc settings"
|
|
msgstr "FPDoc-asetukset"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintboldformat
|
|
msgid "Insert bold formatting tag"
|
|
msgstr "Merkitse muotoiluksi lihavoitu"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintinsertcodetag
|
|
msgid "Insert code formatting tag"
|
|
msgstr "Merkitse muotoiluksi koodi"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintitalicformat
|
|
msgid "Insert italic formatting tag"
|
|
msgstr "Merkitse muotoiluksi kursiivi"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintremarktag
|
|
msgid "Insert remark formatting tag"
|
|
msgstr "Merkitse muotoiluksi huomautus"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintunderlineformat
|
|
msgid "Insert underline formatting tag"
|
|
msgstr "Merkitse muotoiluksi alleviivaus"
|
|
|
|
#: lazarusidestrconsts.liscodehelphintvartag
|
|
msgid "Insert var formatting tag"
|
|
msgstr "Merkitse muotoiluksi var"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinherited
|
|
msgctxt "lazarusidestrconsts.liscodehelpinherited"
|
|
msgid "Inherited"
|
|
msgstr "Periytyneet"
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertalink
|
|
msgid "Insert a link ..."
|
|
msgstr "Lisää linkki ..."
|
|
|
|
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
|
|
msgid "Insert paragraph formatting tag"
|
|
msgstr "Merkitse muotoiluksi kappale"
|
|
|
|
#: lazarusidestrconsts.liscodehelpmainformcaption
|
|
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
|
|
msgid "FPDoc Editor"
|
|
msgstr "FPDoc-muokkain"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
|
|
msgid "(no inherited description found)"
|
|
msgstr "(periytyvää selitystä ei löydy)"
|
|
|
|
#: lazarusidestrconsts.liscodehelpnotagcaption
|
|
msgid "<NONE>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodehelpseealsotag
|
|
msgid "See also"
|
|
msgstr "Katso myös"
|
|
|
|
#: lazarusidestrconsts.liscodehelpshortdescriptionof
|
|
msgid "Short description of"
|
|
msgstr "Lyhyt kuvaus: "
|
|
|
|
#: lazarusidestrconsts.liscodehelpshorttag
|
|
msgid "Short"
|
|
msgstr "Lyhyt"
|
|
|
|
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
|
|
msgid "Ignore constants in next functions"
|
|
msgstr "Älä huomioi vakioita funktioissa"
|
|
|
|
#: lazarusidestrconsts.liscodeobscharconst
|
|
msgid "Search for unnamed char constants"
|
|
msgstr "Etsi nimetöntä merkkivakiota"
|
|
|
|
#: lazarusidestrconsts.liscodeobserver
|
|
msgid "Code Observer"
|
|
msgstr "Koodin havainnoija"
|
|
|
|
#: lazarusidestrconsts.liscodeobsignoreeconstants
|
|
msgid "Ignore next unnamed constants"
|
|
msgstr "Älä huomioi nimettömiä vakioita"
|
|
|
|
#: lazarusidestrconsts.liscodetempladd
|
|
msgid "Add template"
|
|
msgstr "Lisää malline"
|
|
|
|
#: lazarusidestrconsts.liscodetempladdcodetemplate
|
|
msgid "Add code template"
|
|
msgstr "Lisää koodimalline"
|
|
|
|
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
|
|
msgid " A token \"%s\" already exists! "
|
|
msgstr " Tunnus \"%s\" on jo olemassa! "
|
|
|
|
#: lazarusidestrconsts.liscodetemplautocompleteon
|
|
msgid "Auto complete on"
|
|
msgstr "Automaattinen täydennys päällä"
|
|
|
|
#: lazarusidestrconsts.liscodetemplchange
|
|
msgctxt "lazarusidestrconsts.liscodetemplchange"
|
|
msgid "Change"
|
|
msgstr "Muuta"
|
|
|
|
#: lazarusidestrconsts.liscodetemplcomment
|
|
msgid "Comment:"
|
|
msgstr "Kommentti:"
|
|
|
|
#: lazarusidestrconsts.liscodetempleditcodetemplate
|
|
msgid "Edit code template"
|
|
msgstr "Muokkaa koodimallinetta"
|
|
|
|
#: lazarusidestrconsts.liscodetemplerror
|
|
msgctxt "lazarusidestrconsts.liscodetemplerror"
|
|
msgid "Error"
|
|
msgstr "Virhe"
|
|
|
|
#: lazarusidestrconsts.liscodetempltoken
|
|
msgid "Token:"
|
|
msgstr "Tunnus:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsaction
|
|
msgid "Action: %s"
|
|
msgstr "Toiminto: %s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
|
|
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
|
|
msgstr "Automaattisesti luotuja solmuja ei voi muokata,%seikä niillä voi olla automaattisesti luotuja lapsia"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
|
|
msgid "%s, auto generated"
|
|
msgstr "%s, automaattisesti luotu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
|
|
msgid "Auto generated nodes cannot be edited."
|
|
msgstr "Automaattisesti luotuja solmuja ei voi muokata."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsblock
|
|
msgid "Block"
|
|
msgstr "Lohko"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor"
|
|
msgstr "CodeTools määritysten muokkain"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
|
|
msgid "Compiler path"
|
|
msgstr "Kääntäjän polku"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
|
|
msgid "Convert node"
|
|
msgstr "Muunna solmu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
|
|
msgid "Create Defines for %s Directory"
|
|
msgstr "Luo määritykset %s hakemistolle"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
|
|
msgid "Create Defines for Free Pascal Compiler"
|
|
msgstr "Luo määritykset Free Pascal -kääntäjälle"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
|
|
msgid "Create Defines for Free Pascal SVN Sources"
|
|
msgstr "Luo määritykset Free Pascal SVN -koodeille"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
|
|
msgid "Create Defines for %s Project"
|
|
msgstr "Luo määritykset %s projektille"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
|
|
msgid "Create FPC Macros and paths for a fpc project directory"
|
|
msgstr "Luo FPC-makrot ja polut FPC-projektihakemistolle"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefine
|
|
msgid "Define"
|
|
msgstr "Määrite"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
|
|
msgid "Define Recurse"
|
|
msgstr "Rekursiivinen määrite"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
|
|
msgid "Delete node"
|
|
msgstr "Poista solmu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Päähakemisto %s,%sminne Borland on asentanut kaikki %s lähdekoodit.%sEsim.: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
|
|
msgstr "Päähakemisto %s,%sminne Borland on asentanut kaikki %s tämän %s projektin käyttämät lähdekoodit.%s%sEsim.: C:/Programme/Borland/Delphi%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdescription
|
|
msgid "Description:"
|
|
msgstr "Kuvaus:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsdirectory
|
|
msgid "%s directory"
|
|
msgstr "%s hakemisto"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselse
|
|
msgid "Else"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefselseif
|
|
msgid "ElseIf"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
|
|
msgid "Exit without Save"
|
|
msgstr "Poistu tallentamatta"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
|
|
msgid "FPC SVN source directory"
|
|
msgstr "FPC:n SVN-lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsif
|
|
msgid "If"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifdef
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
|
|
msgid "IfDef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsifndef
|
|
msgid "IfNDef"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
|
|
msgid "Directory"
|
|
msgstr "Kansio"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
|
|
msgid "Insert Delphi 5 Compiler Template"
|
|
msgstr "Lisää Delphi 5 -kääntäjän malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
|
|
msgid "Insert Delphi 5 Directory Template"
|
|
msgstr "Lisää Delphi 5 -hakemiston malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
|
|
msgid "Insert Delphi 5 Project Template"
|
|
msgstr "Lisää Delphi 5 -projektin malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
|
|
msgid "Insert Delphi 6 Compiler Template"
|
|
msgstr "Lisää Delphi 6 -kääntäjän malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
|
|
msgid "Insert Delphi 6 Directory Template"
|
|
msgstr "Lisää Delphi 6 -hakemiston malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
|
|
msgid "Insert Delphi 6 Project Template"
|
|
msgstr "Lisää Delphi 6 -projektin malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
|
|
msgid "Insert Delphi 7 Compiler Template"
|
|
msgstr "Lisää Delphi 7 -kääntäjän malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
|
|
msgid "Insert Delphi 7 Directory Template"
|
|
msgstr "Lisää Delphi 7 -hakemiston malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
|
|
msgid "Insert Delphi 7 Project Template"
|
|
msgstr "Lisää Delphi 7 -projektin malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
|
|
msgid "Insert Free Pascal Compiler Template"
|
|
msgstr "Lisää Free Pascal -kääntäjän malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
|
|
msgid "Insert Free Pascal Project Template"
|
|
msgstr "Lisää Free Pascal -projektin malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
|
|
msgid "Insert Free Pascal SVN Source Template"
|
|
msgstr "Lisää Free Pascal SVN -lähdemalline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
|
|
msgid "Insert Kylix 3 Compiler Template"
|
|
msgstr "Lisää Kylix 3 -kääntäjän malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
|
|
msgid "Insert Kylix 3 Directory Template"
|
|
msgstr "Lisää Kylix 3 -hakemiston malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
|
|
msgid "Insert Kylix 3 Project Template"
|
|
msgstr "Lisää Kylix 3 -projektin malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
|
|
msgid "Insert node as child"
|
|
msgstr "Lisää solmu lapsena"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
|
|
msgid "Insert node below"
|
|
msgstr "Lisää solmu alapuolelle"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
|
|
msgid "Insert Template"
|
|
msgstr "Lisää malline"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
|
|
msgid "Invalid parent"
|
|
msgstr "Kelvoton kantaluokka"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
|
|
msgid "Invalid parent node"
|
|
msgstr "Kelvoton kantasolmu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
|
|
msgid "Invalid previous node"
|
|
msgstr "Kelvoton edellinen solmu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
|
|
msgstr "Päähakemisto %s,%sminne Borland on asentanut kaikki %s lähdekoodit.%sEsim.: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
|
|
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
|
|
msgstr "Päähakemisto %s,%sminne Borland on asentanut kaikki %s tämän %s projektin käyttämät lähdekoodit.%s%sEsim.: /home/user/kylix%s"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
|
|
msgid "Move node down"
|
|
msgstr "Siirrä solmua alas"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
|
|
msgid "Move node one level down"
|
|
msgstr "Siirrä solmua pykälä alaspäin"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
|
|
msgid "Move node one level up"
|
|
msgstr "Siirrä solmua pykälä ylöspäin"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
|
|
msgid "Move node up"
|
|
msgstr "Siirrä solmua ylös"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsname
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
|
|
msgid "Name:"
|
|
msgstr "Nimi:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnewnode
|
|
msgid "NewNode"
|
|
msgstr "UusiSolmu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
|
|
msgid "Node is readonly"
|
|
msgstr "Solmu on vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
|
|
msgid "none selected"
|
|
msgstr "solmu valittu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
|
|
msgid "Parent node cannot contain child nodes."
|
|
msgstr "Emosolmu ei voi sisältää lapsi-solmuja"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
|
|
msgid "Previous node can not contain child nodes."
|
|
msgstr "Edellisessä solmussa ei voi olla lapsi-solmuja."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
|
|
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Projektin hakemisto"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
|
|
msgid "%s project directory"
|
|
msgstr "%s projektin hakemisto"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsreaderror
|
|
msgid "Read error"
|
|
msgstr "Lukuvirhe"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
|
|
msgid "Save and Exit"
|
|
msgstr "Tallenna ja poistu"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsselectednode
|
|
msgid "Selected Node:"
|
|
msgstr "Valittu solmu:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
|
|
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
|
|
msgstr "Free Pascal SVN -lähdehakemisto. Ei välttämätön. Auttaa määritysten haussa ja virheenjäljityksessä."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
|
|
msgid "The Free Pascal project directory."
|
|
msgstr "Free Pascal -projektihakemisto."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
|
|
msgid "The Free Pascal SVN source directory."
|
|
msgstr "Free Pascal SVN -lähdehakemisto."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
|
|
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
msgstr "Free Pascal -kääntäjän polku.%s Esim. %s/usr/bin/%s -n%s tai %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
|
|
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
|
|
msgstr "Free Pascal -kääntäjän polku tälle projektille. Tarvitaan vain jos FPC SVN -lähde asetataan (alla). Käytetään makrojen luontiin."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
|
|
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
|
|
msgstr "Free Pascal -kääntäjän polku tälle koodille.%sKäytetään makrojen luontiin."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
|
|
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
|
|
msgstr "Projektin %s hakemisto,%smissä ovat .dpr- ja dpk-tiedostot."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefine
|
|
msgid "Undefine"
|
|
msgstr "Poista määrittely"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefineall
|
|
msgid "Undefine All"
|
|
msgstr "Poista kaikki määrittelyt"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
|
|
msgid "Undefine Recurse"
|
|
msgstr "Poista Recurse-määrittely"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
|
|
msgid "Value as File Paths"
|
|
msgstr "Arvo tiedostopolkuina"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
|
|
msgid "Value as Text"
|
|
msgstr "Arvo tekstinä"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
|
|
msgid "%s:%svalue \"%s\" is invalid."
|
|
msgstr "%s:%sarvo \"%s\" is invalid."
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefsvariable
|
|
msgid "Variable:"
|
|
msgstr "Muuttuja:"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsdefswriteerror
|
|
msgid "Write error"
|
|
msgstr "Tiedoston tallentaminen ei onnistunut"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsat
|
|
msgid "At"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsbracket
|
|
msgid "Bracket"
|
|
msgstr "Sulku"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscaret
|
|
msgid "Caret (^)"
|
|
msgstr "Tekstikursori (^)"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscolon
|
|
msgid "Colon"
|
|
msgstr "Kaksoispiste"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptscomma
|
|
msgid "Comma"
|
|
msgstr "Pilkku"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsidentifier
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Tunniste"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptskeyword
|
|
msgid "Keyword"
|
|
msgstr "Avainsana"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnewline
|
|
msgid "Newline"
|
|
msgstr "Rivinvaihto"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnone
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
|
|
msgid "None"
|
|
msgstr "Ei yhtään"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsnumber
|
|
msgid "Number"
|
|
msgstr "Numero"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptspoint
|
|
msgid "Point"
|
|
msgstr "Piste"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssemicolon
|
|
msgid "Semicolon"
|
|
msgstr "Puolipiste"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsspace
|
|
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
|
|
msgid "Space"
|
|
msgstr "Välilyönti"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptsstringconst
|
|
msgid "String constant"
|
|
msgstr "Tekstivakio"
|
|
|
|
#: lazarusidestrconsts.liscodetoolsoptssymbol
|
|
msgid "Symbol"
|
|
msgstr "Symboli"
|
|
|
|
#: lazarusidestrconsts.liscoexecuteafter
|
|
msgid "Execute after"
|
|
msgstr "Suorita jälkeen"
|
|
|
|
#: lazarusidestrconsts.liscoexecutebefore
|
|
msgid "Execute before"
|
|
msgstr "Suorita ennen"
|
|
|
|
#: lazarusidestrconsts.liscoladdress
|
|
msgid "Address"
|
|
msgstr "Osoite"
|
|
|
|
#: lazarusidestrconsts.liscolclass
|
|
msgid "Class"
|
|
msgstr "Luokka"
|
|
|
|
#: lazarusidestrconsts.liscollapseall
|
|
msgid "Collapse All (/)"
|
|
msgstr "Supista kaikki (/)"
|
|
|
|
#: lazarusidestrconsts.liscollapseallclasses
|
|
msgid "Collapse all classes"
|
|
msgstr "Supista kaikki luokat"
|
|
|
|
#: lazarusidestrconsts.liscollapseallpackages
|
|
msgid "Collapse all packages"
|
|
msgstr "Supista kaikki paketit"
|
|
|
|
#: lazarusidestrconsts.liscollapseallunits
|
|
msgid "Collapse all units"
|
|
msgstr "Supista kaikki käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.liscolreturns
|
|
msgid "Returns"
|
|
msgstr "Palauttaa"
|
|
|
|
#: lazarusidestrconsts.liscolvisibility
|
|
msgid "Visibility"
|
|
msgstr "Näkyvyys"
|
|
|
|
#: lazarusidestrconsts.liscommandafter
|
|
msgid "Command after"
|
|
msgstr "Komento jälkeen"
|
|
|
|
#: lazarusidestrconsts.liscommandafterinvalid
|
|
msgid "Command after invalid"
|
|
msgstr "Komento virheellisen jälkeen"
|
|
|
|
#: lazarusidestrconsts.liscommandafterpublishingmodule
|
|
msgid "Command after publishing module"
|
|
msgstr "Komento julkaistun moduulin jälkeen"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparameters
|
|
msgctxt "lazarusidestrconsts.liscommandlineparameters"
|
|
msgid "Command line parameters"
|
|
msgstr "Komentorivin parametrit"
|
|
|
|
#: lazarusidestrconsts.liscommandlineparamsofprogram
|
|
msgid "Command line parameters of program"
|
|
msgstr "Ohjelman komentorivi-parametrit"
|
|
|
|
#: lazarusidestrconsts.liscompile
|
|
msgctxt "lazarusidestrconsts.liscompile"
|
|
msgid "Compile"
|
|
msgstr "Käännä"
|
|
|
|
#: lazarusidestrconsts.liscompileproject
|
|
msgid "Compile Project"
|
|
msgstr "Käännä projekti"
|
|
|
|
#: lazarusidestrconsts.liscompiler
|
|
msgid "Compiler"
|
|
msgstr "Kääntäjä"
|
|
|
|
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
|
|
msgid "Compiler \"%s\" does not support target %s-%s"
|
|
msgstr "Kääntäjä \"%s\" ei tue kohdetta %s-%s"
|
|
|
|
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
|
|
msgid "Error: invalid compiler: %s"
|
|
msgstr "Virhe: toimimaton kääntäjä: %s"
|
|
|
|
#: lazarusidestrconsts.liscompilerfilename
|
|
msgid "Compiler filename"
|
|
msgstr "Kääntäjän tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
|
|
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
|
|
msgstr "Vihje: voit asettaa kääntäjän hakupolun valikosta Työkalut -> Asetukset -> Tiedostot -> Kääntäjän polku"
|
|
|
|
#: lazarusidestrconsts.liscompilermessagesfilenotfound
|
|
msgid "Compiler messages file not found:%s%s"
|
|
msgstr "Kääntäjän viestien tiedostoa ei löydy:%s%s"
|
|
|
|
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
|
|
msgid "NOTE: codetools config file not found - using defaults"
|
|
msgstr "HUOM: codetools asetustiedostoa ei löydy - käytetään oletuksia"
|
|
|
|
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
|
|
msgid "NOTE: loading old codetools options file: "
|
|
msgstr "Huom. luetaan vanha codetools-asetustiedosto: "
|
|
|
|
#: lazarusidestrconsts.liscompilestage
|
|
msgctxt "lazarusidestrconsts.liscompilestage"
|
|
msgid "Compile"
|
|
msgstr "Käännä"
|
|
|
|
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
|
|
msgid "Compile with -vd for more details. Check for duplicates."
|
|
msgstr "Käännä -vd option kanssa lisätietoa varten. Tarkista duplikaatit."
|
|
|
|
#: lazarusidestrconsts.liscompiling
|
|
msgid "%s (compiling ...)"
|
|
msgstr "%s (käännetään ...)"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttype
|
|
msgid "Show long line hints"
|
|
msgstr "Näytä pitkien rivien vihjeet"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
|
|
msgid "Extend far left"
|
|
msgstr "Laajenna kauas vasemmalle"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
|
|
msgid "Extend some left"
|
|
msgstr "Laajenna vähän vasemmalle"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
|
|
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
|
|
msgid "Never"
|
|
msgstr "Ei koskaan"
|
|
|
|
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
|
|
msgid "Extend right only"
|
|
msgstr "Laajenna vain oikealle"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
|
|
msgid "Component name \"%s\" is a Pascal keyword."
|
|
msgstr "Komponentin nimi \"%s\" on Pascalin avainsana."
|
|
|
|
#: lazarusidestrconsts.liscomponentnameiskeyword
|
|
msgid "Component name \"%s\" is keyword"
|
|
msgstr "Komponentin nimi \"%s\" on avainsana"
|
|
|
|
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
|
|
msgid "Component name \"%s\" is not a valid identifier"
|
|
msgstr "Komponentin nimi \"%s\" ei ole sallittu tunniste"
|
|
|
|
#: lazarusidestrconsts.liscomppalcomponentlist
|
|
msgid "View All"
|
|
msgstr "Näytä kaikki"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenpackage
|
|
msgid "Open package"
|
|
msgstr "Avaa paketti"
|
|
|
|
#: lazarusidestrconsts.liscomppalopenunit
|
|
msgid "Open unit"
|
|
msgstr "Avaa käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.liscomptest
|
|
msgid "&Test"
|
|
msgstr "&Testi"
|
|
|
|
#: lazarusidestrconsts.liscondition
|
|
msgid "Condition"
|
|
msgstr "Ehto"
|
|
|
|
#: lazarusidestrconsts.lisconditionals
|
|
msgctxt "lazarusidestrconsts.lisconditionals"
|
|
msgid "Conditionals"
|
|
msgstr "Ehdolliset"
|
|
|
|
#: lazarusidestrconsts.lisconfigdirectory
|
|
msgid "Lazarus config directory"
|
|
msgstr "Lazaruksen asetushakemisto"
|
|
|
|
#: lazarusidestrconsts.lisconfigfileofadditions
|
|
msgid "Config file of additions:"
|
|
msgstr "Lisäysten asetustiedosto:"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuild
|
|
msgid "Configure Build %s"
|
|
msgstr "Konfiguroi %s:n kokoaminen"
|
|
|
|
#: lazarusidestrconsts.lisconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\""
|
|
msgstr "Konfiguroi \"Lazaruksen kokoaminen\""
|
|
|
|
#: lazarusidestrconsts.lisconfigureeditortoolbar
|
|
msgid "Configure Toolbar"
|
|
msgstr "Konfiguroi työkalupalkki"
|
|
|
|
#: lazarusidestrconsts.lisconfigurelazaruside
|
|
msgid "Configure Lazarus IDE"
|
|
msgstr "Konfiguroi Lazarus IDE"
|
|
|
|
#: lazarusidestrconsts.lisconfirm
|
|
msgid "Confirm"
|
|
msgstr "Varmista"
|
|
|
|
#: lazarusidestrconsts.lisconfirmation
|
|
msgid "Confirmation"
|
|
msgstr "Varmistus"
|
|
|
|
#: lazarusidestrconsts.lisconfirmbuildallprofiles
|
|
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
|
|
msgstr "Lazarus käännetään uudelleen käyttäen profiilia:%sJatketaanko?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmchanges
|
|
msgid "Confirm changes"
|
|
msgstr "Vahvista seuraavat muutokset"
|
|
|
|
#: lazarusidestrconsts.lisconfirmdelete
|
|
msgid "Confirm delete"
|
|
msgstr "Vahvista poisto"
|
|
|
|
#: lazarusidestrconsts.lisconfirmlazarusrebuild
|
|
msgid "Do you want to rebuild Lazarus with profile: %s?"
|
|
msgstr "Haluatko koota Lazaruksen käyttäen profiilia: %s?"
|
|
|
|
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
|
|
msgid "Confirm new package set for the IDE"
|
|
msgstr "Vahvista uusi pakettien joukko IDE:en"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageaction
|
|
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
|
|
msgid "Action"
|
|
msgstr "Toiminta"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
|
|
msgid "New package set"
|
|
msgstr "Uusi pakettien joukko"
|
|
|
|
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
|
|
msgid "Old package set"
|
|
msgstr "Vanha pakettien joukko"
|
|
|
|
#: lazarusidestrconsts.lisconflict
|
|
msgid "Conflict"
|
|
msgstr "Ristiriita"
|
|
|
|
#: lazarusidestrconsts.lisconflictdetected
|
|
msgid "Conflict detected"
|
|
msgstr "Ristiriita havaittu"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplication
|
|
msgid "Console application"
|
|
msgstr "Komentorivisovellus"
|
|
|
|
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
|
|
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
|
|
msgstr "Free Pascal -komentoriviohjelma. Käyttää TCustomApplication-luokkaa parametrien lukemiseen, keskeytysten hallintaan jne."
|
|
|
|
#: lazarusidestrconsts.lisconstructorcode
|
|
msgid "Constructor code"
|
|
msgstr "Constructor koodi"
|
|
|
|
#: lazarusidestrconsts.liscontains
|
|
msgid "contains"
|
|
msgstr "sisältää"
|
|
|
|
#: lazarusidestrconsts.liscontextsensitive
|
|
msgid "Context sensitive"
|
|
msgstr "Tilanteesta riippuva"
|
|
|
|
#: lazarusidestrconsts.liscontinue
|
|
msgctxt "lazarusidestrconsts.liscontinue"
|
|
msgid "Continue"
|
|
msgstr "Jatka"
|
|
|
|
#: lazarusidestrconsts.liscontinueanddonotaskagain
|
|
msgid "Continue and do not ask again"
|
|
msgstr "Jatka äläkä kysy enää"
|
|
|
|
#: lazarusidestrconsts.liscontinuebuilding
|
|
msgid "Continue building"
|
|
msgstr "Jatka kokoamista"
|
|
|
|
#: lazarusidestrconsts.liscontinuewithoutloadingform
|
|
msgid "Continue without loading form"
|
|
msgstr "Jatka lataamatta lomaketta"
|
|
|
|
#: lazarusidestrconsts.liscontributors
|
|
msgid "Contributors"
|
|
msgstr "Tekijät"
|
|
|
|
#: lazarusidestrconsts.liscontrolneedsparent
|
|
msgid "Control needs parent"
|
|
msgstr "Kontrolli tarvitsee emon"
|
|
|
|
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
|
|
msgid "Add comment after replacement"
|
|
msgstr "Lisää kommentti korvaavan jälkeen"
|
|
|
|
#: lazarusidestrconsts.lisconvaddingflagforregister
|
|
msgid "Adding flag for \"Register\" procedure in unit %s."
|
|
msgstr "Lisätään lippu \"Register\" aliohjelmalle käännösyksikössä %s."
|
|
|
|
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
|
|
msgid "\")\" is missing from replacement function: %s"
|
|
msgstr "\")\" puuttuu korvaavasta funktiosta: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvbracketnotfound
|
|
msgid "Bracket not found"
|
|
msgstr "Sulkua ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisconvconvertedfrom
|
|
msgid " { *Converted from %s* }"
|
|
msgstr " { *Muunnettu %s:sta* }"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordhint
|
|
msgid "An offset is added to Top coordinate of controls inside visual containers"
|
|
msgstr "Siirtymä lisätään komponentin Top koordinaattiin"
|
|
|
|
#: lazarusidestrconsts.lisconvcoordoffs
|
|
msgid "Coordinate offsets"
|
|
msgstr "Koordinaattien siirtymä"
|
|
|
|
#: lazarusidestrconsts.lisconvdeletedfile
|
|
msgid "Deleted file %s"
|
|
msgstr "Poistettu tiedosto %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
|
|
msgid "Added defines %s in custom options"
|
|
msgstr "Lisätty määritteet %s mukautettuihin asetuksiin"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
|
|
msgid "Added Package %s as a dependency."
|
|
msgstr "Lisätty riippuvuus pakettiin %s."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
|
|
msgid "Added unit \"%s\" to uses section."
|
|
msgstr "Lisätty käännösyksikkö \"%s\" uses-lauseeseen."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
|
|
msgid "All sub-directories will be scanned for unit files"
|
|
msgstr "Käännösyksiköitä etsitään kaikista alihakemistoista"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
|
|
msgid "BeginCodeTools failed!"
|
|
msgstr "BeginCodeTools epäonnistui!"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphicategories
|
|
msgid "Categories:"
|
|
msgstr "Luokat"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
|
|
msgid "Changed encoding from %s to UTF-8"
|
|
msgstr "Muutettu merkkikoodaus %s:sta UTF-8:ksi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionaborted
|
|
msgid "Conversion Aborted."
|
|
msgstr "Muunnos on keskeytetty."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversionready
|
|
msgid "Conversion Ready."
|
|
msgstr "Muunnos on valmis."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconversiontook
|
|
msgid "Conversion took: %s"
|
|
msgstr "Muunnos kesti: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
|
|
msgid "Convert Delphi package"
|
|
msgstr "Muunna Delphi-paketti"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
|
|
msgid "Convert Delphi project"
|
|
msgstr "Muunna Delphi-projekti"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
|
|
msgid "Convert Delphi unit"
|
|
msgstr "Muunna Delphi-käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
|
|
msgid "*** Converting unit files found during conversion ***"
|
|
msgstr "*** Muunnetaan muunnoksen aikana löytyneet käännösyksiköt ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
|
|
msgid "*** Converting unit files belonging to project/package ***"
|
|
msgstr "*** Muunnetaan projektiin/pakettiin kuuluvat käännösyksiköt ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphierror
|
|
msgid "Error=\"%s\""
|
|
msgstr "Virhe=\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
|
|
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
|
|
msgstr "Keskeytys tapahtui kesken käännösyksikön muunnoksen. Jatketaan lomakkeiden kanssa..."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
|
|
msgid "Failed converting unit"
|
|
msgstr "Käännösyksikön muunnos epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
|
|
msgid "Failed to convert unit \"%s\""
|
|
msgstr "käännösyksikön \"%s\" muunnos epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifixedunitcase
|
|
msgid "Fixed character case of unit \"%s\" to \"%s\"."
|
|
msgstr "Korjattu kirjainkoko käännösyksikössä \"%s\". Uusi: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
|
|
msgid "Found all unit files"
|
|
msgstr "Kaikki käännösyksiköt löytyivät"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphifunc
|
|
msgid "Delphi Function"
|
|
msgstr "Delphi-funktio"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphimissingincludefile
|
|
msgid "%s(%s,%s) missing include file"
|
|
msgstr "%s(%s,%s) puuttuva include-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiname
|
|
msgid "Delphi Name"
|
|
msgstr "Delphi-nimi"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagenameexists
|
|
msgid "Package name exists"
|
|
msgstr "Paketti tuolla nimellä on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphipackagerequired
|
|
msgid "Package %s is required but not installed in Lazarus! Install it later."
|
|
msgstr "Paketti %s tarvitaan, muttei ole asennettu Lazarukseen! Asenna myöhemmin."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
|
|
msgid "Omitted unit %s from project"
|
|
msgstr "Käännösyksikkö %s jätettiin pois projektista"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
|
|
msgid "Removed unit \"%s\" from uses section."
|
|
msgstr "Poistettu käännösyksikkö \"%s\" uses-lauseesta."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
|
|
msgid "*** Fixing used units and Repairing form files ***"
|
|
msgstr "*** Korjataan käytettyjä käännösyksiköitä ja lomakkeita ... ***"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
|
|
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
|
|
msgstr "Korvattu käännösyksikkö \"%s\" \"%s\":lla uses-lauseessa."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
|
|
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
|
|
msgstr "\"%s\" niminen paketti on jo olemassa.%sSulje se ensin."
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
|
|
msgid "Unitname exists in LCL"
|
|
msgstr "Käännösyksikön nimi on LCL:ssä"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
|
|
msgid "Units to replace in %s"
|
|
msgstr "Nämä käännösyksiköt korvataan %s:ssa"
|
|
|
|
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
|
|
msgid "LCL already has a unit with name %s. Delete local file %s?"
|
|
msgstr "LCL:ssä on jo käännösyksikkö %s. Poista paikallinen tiedosto %s?"
|
|
|
|
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
|
|
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
|
|
msgstr ".dproj ei ole tuettu vielä. Sitä käyttää Delphi 2007 ja uudemmat. Valitse projektin .dpr tai paketin .dpk tiedosto."
|
|
|
|
#: lazarusidestrconsts.lisconversionerror
|
|
msgid "Conversion error"
|
|
msgstr "Virhe muunnoksessa"
|
|
|
|
#: lazarusidestrconsts.lisconvert
|
|
msgid "Convert"
|
|
msgstr "Muunna"
|
|
|
|
#: lazarusidestrconsts.lisconvertencoding
|
|
msgid "Convert Encoding"
|
|
msgstr "Muunna merkkikoodaus"
|
|
|
|
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
|
|
msgid "Convert encoding of projects/packages"
|
|
msgstr "Muunna projektin/paketin merkkikoodaus"
|
|
|
|
#: lazarusidestrconsts.lisconvertotherhint
|
|
msgid "Other options affecting the conversion"
|
|
msgstr "Muut muunnokseen vaikuttavat asetukset"
|
|
|
|
#: lazarusidestrconsts.lisconvertprojectorpackage
|
|
msgid "Convert project or package"
|
|
msgstr "Muunna projekti tai paketti"
|
|
|
|
#: lazarusidestrconsts.lisconverttarget
|
|
msgid "Target"
|
|
msgstr "Kohde"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatform
|
|
msgid "Cross-platform"
|
|
msgstr "Monen järjestelmän tuki"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
|
|
msgid "Cross-platform versus Windows-only"
|
|
msgstr "Monta järjestelmää / vain Windows"
|
|
|
|
#: lazarusidestrconsts.lisconverttargethint
|
|
msgid "Converter adds conditional compilation to support different targets"
|
|
msgstr "Muunnin lisää ehdollista koodia (IFDEF) tukeakseen eri alustoja"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfile
|
|
msgid "Use the same DFM form file"
|
|
msgstr "Käytä samaa DFM-lomaketiedostoa"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
|
|
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
|
|
msgstr "Sama DFM-lomake Lazaruksen ja Delphin käyttöön. Ei kopioida LFM-lomakkeeksi"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphi
|
|
msgid "Support Delphi"
|
|
msgstr "Tue Delphiä"
|
|
|
|
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
|
|
msgid "Use conditional compilation to support Delphi"
|
|
msgstr "Käytä ehdollista koodia (IFDEF) niin että koodi kääntyy myös Delphillä"
|
|
|
|
#: lazarusidestrconsts.lisconvfixedunitname
|
|
msgid "Fixed unit name from %s to %s."
|
|
msgstr "Korjattu käännösyksikön nimi %s:sta to %s:ksi."
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplacements
|
|
msgid "Function Replacements"
|
|
msgstr "Funktioiden korvaaminen"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncreplhint
|
|
msgid "Some Delphi functions can be replaced with LCL function"
|
|
msgstr "Jotkut Delphin-funktiot voidaan korvata LCL-funktioilla"
|
|
|
|
#: lazarusidestrconsts.lisconvfuncstoreplace
|
|
msgid "Functions / procedures to replace"
|
|
msgstr "Korvattavat funktiot"
|
|
|
|
#: lazarusidestrconsts.lisconvleftoff
|
|
msgid "Left offset"
|
|
msgstr "Siirtymä vasemmalle"
|
|
|
|
#: lazarusidestrconsts.lisconvnewname
|
|
msgid "New Name"
|
|
msgstr "Uusi nimi"
|
|
|
|
#: lazarusidestrconsts.lisconvparentcontainer
|
|
msgid "Parent Container"
|
|
msgstr "Emosäiliö"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfindingallunits
|
|
msgid "Problems when trying to find all units from project file %s"
|
|
msgstr "Ongelmia löytää kaikki käännösyksiköt projekti-tiedostosta %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
|
|
msgid "Problems when fixing include files in file %s"
|
|
msgstr "Ongelmia korjattaessa include-tiedostot tiedostossa %s"
|
|
|
|
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
|
|
msgid "Problems when repairing form file %s"
|
|
msgstr "Ongelmia korjattaessa lomaketta %s"
|
|
|
|
#: lazarusidestrconsts.lisconvrepairingincludefiles
|
|
msgid "Repairing include files : "
|
|
msgstr "Korjataan include-tiedostoja : "
|
|
|
|
#: lazarusidestrconsts.lisconvreplacedcall
|
|
msgid "Replaced call %s with %s"
|
|
msgstr "Korvataan kutsu %s kutsulla %s"
|
|
|
|
#: lazarusidestrconsts.lisconvreplfuncparameternum
|
|
msgid "Replacement function parameter number should be >= 1: %s"
|
|
msgstr "Korvaava funktio parametrin numero pitää olla >= 1: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
|
|
msgid "\"$\" should be followed by a number: %s"
|
|
msgstr "\"$\" jälkeen pitää tulla numero: %s"
|
|
|
|
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
|
|
msgid "Stopped because there already is a package with the same name"
|
|
msgstr "Keskeytettiin koska samanniminen paketti on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisconvthislogwassaved
|
|
msgid "This log was saved to %s"
|
|
msgstr "Tämä loki talletettiin tiedostoon %s"
|
|
|
|
#: lazarusidestrconsts.lisconvtopoff
|
|
msgid "Top offset"
|
|
msgstr "Siirtymä ylös"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplacements
|
|
msgid "Type Replacements"
|
|
msgstr "Tyyppien korvaaminen"
|
|
|
|
#: lazarusidestrconsts.lisconvtypereplhint
|
|
msgid "Unknown types in form file (DFM/LFM)"
|
|
msgstr "Tuntemattomia tyyppejä lomakkeessa (DFM/LFM)"
|
|
|
|
#: lazarusidestrconsts.lisconvtypestoreplace
|
|
msgid "Types to replace"
|
|
msgstr "Korvattavat tyypit"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplacements
|
|
msgid "Unit Replacements"
|
|
msgstr "Käännösyksiköiden korvaaminen"
|
|
|
|
#: lazarusidestrconsts.lisconvunitreplhint
|
|
msgid "Unit names in uses section of a source unit"
|
|
msgstr "Käännösyksiköiden nimet lähdekoodin uses-lauseessa"
|
|
|
|
#: lazarusidestrconsts.lisconvunitstoreplace
|
|
msgid "Units to replace"
|
|
msgstr "Korvattavat käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisconvunknownprops
|
|
msgid "Unknown properties"
|
|
msgstr "Tuntemattomat ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
|
|
msgid "User selected to end conversion with file %s"
|
|
msgstr "Käyttäjä päätti lopettaa muunnoksen tiedostoon %s"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddconfigdelete
|
|
msgid "Add/Config/Delete Toolbar(s)"
|
|
msgstr "Lisää/muokkaa/poista työkalupalkki"
|
|
|
|
#: lazarusidestrconsts.liscoolbaradddivider
|
|
msgid "Add Divider"
|
|
msgstr "Lisää erotin"
|
|
|
|
#: lazarusidestrconsts.liscoolbaraddselected
|
|
msgid "Add selected item to toolbar"
|
|
msgstr "Lisää valitut kohdat työkalupalkkiin"
|
|
|
|
#: lazarusidestrconsts.liscoolbaravailablecommands
|
|
msgid "Available commands"
|
|
msgstr "Tarjolla olevat komennot"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyle
|
|
msgid "Toolbars border style"
|
|
msgstr "Työkalupalkin kehyksen tyyli"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem0
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
|
|
msgid "None"
|
|
msgstr "Ei yhtään"
|
|
|
|
#: lazarusidestrconsts.liscoolbarborderstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
|
|
msgid "Single"
|
|
msgstr "Yksittäinen"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodeexplorer
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Koodin tutkija"
|
|
|
|
#: lazarusidestrconsts.liscoolbarcodetemplates
|
|
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
|
|
msgid "Code Templates"
|
|
msgstr "Koodimallit"
|
|
|
|
#: lazarusidestrconsts.liscoolbarconfigure
|
|
msgid "&Configure"
|
|
msgstr "&Konfiguroi"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletetoolbar
|
|
msgid "Are you sure you want to delete the selected toolbar?"
|
|
msgstr "Haluatko varmasti poistaa valitun työkalupalkin?"
|
|
|
|
#: lazarusidestrconsts.liscoolbardeletewarning
|
|
msgid "There must be at least one toolbar!"
|
|
msgstr "Vähintään yksi työkalupalkki tarvitaan!"
|
|
|
|
#: lazarusidestrconsts.liscoolbardesigner
|
|
msgid "Designer"
|
|
msgstr "Lomake-editori"
|
|
|
|
#: lazarusidestrconsts.liscoolbargeneralsettings
|
|
msgid "General Coolbar Settings"
|
|
msgstr "Yleiset Coolbar asetukset"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyle
|
|
msgid "Toolbars grab style"
|
|
msgstr "Työkalupalkin tarttumistyyli"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem0
|
|
msgid "Simple"
|
|
msgstr "Yksinkertainen"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem1
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
|
|
msgid "Double"
|
|
msgstr "Kaksois"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem2
|
|
msgid "HorLines"
|
|
msgstr "Vaakaviivat"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem3
|
|
msgid "VerLines"
|
|
msgstr "Pystyviivat"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem4
|
|
msgid "Gripper"
|
|
msgstr "Pihdit"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabstyleitem5
|
|
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
|
|
msgid "Button"
|
|
msgstr "Nappi"
|
|
|
|
#: lazarusidestrconsts.liscoolbargrabwidth
|
|
msgid "Grab width"
|
|
msgstr "Tarttumisleveys"
|
|
|
|
#: lazarusidestrconsts.liscoolbaridemainmenu
|
|
msgid "IDE Main Menu"
|
|
msgstr "IDE päävalikko"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmessages
|
|
msgctxt "lazarusidestrconsts.liscoolbarmessages"
|
|
msgid "Messages"
|
|
msgstr "Viestit"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselecteddown
|
|
msgid "Move selected toolbar item down"
|
|
msgstr "Siirrä valittu työkalupalkin kohta alas"
|
|
|
|
#: lazarusidestrconsts.liscoolbarmoveselectedup
|
|
msgid "Move selected toolbar item up"
|
|
msgstr "Siirrä valittu työkalupalkin kohta ylös"
|
|
|
|
#: lazarusidestrconsts.liscoolbaroptions
|
|
msgid "IDE CoolBar"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditor
|
|
msgid "Package Editor"
|
|
msgstr "Pakettimuokkain"
|
|
|
|
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
|
|
msgid "Package Editor Files"
|
|
msgstr "Pakettimuokkaimen tiedostot"
|
|
|
|
#: lazarusidestrconsts.liscoolbarremoveselected
|
|
msgid "Remove selected item from toolbar"
|
|
msgstr "Poista valittu kohta työkalupalkista"
|
|
|
|
#: lazarusidestrconsts.liscoolbarrestoredefaults
|
|
msgid "Restore defaults"
|
|
msgstr "Palauta oletukset"
|
|
|
|
#: lazarusidestrconsts.liscoolbarselecttoolbar
|
|
msgid "Please select a toolbar first!"
|
|
msgstr "Valitse ensin työkalupalkki!"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourceeditor
|
|
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Lähdekoodieditori"
|
|
|
|
#: lazarusidestrconsts.liscoolbarsourcetab
|
|
msgid "Source Tab"
|
|
msgstr "Lähdekoodin välilehti"
|
|
|
|
#: lazarusidestrconsts.liscoolbartoolbarcommands
|
|
msgid "Toolbar commands"
|
|
msgstr "Työkalupalkin komennot"
|
|
|
|
#: lazarusidestrconsts.liscoolbarvisible
|
|
msgid "Coolbar is &visible"
|
|
msgstr "Coolbar &näytetään"
|
|
|
|
#: lazarusidestrconsts.liscoolbarwidth
|
|
msgid "Coolbar width"
|
|
msgstr "Coolbar leveys"
|
|
|
|
#: lazarusidestrconsts.liscopy
|
|
msgctxt "lazarusidestrconsts.liscopy"
|
|
msgid "Copy"
|
|
msgstr "Kopioi"
|
|
|
|
#: lazarusidestrconsts.liscopyall
|
|
msgid "Copy All"
|
|
msgstr "Kopioi kaikki"
|
|
|
|
#: lazarusidestrconsts.liscopyallitemstoclipboard
|
|
msgid "Copy All Items to Clipboard"
|
|
msgstr "Kopioi kaikki leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
|
|
msgid "Copy All/Original Messages to Clipboard"
|
|
msgstr "Kopioi kaikki/alkuperäiset viestit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyalloutputclipboard
|
|
msgid "Copy all output to clipboard"
|
|
msgstr "Kopioi kaikki tulostus leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
|
|
msgid "Copy All Shown Messages to Clipboard"
|
|
msgstr "Kopioi kaikki näytetyt viestit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopydescription
|
|
msgid "Copy description to clipboard"
|
|
msgstr "Kopioi selitys leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyerror
|
|
msgid "Copy Error"
|
|
msgstr "Kopiointivirhe"
|
|
|
|
#: lazarusidestrconsts.liscopyerror2
|
|
msgid "Copy error"
|
|
msgstr "Kopiointivirhe"
|
|
|
|
#: lazarusidestrconsts.liscopyfilename
|
|
msgid "Copy Filename %s"
|
|
msgstr "Kopioi tiedostonimi %s"
|
|
|
|
#: lazarusidestrconsts.liscopyfilenametoclipboard
|
|
msgid "Copy File Name to Clipboard"
|
|
msgstr "Kopioi tiedostonimi leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyidentifier
|
|
msgid "Copy \"%s\" to clipboard"
|
|
msgstr "Kopioi \"%s\" leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
|
|
msgid "Copying a whole form is not implemented."
|
|
msgstr "Kokonaisen lomakkeen kopiointia ei tueta."
|
|
|
|
#: lazarusidestrconsts.liscopyitemtoclipboard
|
|
msgid "Copy Item to Clipboard"
|
|
msgstr "Kopioi leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopymovefiletodirectory
|
|
msgid "Copy/Move File to Directory"
|
|
msgstr "Kopioi/Siirrä tiedosto hakemistoon"
|
|
|
|
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
|
|
msgid "Copy Selected Items to Clipboard"
|
|
msgstr "Kopioi valitut leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
|
|
msgid "Copy Selected Messages to Clipboard"
|
|
msgstr "Kopioi valitut viestit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liscoscanforfpcmessages
|
|
msgid "Scan for FPC messages"
|
|
msgstr "Tutki FPC-viestit"
|
|
|
|
#: lazarusidestrconsts.liscoscanformakemessages
|
|
msgid "Scan for Make messages"
|
|
msgstr "Tutki Make-viestit"
|
|
|
|
#: lazarusidestrconsts.liscoscanformessages
|
|
msgid "Scan for messages:"
|
|
msgstr "Tutki viestit:"
|
|
|
|
#: lazarusidestrconsts.liscoskipcallingcompiler
|
|
msgid "Skip calling compiler"
|
|
msgstr "Ohita kääntäjän kutsu"
|
|
|
|
#: lazarusidestrconsts.liscouldnotadditomainsource
|
|
msgid "Could not add \"{$I %s}\" to main source!"
|
|
msgstr "\"{$I %s}\" lisäys päälähdekoodiin ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddrtomainsource
|
|
msgid "Could not add \"{$R %s}\" to main source!"
|
|
msgstr "\"{$R %s}\" lisäys päälähdekoodiin ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscouldnotaddtomainsource
|
|
msgid "Could not add \"%s\" to main source!"
|
|
msgstr "\"%s\" lisäys päälähdekoodiin ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscouldnotremovefrommainsource
|
|
msgid "Could not remove \"%s\" from main source!"
|
|
msgstr "\"%s\" poisto päälähdekoodista ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
|
|
msgid "Could not remove \"{$I %s}\" from main source!"
|
|
msgstr "\"{$I %s}\" poisto päälähdekoodista ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
|
|
msgid "Could not remove \"{$R %s}\" from main source!"
|
|
msgstr "\"{$R %s}\" poisto päälähdekoodista ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
|
|
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
|
|
msgstr "Kääntäjän lisäasetustiedostolla on sama nimi kuin Free Pascal kääntäjän omalla tiedostolla. Sen johdosta ehkä VAIN lisäasetukset luetaan ja perusasetukset jäävät pois."
|
|
|
|
#: lazarusidestrconsts.liscpopenpackage
|
|
msgid "Open Package %s"
|
|
msgstr "Avaa paketti %s"
|
|
|
|
#: lazarusidestrconsts.liscpopenunit
|
|
msgid "Open Unit %s"
|
|
msgstr "Avaa käännösyksikkö %s"
|
|
|
|
#: lazarusidestrconsts.liscpu
|
|
msgid ", CPU: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liscreateaprojectfirst
|
|
msgid "Create a project first!"
|
|
msgstr "Luo ensin projekti!"
|
|
|
|
#: lazarusidestrconsts.liscreatedebugandreleasemodes
|
|
msgid "Create Debug and Release modes"
|
|
msgstr "Luo Debug ja Release moodit"
|
|
|
|
#: lazarusidestrconsts.liscreatedirectory
|
|
msgid "Create directory?"
|
|
msgstr "Luo hakemisto?"
|
|
|
|
#: lazarusidestrconsts.liscreatefilter
|
|
msgid "Create Filter"
|
|
msgstr "Luo suodatin"
|
|
|
|
#: lazarusidestrconsts.liscreatefunction
|
|
msgid "Create function"
|
|
msgstr "Luo funktio"
|
|
|
|
#: lazarusidestrconsts.liscreatehelpnode
|
|
msgid "Create Help node"
|
|
msgstr "Luo ohje-solmu"
|
|
|
|
#: lazarusidestrconsts.liscreateit
|
|
msgid "Create it"
|
|
msgstr "Luo se"
|
|
|
|
#: lazarusidestrconsts.liscreatelocalvariable
|
|
msgid "Create local variable \"%s\""
|
|
msgstr "Luo paikallinen muuttuja \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscreatenewaddition
|
|
msgid "Create new addition"
|
|
msgstr "Luo uusi lisäys"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackage
|
|
msgid "(Create new package)"
|
|
msgstr "(Luo uusi paketti)"
|
|
|
|
#: lazarusidestrconsts.liscreatenewpackagecomponent
|
|
msgid "Create new package component"
|
|
msgstr "Luo uusi paketin komponentti"
|
|
|
|
#: lazarusidestrconsts.liscreateproject
|
|
msgid "Create project"
|
|
msgstr "Luo projekti"
|
|
|
|
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
|
|
msgid "Create/update .po file when saving a lfm file"
|
|
msgstr "Luo tai päivitä .po-tiedosto, kun lfm-tiedosto talletetaan"
|
|
|
|
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
|
|
msgid "Creating file index of FPC sources %s ..."
|
|
msgstr "Luodaan tiedostoluetteloa FPC:n lähdekoodista %s ..."
|
|
|
|
#: lazarusidestrconsts.liscsbottom
|
|
msgctxt "lazarusidestrconsts.liscsbottom"
|
|
msgid "Bottom"
|
|
msgstr "Alhaalla"
|
|
|
|
#: lazarusidestrconsts.liscstop
|
|
msgctxt "lazarusidestrconsts.liscstop"
|
|
msgid "Top"
|
|
msgstr "Ylhäällä"
|
|
|
|
#: lazarusidestrconsts.lisctdefchoosedirectory
|
|
msgid "Choose Directory"
|
|
msgstr "Valitse hakemisto"
|
|
|
|
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
|
|
msgid "CodeTools Directory Values"
|
|
msgstr "CodeTools-hakemiston arvot"
|
|
|
|
#: lazarusidestrconsts.lisctdefdefinetemplates
|
|
msgid "Define templates"
|
|
msgstr "Määritemallit"
|
|
|
|
#: lazarusidestrconsts.lisctdefnovariableselected
|
|
msgid "<no variable selected>"
|
|
msgstr "<muuttujaa ei ole valittuna>"
|
|
|
|
#: lazarusidestrconsts.lisctdefsopenpreview
|
|
msgid "Open Preview"
|
|
msgstr "Avaa esikatselu"
|
|
|
|
#: lazarusidestrconsts.lisctdefstools
|
|
msgid "Tools"
|
|
msgstr "Työkalut"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariable
|
|
msgid "Variable: %s"
|
|
msgstr "Muuttuja: %s"
|
|
|
|
#: lazarusidestrconsts.lisctdefvariablename
|
|
msgid "Variable Name"
|
|
msgstr "Muuttujan nimi"
|
|
|
|
#: lazarusidestrconsts.lisctdtemplates
|
|
msgid "Templates"
|
|
msgstr "Mallit"
|
|
|
|
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
|
|
msgid "Update all method signatures"
|
|
msgstr "Päivitä kaikki metodien määritykset"
|
|
|
|
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
|
|
msgid "Update multiple procedure signatures"
|
|
msgstr "Päivitä monen metodin määritykset"
|
|
|
|
#: lazarusidestrconsts.lisctpleaseselectamacro
|
|
msgid "please select a macro"
|
|
msgstr "valitse makro"
|
|
|
|
#: lazarusidestrconsts.lisctselectcodemacro
|
|
msgid "Select Code Macro"
|
|
msgstr "Valitse koodimakro"
|
|
|
|
#: lazarusidestrconsts.liscurrent
|
|
msgctxt "lazarusidestrconsts.liscurrent"
|
|
msgid "Current"
|
|
msgstr "Nykyinen"
|
|
|
|
#: lazarusidestrconsts.liscurrentlclwidgetset
|
|
msgid "Current LCL widgetset: \"%s\""
|
|
msgstr "Nykyinen LCL widgetset: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liscurrentstate
|
|
msgid "Current state: "
|
|
msgstr "Nykyinen tila: "
|
|
|
|
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
|
|
msgid "Cursor column in current editor"
|
|
msgstr "Kursorin sarake nykyisessä editorissa"
|
|
|
|
#: lazarusidestrconsts.liscursorrowincurrenteditor
|
|
msgid "Cursor row in current editor"
|
|
msgstr "Kursorin rivi nykyisessä editorissa"
|
|
|
|
#: lazarusidestrconsts.liscustomopthint
|
|
msgid "These options are passed to the compiler after macros are replaced."
|
|
msgstr "Nämä asetukset viedään kääntäjälle, kun makrot on korvattu."
|
|
|
|
#: lazarusidestrconsts.liscustomoptions
|
|
msgid "custom options"
|
|
msgstr "mukautetut asetukset"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions2
|
|
msgid "Custom options"
|
|
msgstr "Mukautetut asetukset"
|
|
|
|
#: lazarusidestrconsts.liscustomoptions3
|
|
msgid "Custom Options"
|
|
msgstr "Lisäasetukset"
|
|
|
|
#: lazarusidestrconsts.liscustomprogram
|
|
msgid "Custom Program"
|
|
msgstr "Mukautettu ohjelma"
|
|
|
|
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
|
|
msgid "A Custom Free Pascal program."
|
|
msgstr "Mukautettu Free Pascal -ohjelma."
|
|
|
|
#: lazarusidestrconsts.liscut
|
|
msgctxt "lazarusidestrconsts.liscut"
|
|
msgid "Cut"
|
|
msgstr "Leikkaa"
|
|
|
|
#: lazarusidestrconsts.lisdadattach
|
|
msgid "Attach"
|
|
msgstr "Liitä"
|
|
|
|
#: lazarusidestrconsts.lisdadimagename
|
|
msgid "Image Name"
|
|
msgstr "Kuvan nimi"
|
|
|
|
#: lazarusidestrconsts.lisdadpid
|
|
msgid "PID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdadrunningprocesses
|
|
msgid "Running Processes"
|
|
msgstr "Käynnissä olevat prosessit"
|
|
|
|
#: lazarusidestrconsts.lisdatamodule
|
|
msgid "Data Module"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdate
|
|
msgid "Date"
|
|
msgstr "Päiväys"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdelete
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
|
|
msgid "Delete all"
|
|
msgstr "Poista kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
|
|
msgid "Delete all"
|
|
msgstr "Poista kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
|
|
msgid "Disable all"
|
|
msgstr "Estä kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
|
|
msgid "Disable all"
|
|
msgstr "Estä kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
|
|
msgid "Enable all"
|
|
msgstr "Salli kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgallitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
|
|
msgid "Enable all"
|
|
msgstr "Salli kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
|
|
msgid "Copy to Clipboard"
|
|
msgstr "Kopioi leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
|
|
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr "Keskeytyskohdan ominaisuudet ..."
|
|
|
|
#: lazarusidestrconsts.lisdbgemexpression
|
|
msgid "&Expression:"
|
|
msgstr "&Ilmaisu:"
|
|
|
|
#: lazarusidestrconsts.lisdbgemnewvalue
|
|
msgid "&New value:"
|
|
msgstr "&Uusi arvo:"
|
|
|
|
#: lazarusidestrconsts.lisdbgemresult
|
|
msgid "&Result:"
|
|
msgstr "&Lopputulos:"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
|
|
msgid "Breakpoint Evaluation"
|
|
msgstr "Keskeytyskohdan määritys"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointhit
|
|
msgid "Breakpoint Hit"
|
|
msgstr "Keskeytyskohdan osuma"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointmessage
|
|
msgid "Breakpoint Message"
|
|
msgstr "Keskeytyskohdan viesti"
|
|
|
|
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
|
|
msgid "Breakpoint Stack Dump"
|
|
msgstr "Keskeytyskohdan pinolistaus"
|
|
|
|
#: lazarusidestrconsts.lisdbgendefaultcolor
|
|
msgid "Default Color"
|
|
msgstr "Oletusväri"
|
|
|
|
#: lazarusidestrconsts.lisdbgenexceptionraised
|
|
msgid "Exception Raised"
|
|
msgstr "Keskeytys on annettu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleload
|
|
msgid "Module Load"
|
|
msgstr "Lataa Moduuli"
|
|
|
|
#: lazarusidestrconsts.lisdbgenmoduleunload
|
|
msgid "Module Unload"
|
|
msgstr "Poista Moduuli"
|
|
|
|
#: lazarusidestrconsts.lisdbgenoutputdebugstring
|
|
msgid "Output Debug String"
|
|
msgstr "Näytä virheenjäljitysteksti"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessexit
|
|
msgid "Process Exit"
|
|
msgstr "Prosessin loppu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenprocessstart
|
|
msgid "Process Start"
|
|
msgstr "Prosessin alku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadexit
|
|
msgid "Thread Exit"
|
|
msgstr "Säikeen loppu"
|
|
|
|
#: lazarusidestrconsts.lisdbgenthreadstart
|
|
msgid "Thread Start"
|
|
msgstr "Säikeen alku"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
|
|
msgid "Windows Message Posted"
|
|
msgstr "Windows-viesti on viety"
|
|
|
|
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
|
|
msgid "Windows Message Sent"
|
|
msgstr "Windows-viesti on lähetetty"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdeletehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
|
|
msgid "Delete"
|
|
msgstr "Poista"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
|
|
msgid "Disable"
|
|
msgstr "Estä"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemdisablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
|
|
msgid "Disable"
|
|
msgstr "Estä"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenable
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenable"
|
|
msgid "Enable"
|
|
msgstr "Salli"
|
|
|
|
#: lazarusidestrconsts.lisdbgitemenablehint
|
|
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
|
|
msgid "Enable"
|
|
msgstr "Salli"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
|
|
msgid "No debugger specified"
|
|
msgstr "Virheenjäljitintä ei ole valittu"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
|
|
msgid "Set the breakpoint anyway"
|
|
msgstr "Merkitse tämä kuitenkin keskeyskohdaksi"
|
|
|
|
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
|
|
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
|
|
msgstr "Virheenjäljitintä ei ole valittu.%sKeskeytyskohdalla ei ole vaikutusta ennenkuin 'Käyttöliittymä'-valikon 'Virheenjäljittimen asetus' on asetettu."
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpower
|
|
msgid "On/Off"
|
|
msgstr "Päällä/Pois"
|
|
|
|
#: lazarusidestrconsts.lisdbgwinpowerhint
|
|
msgid "Disable/Enable updates for the entire window"
|
|
msgstr "Estä/salli päivitykset koko ikkunalle"
|
|
|
|
#: lazarusidestrconsts.lisdebug
|
|
msgctxt "lazarusidestrconsts.lisdebug"
|
|
msgid "Debug"
|
|
msgstr "Virheenjäljitys"
|
|
|
|
#: lazarusidestrconsts.lisdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
|
|
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
|
|
msgstr "Virheenjäljittimen virhe%sHups, virhetila%sTalleta muutokset nyt!%sPaina Seis ja toivo parasta, vedämme piuhan irti."
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackerror
|
|
msgid "Debugger Error"
|
|
msgstr "Virheenjäljittimen virhe"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
|
|
msgid "Debugger Information"
|
|
msgstr "Virheenjäljittimen tietoja"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
|
|
msgid "Debugger Warning"
|
|
msgstr "Virheenjäljittimen varoitus"
|
|
|
|
#: lazarusidestrconsts.lisdebuggerinvalid
|
|
msgid "Debugger invalid"
|
|
msgstr "Kelvoton virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.lisdebugging
|
|
msgid "%s (debugging ...)"
|
|
msgstr "%s (jäljittää virheitä ...)"
|
|
|
|
#: lazarusidestrconsts.lisdebughintautotypecastclass
|
|
msgid "Automatic typecast for objects"
|
|
msgstr "Objektien automaattinen tyypitys"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
|
|
msgid "Add Exception"
|
|
msgstr "Lisää keskeytys"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
|
|
msgid "Additional search path"
|
|
msgstr "Lisähakupolku"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
|
|
msgid "Breakpoint"
|
|
msgstr "Keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
|
|
msgid "Clear log on run"
|
|
msgstr "Tyhjennä loki ennen suoritusta"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
|
|
msgid "Debugger"
|
|
msgstr "Virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
|
|
msgid "Debugger general options"
|
|
msgstr "Virheenjäljittimen yleiset asetukset"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
|
|
msgid "Debugger specific options (depends on type of debugger)"
|
|
msgstr "Virheenjäljitinkohtaiset asetukset (riippuu tyypistä)"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
|
|
msgid "Duplicate Exception name"
|
|
msgstr "Päällekkäinen keskeytyksen nimi"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
|
|
msgid "Enter the name of the exception"
|
|
msgstr "Syötä keskeytyksen nimi"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
|
|
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
|
|
msgid "Event Log"
|
|
msgstr "Tapahtumaloki"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
|
|
msgid "Handled by"
|
|
msgstr "Huolehtii:"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
|
|
msgid "Handled by Debugger"
|
|
msgstr "Virheenjäljitin huolehtii"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
|
|
msgid "Handled by Program"
|
|
msgstr "Ohjelma huolehtii"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
|
|
msgid "Ignore these exceptions"
|
|
msgstr "Sivuuta nämä poikkeukset"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
|
|
msgid "Language Exceptions"
|
|
msgstr "Kielilaajennukset"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
|
|
msgid "Limit line count to"
|
|
msgstr "Rajoita rivien määrä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
|
|
msgid "Module"
|
|
msgstr "Moduuli"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
|
|
msgid "Notify on Lazarus Exceptions"
|
|
msgstr "Ilmoita Lazaruksen keskeytyksistä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
|
|
msgid "OS Exceptions"
|
|
msgstr "Käyttöjärjestelmän keskeytys"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
|
|
msgid "Output"
|
|
msgstr "Tuloste"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
|
|
msgid "Process"
|
|
msgstr "Prosessi"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
|
|
msgid "Reset Debugger after each run"
|
|
msgstr "Nollaa virheenjäljitin jokaisen ajon jälkeen"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresume
|
|
msgid "Resume"
|
|
msgstr "Jatka"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
|
|
msgid "Resume Handled"
|
|
msgstr "Jatka käsiteltyä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
|
|
msgid "Resume Unhandled"
|
|
msgstr "Jatka käsittelemätöntä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
|
|
msgid "Show message on stop"
|
|
msgstr "Näytä viesti pysähdyttäessä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
|
|
msgid "Signals"
|
|
msgstr "Signaalit"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmthread
|
|
msgid "Thread"
|
|
msgstr "Säie"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
|
|
msgid "Use event log colors"
|
|
msgstr "Käytä tapahtumalokin värejä"
|
|
|
|
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
|
|
msgid "Windows"
|
|
msgstr "Ikkunat"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile
|
|
msgid "Unable to load file"
|
|
msgstr "Tiedoston lataus ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisdebugunabletoloadfile2
|
|
msgid "Unable to load file \"%s\"."
|
|
msgstr "Tiedoston \"%s\" lataus ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisdecimal
|
|
msgctxt "lazarusidestrconsts.lisdecimal"
|
|
msgid "Decimal"
|
|
msgstr "Desimaali"
|
|
|
|
#: lazarusidestrconsts.lisdefault
|
|
msgctxt "lazarusidestrconsts.lisdefault"
|
|
msgid "Default"
|
|
msgstr "Oletus"
|
|
|
|
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
|
|
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
|
|
msgstr "Uusien metodien oletusnäkyvyyden lohko luokassa. Esim. kun täydennetään OnShow:="
|
|
|
|
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
|
|
msgid "The default is ComboBox with \"True\" and \"False\" selections"
|
|
msgstr "Oletus on ComboBox, missä \"True\" ja \"False\" valinnat"
|
|
|
|
#: lazarusidestrconsts.lisdefaultplaceholder
|
|
msgid "(default)"
|
|
msgstr "(oletus)"
|
|
|
|
#: lazarusidestrconsts.lisdefaultsectionofmethods
|
|
msgid "Default section of methods"
|
|
msgstr "Metodien oletusnäkyvyys"
|
|
|
|
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
|
|
msgid "Delay for long line hints in completion box"
|
|
msgstr "Pitkien rivien viive täydennyslaatikossa"
|
|
|
|
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
|
|
msgid "Delay for hints and completion box"
|
|
msgstr "Vihjeiden ja täydennyslaatikon viive"
|
|
|
|
#: lazarusidestrconsts.lisdelete
|
|
msgctxt "lazarusidestrconsts.lisdelete"
|
|
msgid "Delete"
|
|
msgstr "Poista"
|
|
|
|
#: lazarusidestrconsts.lisdelete2
|
|
msgid "Delete?"
|
|
msgstr "Poista?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteaddition
|
|
msgid "Delete addition \"%s\"?"
|
|
msgstr "Poista lisäys \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteall
|
|
msgid "&Delete All"
|
|
msgstr "&Poista kaikki"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints
|
|
msgid "Delete all breakpoints?"
|
|
msgstr "Poista kaikki keskeytyskohdat?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallbreakpoints2
|
|
msgid "Delete all breakpoints in file \"%s\"?"
|
|
msgstr "Poista kaikki keskeytyskohdat tiedostossa \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallinsamesource
|
|
msgid "Delete All in same source"
|
|
msgstr "Poista kaikki samassa lähdekoodissa"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
|
|
msgid "Delete all selected breakpoints?"
|
|
msgstr "Poista kaikki valitut keskeytyskohdat?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteallthesefiles
|
|
msgid "Delete all these files?"
|
|
msgstr "Poistetaanko kaikki nämä tiedostot?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteambiguousfile
|
|
msgid "Delete ambiguous file?"
|
|
msgstr "Poista ristiriitainen tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpoint
|
|
msgid "Delete Breakpoint"
|
|
msgstr "Poista keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointatline
|
|
msgid "Delete breakpoint at%s\"%s\" line %d?"
|
|
msgstr "Poista keskeytyskohta kohdassa%s\"%s\" rivi %d?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforaddress
|
|
msgid "Delete breakpoint for address %s?"
|
|
msgstr "Poista osoitteen %s keskeytyskohta?"
|
|
|
|
#: lazarusidestrconsts.lisdeletebreakpointforwatch
|
|
msgid "Delete watchpoint for \"%s\"?"
|
|
msgstr "Poista \"%s\" vahtipiste?"
|
|
|
|
#: lazarusidestrconsts.lisdeletefilefailed
|
|
msgid "Delete file failed"
|
|
msgstr "Tiedoston poistaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisdeletemacro
|
|
msgid "Delete macro \"%s\"?"
|
|
msgstr "Poista makro \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeletemode
|
|
msgid "Delete mode \"%s\""
|
|
msgstr "Poista moodi \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile
|
|
msgid "Delete old file \"%s\"?"
|
|
msgstr "Poistetaanko vanha fiedosto \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteoldfile2
|
|
msgid "Delete old file?"
|
|
msgstr "Poistetaanko vanha tiedosto?"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedfiles
|
|
msgid "Delete selected files"
|
|
msgstr "Poista valitut tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisdeleteselectedmacro
|
|
msgid "Delete selected macro?"
|
|
msgstr "Poista valitut makrot?"
|
|
|
|
#: lazarusidestrconsts.lisdeletethisaddition
|
|
msgid "Delete this addition"
|
|
msgstr "Poista tämä lisäys"
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue
|
|
msgid "Delete value \"%s\"?"
|
|
msgstr "Poista arvo \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdeletevalue2
|
|
msgid "Delete value %s"
|
|
msgstr "Poista arvo %s"
|
|
|
|
#: lazarusidestrconsts.lisdeletingoffilefailed
|
|
msgid "Deleting of file \"%s\" failed."
|
|
msgstr "Tiedoston \"%s\" poistaminen epäonnistui."
|
|
|
|
#: lazarusidestrconsts.lisdelimiterissemicolon
|
|
msgid "Delimiter is semicolon."
|
|
msgstr "Erotin on puolipiste."
|
|
|
|
#: lazarusidestrconsts.lisdelphicompatibleresources
|
|
msgid "Delphi compatible resources. Recommended."
|
|
msgstr "Delphi yhteensopivat resurssit. Suositus."
|
|
|
|
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
|
|
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
|
|
msgstr "\"Suunnittelupaketti\" lisää komponentteja ja valikkoja IDE:en. Projektit voivat käyttää niitä, mutta niitä ei käännetä projektin mukana. Kääntäjä ei löydä käännösyksikköjä näistä paketista kääntäessään projektia."
|
|
|
|
#: lazarusidestrconsts.lisdesktops
|
|
msgid "Desktops ..."
|
|
msgstr "Työpöydät ..."
|
|
|
|
#: lazarusidestrconsts.lisdestinationdirectory
|
|
msgid "Destination directory"
|
|
msgstr "Kohdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lisdestructorcode
|
|
msgid "Destructor code"
|
|
msgstr "Destructor koodi"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
|
|
msgid "Case Insensitive"
|
|
msgstr "Kirjaimen koolla ei väliä"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile1
|
|
msgid "File1"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgfile2
|
|
msgid "File2"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
|
|
msgid "Ignore if empty lines were added or removed"
|
|
msgstr "Jätä huomiotta tyhjät rivit"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
|
|
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
|
|
msgstr "Jätä huomiotta eri rivinlopetukset (esim. #10 = #13#10)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
|
|
msgid "Ignore amount of space chars"
|
|
msgstr "Jätä huomiotta välilyöntien määrä merkkien välissä "
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespaces
|
|
msgid "Ignore spaces (newline chars not included)"
|
|
msgstr "Jätä huomiotta välilyönnit (ei koske tyhjiä rivejä)"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
|
|
msgid "Ignore spaces at end of line"
|
|
msgstr "Jätä huomiotta välilyönnit rivin lopussa"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
|
|
msgid "Ignore spaces at start of line"
|
|
msgstr "Jätä huomiotta välilyönnit rivin alussa"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgonlyselection
|
|
msgid "Only selection"
|
|
msgstr "Ainoastaan valittu osa"
|
|
|
|
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
|
|
msgid "Open difference in editor"
|
|
msgstr "Avaa eroavuudet editorissa"
|
|
|
|
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
|
|
msgid "different unit %s found at new position \"%s\""
|
|
msgstr "eri käännösyksikkö %s löytyi uudesta kohdasta \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisdigits
|
|
msgid "Digits:"
|
|
msgstr "Numerot"
|
|
|
|
#: lazarusidestrconsts.lisdirectives
|
|
msgid "Directives"
|
|
msgstr "Ohjeet kääntäjälle"
|
|
|
|
#: lazarusidestrconsts.lisdirectivesfornewunit
|
|
msgid "Directives for new unit"
|
|
msgstr "Ohjeet uudelle käännösyksikölle"
|
|
|
|
#: lazarusidestrconsts.lisdirectories
|
|
msgid "Directories"
|
|
msgstr "Hakemistot"
|
|
|
|
#: lazarusidestrconsts.lisdirectory
|
|
msgid "Directory: "
|
|
msgstr "Hakemisto: "
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound
|
|
msgid "Directory \"%s\" not found."
|
|
msgstr "Hakemistoa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotfound2
|
|
msgid "directory %s not found"
|
|
msgstr "hakemistoa %s ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisdirectorynotwritable
|
|
msgid "Directory not writable"
|
|
msgstr "Hakemistoon ei voi kirjoittaa"
|
|
|
|
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
|
|
msgid "Directory where the IDE puts the .po files"
|
|
msgstr "Hakemisto mihin IDE laittaa .po-tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisdisableallinsamesource
|
|
msgid "Disable All in same source"
|
|
msgstr "Estä kaikki samassa tiedostossa"
|
|
|
|
#: lazarusidestrconsts.lisdisablebreakpoint
|
|
msgid "Disable Breakpoint"
|
|
msgstr "Estä keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.lisdisabled
|
|
msgid "Disabled"
|
|
msgstr "Estetty"
|
|
|
|
#: lazarusidestrconsts.lisdisablegroups
|
|
msgid "Disable Groups"
|
|
msgstr "Estä ryhmät"
|
|
|
|
#: lazarusidestrconsts.lisdisablei18nforlfm
|
|
msgid "Disable I18N for LFM"
|
|
msgstr "Älä käytä I18N:ta LFM:ssa"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg
|
|
msgid "Disable Option -Xg?"
|
|
msgstr "Poista valinta -Xg?"
|
|
|
|
#: lazarusidestrconsts.lisdisableoptionxg2
|
|
msgid "Disable option -Xg"
|
|
msgstr "Poista valinta -Xg"
|
|
|
|
#: lazarusidestrconsts.lisdisassassembler
|
|
msgctxt "lazarusidestrconsts.lisdisassassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
|
|
msgid "Goto Address"
|
|
msgstr "Mene osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.lisdisassgotoaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
|
|
msgid "Goto Address"
|
|
msgstr "Mene osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddress
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
|
|
msgid "Goto Current Address"
|
|
msgstr "Mene nykyiseen osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
|
|
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
|
|
msgid "Goto Current Address"
|
|
msgstr "Mene nykyiseen osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchanges
|
|
msgid "Discard changes"
|
|
msgstr "Hylkää muutokset"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesall
|
|
msgid "Discard all changes"
|
|
msgstr "Hylkää kaikki muutokset"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandopenproject
|
|
msgid "Discard changes and open project"
|
|
msgstr "Hylkää muutokset ja avaa projekti"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangesandquit
|
|
msgid "Discard changes and quit"
|
|
msgstr "Hylkää muutokset ja poistu"
|
|
|
|
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
|
|
msgid "Discard changes, create new project"
|
|
msgstr "Hylkää muutokset, luo uusi projekti"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
|
|
msgid "Click on one of the above items to see the diff"
|
|
msgstr "Klikkaa jotain ylläolevaa kohtaa nähdäksesi muuttuneet kohdat"
|
|
|
|
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
|
|
msgid "Error reading file: %s"
|
|
msgstr "Virhe luettaessa tiedostoa: %s"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
|
|
msgid "Ignore all disk changes"
|
|
msgstr "Ohita kaikki muutokset levyllä"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
|
|
msgid "Reload checked files from disk"
|
|
msgstr "Lataa valitut tiedostot uudestaan levyltä"
|
|
|
|
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
|
|
msgid "Some files have changed on disk:"
|
|
msgstr "Seuraavat tiedostot ovat muuttuneet:"
|
|
|
|
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
|
|
msgid "Distinguish big and small letters e.g. A and a"
|
|
msgstr "Erottelee pienet ja isot kirjaimet (esim. A ja a )"
|
|
|
|
#: lazarusidestrconsts.lisdlgadd
|
|
msgid "Add ..."
|
|
msgstr "Lisää ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgalloptions
|
|
msgid "All options ..."
|
|
msgstr "Kaikki asetukset ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgchangeclass
|
|
msgid "Change Class ..."
|
|
msgstr "Vaihda luokka ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgdefines
|
|
msgid "Defines ..."
|
|
msgstr "Määritteet ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgedit
|
|
msgid "Edit ..."
|
|
msgstr "Muokkaa ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgexport
|
|
msgid "Export ..."
|
|
msgstr "Vie ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgimport
|
|
msgid "Import ..."
|
|
msgstr "Tuo ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgmore
|
|
msgctxt "lazarusidestrconsts.lisdlgmore"
|
|
msgid "More ..."
|
|
msgstr "Lisää ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgopen
|
|
msgid "Open ..."
|
|
msgstr "Avaa ..."
|
|
|
|
#: lazarusidestrconsts.lisdlgsave
|
|
msgid "Save ..."
|
|
msgstr "Tallenna ..."
|
|
|
|
#: lazarusidestrconsts.lisdoesnotexists
|
|
msgid "%s does not exist: %s"
|
|
msgstr "%s ei ole olemassa: %s"
|
|
|
|
#: lazarusidestrconsts.lisdonotchange
|
|
msgid "Do not change"
|
|
msgstr "Älä muuta"
|
|
|
|
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
|
|
msgid "%sDo not check if another IDE instance is already running"
|
|
msgstr "%sÄlä tarkista onko toinen IDE instanssi käynnissä"
|
|
|
|
#: lazarusidestrconsts.lisdonotclosetheproject
|
|
msgid "Do not close the project"
|
|
msgstr "Ei suljetakaan projektia"
|
|
|
|
#: lazarusidestrconsts.lisdonotcompiledependencies
|
|
msgid "do not compile dependencies"
|
|
msgstr "älä käännä riippuvuuksia"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowsplashscreen
|
|
msgid "Do not show splash screen"
|
|
msgstr "Älä näytä aloitusikkunaa"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
|
|
msgid "Do not show this dialog for this project"
|
|
msgstr "Älä näytä tätä ikkunaa tälle projektille"
|
|
|
|
#: lazarusidestrconsts.lisdonotshowthismessageagain
|
|
msgid "Do not show this message again"
|
|
msgstr "Älä näytä tätä viestiä enää"
|
|
|
|
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
|
|
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
|
|
msgstr "Älä kirjoita päivitettyjä projektin tietoja koonnan jälkeen. Jos ei määritelty, koontanumeroa lisätään asetuksen mukaan."
|
|
|
|
#: lazarusidestrconsts.lisdown
|
|
msgid "Down"
|
|
msgstr "Alas"
|
|
|
|
#: lazarusidestrconsts.lisdowngrade
|
|
msgid "Downgrade"
|
|
msgstr "Palauta aikaisempaan"
|
|
|
|
#: lazarusidestrconsts.lisdowngradeconfiguration
|
|
msgid "Downgrade configuration"
|
|
msgstr "Palauta asetukset aikaisempaan"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
|
|
msgid "Do you still want to create the new project?"
|
|
msgstr "Tahdotko yhä luoda uuden projektin?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
|
|
msgid "Do you still want to open another project?"
|
|
msgstr "Tahdotko yhä avata toisen projektin?"
|
|
|
|
#: lazarusidestrconsts.lisdoyoustillwanttoquit
|
|
msgid "Do you still want to quit?"
|
|
msgstr "Tahdotko yhä poistua?"
|
|
|
|
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
|
|
msgid "Draw grid lines"
|
|
msgstr "Näytä kohdistusviivat"
|
|
|
|
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
|
|
msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
|
|
msgstr "Piirrä valinta aina fokusoituna vaikkei viesti-ikkunalla olisi fokusta. Hyödyllinen jos työpöydän teema piirtää sen vaikeasti erottuvana."
|
|
|
|
#: lazarusidestrconsts.lisdsgcopycomponents
|
|
msgid "Copy selected components to clipboard"
|
|
msgstr "Kopioi valitut komponentit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisdsgcutcomponents
|
|
msgid "Cut selected components to clipboard"
|
|
msgstr "Leikkaa valitut komponentit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderbackone
|
|
msgid "Move component one back"
|
|
msgstr "Siirrä komponentti yksi taaksepäin"
|
|
|
|
#: lazarusidestrconsts.lisdsgorderforwardone
|
|
msgid "Move component one forward"
|
|
msgstr "Siirrä komponentti yksi eteenpäin"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetoback
|
|
msgid "Move component to back"
|
|
msgstr "Siirrä komponentti taakse"
|
|
|
|
#: lazarusidestrconsts.lisdsgordermovetofront
|
|
msgid "Move component to front"
|
|
msgstr "Siirrä komponentti eteen"
|
|
|
|
#: lazarusidestrconsts.lisdsgpastecomponents
|
|
msgid "Paste selected components from clipboard"
|
|
msgstr "Liitä komponentit leikepöydältä"
|
|
|
|
#: lazarusidestrconsts.lisdsgselectparentcomponent
|
|
msgid "Select parent component"
|
|
msgstr "Valitse emokomponentti"
|
|
|
|
#: lazarusidestrconsts.lisduplicate
|
|
msgid "Duplicate"
|
|
msgstr "Päällekkäinen"
|
|
|
|
#: lazarusidestrconsts.lisduplicateentry
|
|
msgid "Duplicate entry"
|
|
msgstr "Päällekkäinen merkintä"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefilename
|
|
msgid "Duplicate File Name"
|
|
msgstr "Päällekkäinen tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lisduplicatefoundofvalue
|
|
msgid "Duplicate found of value \"%s\"."
|
|
msgstr "Päällekkäinen arvo \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisduplicatename
|
|
msgid "Duplicate Name"
|
|
msgstr "Päällekkäinen nimi"
|
|
|
|
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
|
|
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
|
|
msgstr "Päällekkäinen nimi: Komponentti \"%s\" on jo olemassa perityssä komponentissa %s"
|
|
|
|
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
|
|
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Päällekkäiset ppu tiedostot. Poista yksi tai varmista että hakupolut ovat oikeassa järjestyksessä (Vihje: FPC käyttää viimeistä polkua ensin)."
|
|
|
|
#: lazarusidestrconsts.lisduplicatesearchpath
|
|
msgid "Duplicate search path"
|
|
msgstr "Päällekkäinen hakupolku"
|
|
|
|
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
|
|
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
|
|
msgstr "Päällekkäiset lähdekoodit. Poista yksi tai varmista että hakupolut ovat oikeassa järjestyksessä (Vihje: FPC käyttää viimeistä polkua ensin)."
|
|
|
|
#: lazarusidestrconsts.lisduplicateunit
|
|
msgid "Duplicate Unit"
|
|
msgstr "Päällekkäinen käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisduplicateunitin
|
|
msgid "Duplicate unit \"%s\" in \"%s\""
|
|
msgstr "Päällekkäinen käännösyksikkö \"%s\" \"%s\":ssa"
|
|
|
|
#: lazarusidestrconsts.lisedit
|
|
msgctxt "lazarusidestrconsts.lisedit"
|
|
msgid "Edit"
|
|
msgstr "Muokkaa"
|
|
|
|
#: lazarusidestrconsts.liseditadditionalhelpformessages
|
|
msgid "Edit additional help for messages"
|
|
msgstr "Muokkaa viestien lisäavuste"
|
|
|
|
#: lazarusidestrconsts.liseditcontexthelp
|
|
msgid "Edit context help"
|
|
msgstr "Muokkaa tilannekohtaista ohjetta"
|
|
|
|
#: lazarusidestrconsts.lisedithelp
|
|
msgid "Edit help"
|
|
msgstr "Muokkaa avustetta"
|
|
|
|
#: lazarusidestrconsts.liseditkey
|
|
msgid "Edit Key"
|
|
msgstr "Muokkaa näppäimiä"
|
|
|
|
#: lazarusidestrconsts.liseditorcolors
|
|
msgid "Editor Colors"
|
|
msgstr "Editorin värit"
|
|
|
|
#: lazarusidestrconsts.liseditormacros
|
|
msgid "Editor macros"
|
|
msgstr "Editorin makrot"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbar
|
|
msgid "Editor ToolBar"
|
|
msgstr "Editorin työkalupalkki"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarsettings
|
|
msgid "Editor Toolbar Settings"
|
|
msgstr "Editorin työkalupalkin asetukset"
|
|
|
|
#: lazarusidestrconsts.liseditortoolbarvisible
|
|
msgid "Editor Toolbar is &visible"
|
|
msgstr "Editorin työkalupalkin &näytetään"
|
|
|
|
#: lazarusidestrconsts.lisedoptsloadascheme
|
|
msgid "Load a scheme"
|
|
msgstr "Lataa kaava"
|
|
|
|
#: lazarusidestrconsts.lisedtdefallpackages
|
|
msgid "All packages"
|
|
msgstr "Kaikki paketit"
|
|
|
|
#: lazarusidestrconsts.lisedtdefcurrentproject
|
|
msgid "Current Project"
|
|
msgstr "Nykyinen projekti"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsallprojects
|
|
msgid "All projects"
|
|
msgstr "Kaikki projektit"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
|
|
msgid "set FPC mode to DELPHI"
|
|
msgstr "Aseta 'FPC mode':n arvoksi DELPHI"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
|
|
msgid "set FPC mode to FPC"
|
|
msgstr "Aseta 'FPC mode':n arvoksi FPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
|
|
msgid "set FPC mode to GPC"
|
|
msgstr "Aseta 'FPC mode':n arvoksi GPC"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
|
|
msgid "set FPC mode to MacPas"
|
|
msgstr "Aseta 'FPC mode':n arvoksi MacPas"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
|
|
msgid "set FPC mode to TP"
|
|
msgstr "Aseta 'FPC mode':n arvoksi TP"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetiocheckson
|
|
msgid "set IOCHECKS on"
|
|
msgstr "Aseta IOCHECKS päälle"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
|
|
msgid "set OVERFLOWCHECKS on"
|
|
msgstr "Aseta OVERFLOWCHECKS päälle"
|
|
|
|
#: lazarusidestrconsts.lisedtdefsetrangecheckson
|
|
msgid "set RANGECHECKS on"
|
|
msgstr "Aseta RANGECHECKS päälle"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
|
|
msgid "use HeapTrc unit"
|
|
msgstr "Käytä HeapTrc käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lisedtdefuselineinfounit
|
|
msgid "use LineInfo unit"
|
|
msgstr "Käytä LineInfo käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
|
|
msgid "A valid tool needs at least a title and a filename."
|
|
msgstr "Työkalu tarvitsee ainakin otsikon ja tiedostonimen."
|
|
|
|
#: lazarusidestrconsts.lisedtexttooledittool
|
|
msgid "Edit Tool"
|
|
msgstr "Muokkaa työkalua"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolkey
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
|
|
msgid "Key"
|
|
msgstr "Näppäin"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolmacros
|
|
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
|
|
msgid "Macros"
|
|
msgstr "Makrot"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolparameters
|
|
msgid "Parameters:"
|
|
msgstr "Parametrit:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolprogramfilename
|
|
msgid "Program Filename:"
|
|
msgstr "Ohjelman tiedostonimi:"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
|
|
msgid "Scan output for FPC messages"
|
|
msgstr "Etsi tulosteesta FPC viestit"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
|
|
msgid "Scan output for \"make\" messages"
|
|
msgstr "Etsi tulosteesta \"make\" viestit"
|
|
|
|
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
|
|
msgid "Title and Filename required"
|
|
msgstr "Otsikko ja tiedostonimi vaaditaan"
|
|
|
|
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
|
|
msgid "Working Directory:"
|
|
msgstr "Työhakemisto"
|
|
|
|
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
|
|
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
|
|
msgstr "Nosta viestin tärkeyttä niin että se näytetään aina (oletuksena matala taso \"verbose\")"
|
|
|
|
#: lazarusidestrconsts.lisemdall
|
|
msgctxt "lazarusidestrconsts.lisemdall"
|
|
msgid "All"
|
|
msgstr "Kaikki"
|
|
|
|
#: lazarusidestrconsts.lisemdemptymethods
|
|
msgid "Empty Methods"
|
|
msgstr "Tyhjät metodit"
|
|
|
|
#: lazarusidestrconsts.lisemdfoundemptymethods
|
|
msgid "Found empty methods:"
|
|
msgstr "Löydetyt tyhjät metodit:"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclass
|
|
msgid "No class"
|
|
msgstr "Ei luokkaa"
|
|
|
|
#: lazarusidestrconsts.lisemdnoclassat
|
|
msgid "No class at %s(%s,%s)"
|
|
msgstr "Ei luokkaa kohdassa %s(%s,%s)"
|
|
|
|
#: lazarusidestrconsts.lisemdonlypublished
|
|
msgid "Only published"
|
|
msgstr "Vain julkaistut"
|
|
|
|
#: lazarusidestrconsts.lisemdpublic
|
|
msgid "Public"
|
|
msgstr "Julkinen"
|
|
|
|
#: lazarusidestrconsts.lisemdpublished
|
|
msgid "Published"
|
|
msgstr "Julkaistu"
|
|
|
|
#: lazarusidestrconsts.lisemdremovemethods
|
|
msgid "Remove methods"
|
|
msgstr "Poista metodit"
|
|
|
|
#: lazarusidestrconsts.lisemdsearchintheseclasssections
|
|
msgid "Search in these class sections:"
|
|
msgstr "Haetaan näistä luokan osista:"
|
|
|
|
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
|
|
msgid "Unable to show empty methods of the current class, because%s%s"
|
|
msgstr "Tämän luokan tyhjien metodien näyttö ei onnistu, koska%s%s"
|
|
|
|
#: lazarusidestrconsts.lisempty
|
|
msgid "Empty"
|
|
msgstr "Tyhjä"
|
|
|
|
#: lazarusidestrconsts.lisenableall
|
|
msgid "&Enable All"
|
|
msgstr "&Salli kaikki"
|
|
|
|
#: lazarusidestrconsts.lisenableallinsamesource
|
|
msgid "Enable All in same source"
|
|
msgstr "Salli kaikki samassa lähdekoodissa"
|
|
|
|
#: lazarusidestrconsts.lisenablebreakpoint
|
|
msgid "Enable Breakpoint"
|
|
msgstr "Salli keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.lisenabled
|
|
msgctxt "lazarusidestrconsts.lisenabled"
|
|
msgid "Enabled"
|
|
msgstr "Sallittu"
|
|
|
|
#: lazarusidestrconsts.lisenabledonlyforpackages
|
|
msgid "Enabled only for packages."
|
|
msgstr "Sallittu vain paketeille."
|
|
|
|
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
|
|
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
|
|
msgstr ". Salli lippu \"Käytä käännösyksikköä\" %s paketissa %s"
|
|
|
|
#: lazarusidestrconsts.lisenablegroups
|
|
msgid "Enable Groups"
|
|
msgstr "Salli ryhmät"
|
|
|
|
#: lazarusidestrconsts.lisenablei18nforlfm
|
|
msgid "Enable I18N for LFM"
|
|
msgstr "Salli I18N LFM:ssa"
|
|
|
|
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
|
|
msgid "Enable internationalization and translation support"
|
|
msgstr "Salli kansainvälistämisen ja käännöksen tuki"
|
|
|
|
#: lazarusidestrconsts.lisenablemacros
|
|
msgid "Enable Macros"
|
|
msgstr "Salli makrot"
|
|
|
|
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
|
|
#, fuzzy
|
|
#| msgid "Enable = replace whole identifier, Disable = replace prefix"
|
|
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
|
|
msgstr "Salli = korvaa koko tunniste, Estä = korvaa alkuosa"
|
|
|
|
#: lazarusidestrconsts.lisenclose
|
|
msgid "Enclose"
|
|
msgstr "Kapseloi"
|
|
|
|
#: lazarusidestrconsts.lisencloseinifdef
|
|
msgid "Enclose in $IFDEF"
|
|
msgstr "Kapseloi $IFDEF:n sisään"
|
|
|
|
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
|
|
msgid "Number of files failed to convert: %d"
|
|
msgstr "Muunnos epäonnistui %d tiedostossa"
|
|
|
|
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
|
|
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
|
|
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
|
|
msgstr "Levyllä olevan tiedoston \"%s\"%skoodaus on %s. Uusi koodaus on %s."
|
|
|
|
#: lazarusidestrconsts.lisendlessloopinmacros
|
|
msgid "Endless loop in macros"
|
|
msgstr "Ikuinen luuppi makrossa"
|
|
|
|
#: lazarusidestrconsts.lisenternewnameformacros
|
|
msgid "Enter new name for Macro \"%s\""
|
|
msgstr "Anna uusi nimi Macrolle \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
|
|
msgid "Environment variable, name as parameter"
|
|
msgstr "Ympäristömuuttuja, nimi parametrina"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
|
|
msgid "Directory not found"
|
|
msgstr "Kansiota ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
|
|
msgid "Invalid debugger filename"
|
|
msgstr "Kelvoton debuggerin tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
|
|
msgid "The debugger file \"%s\" is not an executable."
|
|
msgstr "Debuggeri \"%s\" ei ole suoritettava tiedosto."
|
|
|
|
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
|
|
msgid "Test directory \"%s\" not found."
|
|
msgstr "Testihakemistoa \"%s\" ei löytynyt. "
|
|
|
|
#: lazarusidestrconsts.liserrinvalidoption
|
|
msgid "Invalid option at position %d: \"%s\""
|
|
msgstr "Kelvoton optio paikassa %d: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrnooptionallowed
|
|
msgid "Option at position %d does not allow an argument: %s"
|
|
msgstr "Optio kohdassa %d ei salli parametria: %s"
|
|
|
|
#: lazarusidestrconsts.liserroptionneeded
|
|
msgid "Option at position %d needs an argument : %s"
|
|
msgstr "Optio kohdassa %d tarvitsee parametrin: %s"
|
|
|
|
#: lazarusidestrconsts.liserror
|
|
msgid "Error: "
|
|
msgstr "Virhe: "
|
|
|
|
#: lazarusidestrconsts.liserrorcreatingfile
|
|
msgid "Error creating file"
|
|
msgstr "Virhe luotaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.liserrordeletingfile
|
|
msgid "Error deleting file"
|
|
msgstr "Virhe tuhottaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.liserrorin
|
|
msgid "Error in %s"
|
|
msgstr "Virhe %s:ssa"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecompilerfilename
|
|
msgid "Error in the compiler file name:"
|
|
msgstr "Virhe kääntäjän tiedostonimessä:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
|
|
msgid "Error in the custom compiler options (Other):"
|
|
msgstr "Virhe mukautetuissa kääntäjän asetuksissa (Muut):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
|
|
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
|
|
msgstr "Virhe mukautetuissa linkittäjän asetuksissa (Käännös ja Linkitys / Välitä asetukset linkittäjälle):"
|
|
|
|
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
|
|
msgid "Error in the \"Debugger path addition\":"
|
|
msgstr "Virhe \"Virheenjäljittimen polun lisäyksessä\":"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
|
|
msgid "Error in the search path for \"Include files\":"
|
|
msgstr "Virhe Include-tiedostojen hakupolussa:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
|
|
msgid "Error in the search path for \"Libraries\":"
|
|
msgstr "Virhe Kirjastojen hakupolussa:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
|
|
msgid "Error in the search path for \"Object files\":"
|
|
msgstr "Virhe Käännöshakemiston hakupolussa:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
|
|
msgid "Error in the search path for \"Other sources\":"
|
|
msgstr "Virhe \"Muut lähdekoodit\" hakupolussa:"
|
|
|
|
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
|
|
msgid "Error in the search path for \"Other unit files\":"
|
|
msgstr "Virhe \"Muut käännösyksiköt\" hakupolussa:"
|
|
|
|
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
|
|
msgid "Error in the \"unit output directory\":"
|
|
msgstr "Virhe Käännöshakemistossa:"
|
|
|
|
#: lazarusidestrconsts.liserrorinvalidbuildmode
|
|
msgid "Error: (lazarus) invalid build mode \"%s\""
|
|
msgstr "Virhe: (lazarus) kelvoton koontamoodi \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile
|
|
msgid "Error loading file"
|
|
msgstr "Virhe ladattaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfile2
|
|
msgid "Error loading file \"%s\":"
|
|
msgstr "Virhe ladattaessa tiedostoa \"%s\":"
|
|
|
|
#: lazarusidestrconsts.liserrorloadingfrom
|
|
msgid "Error loading %s from%s%s%s%s"
|
|
msgstr "Virhe ladattaessa %s täältä:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent
|
|
msgid "Error moving component"
|
|
msgstr "Virhe siirrettäessä komponenttia"
|
|
|
|
#: lazarusidestrconsts.liserrormovingcomponent2
|
|
msgid "Error moving component %s:%s"
|
|
msgstr "Virhe siirrettäessä %s:%s komponenttia"
|
|
|
|
#: lazarusidestrconsts.liserrornamingcomponent
|
|
msgid "Error naming component"
|
|
msgstr "Virhe nimettäessä komponenttia"
|
|
|
|
#: lazarusidestrconsts.liserroropeningcomponent
|
|
msgid "Error opening component"
|
|
msgstr "Virhe avattaessa komponenttia"
|
|
|
|
#: lazarusidestrconsts.liserroropeningform
|
|
msgid "Error opening form"
|
|
msgstr "Virhe avattaessa lomaketta"
|
|
|
|
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
|
|
msgid "Error parsing lfm component stream."
|
|
msgstr "Virhe jäsennettäessä lfm komponentin virtaa."
|
|
|
|
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
|
|
msgid "Error reading package list from file%s%s%s%s"
|
|
msgstr "Virhe luettaessa pakettiluetteloa tiedostosta%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxml
|
|
msgid "Error reading XML"
|
|
msgstr "Virhe luettaessa XML"
|
|
|
|
#: lazarusidestrconsts.liserrorreadingxmlfile
|
|
msgid "Error reading xml file \"%s\"%s%s"
|
|
msgstr "Virhe luettaessa xml-tiedostosta \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorrenamingfile
|
|
msgid "Error renaming file"
|
|
msgstr "Virhe uudelleennimettäessä tiedostoa"
|
|
|
|
#: lazarusidestrconsts.liserrors
|
|
msgctxt "lazarusidestrconsts.liserrors"
|
|
msgid "Errors"
|
|
msgstr "Virheet"
|
|
|
|
#: lazarusidestrconsts.liserrors2
|
|
msgid ", Errors: %s"
|
|
msgstr ", Virheet: %s"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingform
|
|
msgid "Error saving form"
|
|
msgstr "Virhe tallennettaessa lomaketta"
|
|
|
|
#: lazarusidestrconsts.liserrorsavingto
|
|
msgid "Error saving %s to%s%s%s%s"
|
|
msgstr "Virhe tallennettaessa %s tänne:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
|
|
msgid "Error setting the name of a component %s to %s"
|
|
msgstr "Virhe nimettäessä komponentti %s %s:ksi"
|
|
|
|
#: lazarusidestrconsts.liserrorwritingfile
|
|
msgid "Error writing file \"%s\""
|
|
msgstr "Virhe tallennettaessa tiedosto \"%s\""
|
|
|
|
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
|
|
msgid "Error writing package list to file%s%s%s%s"
|
|
msgstr "Virhe kirjoitettaessa pakettiluettelo tiedostoon%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisevalexpression
|
|
msgctxt "lazarusidestrconsts.lisevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr "Eval lauseke"
|
|
|
|
#: lazarusidestrconsts.lisevaluate
|
|
msgid "E&valuate"
|
|
msgstr "&Arvioi"
|
|
|
|
#: lazarusidestrconsts.lisevaluatemodify
|
|
msgid "&Evaluate/Modify"
|
|
msgstr "&Arvioi/Muuta"
|
|
|
|
#: lazarusidestrconsts.liseventlogclear
|
|
msgid "Clear Events"
|
|
msgstr "Tyhjennä tapahtumat"
|
|
|
|
#: lazarusidestrconsts.liseventlogoptions
|
|
msgid "Event Log Options ..."
|
|
msgstr "Tapahtumalokin asetukset ..."
|
|
|
|
#: lazarusidestrconsts.liseventlogsavetofile
|
|
msgid "Save Events to File"
|
|
msgstr "Talleta tapahtumat tieostoon"
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment
|
|
msgid "Add Comment ..."
|
|
msgstr "Lisää kommentti ..."
|
|
|
|
#: lazarusidestrconsts.liseventslogaddcomment2
|
|
msgid "Add Comment"
|
|
msgstr "Lisää kommentti"
|
|
|
|
#: lazarusidestrconsts.liseverynthlinenumber
|
|
msgid "Every n-th line number"
|
|
msgstr "Rivinumeroiden näyttöväli"
|
|
|
|
#: lazarusidestrconsts.lisexamplefile
|
|
msgid "Example file:"
|
|
msgstr "Esimerkkitiedosto:"
|
|
|
|
#: lazarusidestrconsts.lisexamplesbuildallselected
|
|
msgid "Build all selected"
|
|
msgstr "Kokoa kaikki valitut"
|
|
|
|
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
|
|
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisexamplesopenfirstselected
|
|
msgid "Open first selected"
|
|
msgstr "Avaa ensimmäinen valittu"
|
|
|
|
#: lazarusidestrconsts.lisexceptiondialog
|
|
msgid "Debugger Exception Notification"
|
|
msgstr "Virheejäljettimen kiinniottaman poikkeuksen havainto"
|
|
|
|
#: lazarusidestrconsts.lisexcludedatruntime
|
|
msgid "%s excluded at run time"
|
|
msgstr "%s sivuutetaan ajon akana"
|
|
|
|
#: lazarusidestrconsts.lisexcludefilter
|
|
msgid "Exclude filter"
|
|
msgstr "Poistosuodatin"
|
|
|
|
#: lazarusidestrconsts.lisexecutableisadirectory
|
|
msgid "executable \"%s\" is a directory"
|
|
msgstr "Suoritettava ohjelma \"%s\" onkin hakemisto"
|
|
|
|
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
|
|
msgid "executable \"%s\" lacks the permission to run"
|
|
msgstr "ohjelmalla \"%s\" ei ole suoritusoikeutta"
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandafter
|
|
msgid "Executing command after"
|
|
msgstr "Suorittaa komennon jälkeen"
|
|
|
|
#: lazarusidestrconsts.lisexecutingcommandbefore
|
|
msgid "Executing command before"
|
|
msgstr "Suorittaa komennon ennen"
|
|
|
|
#: lazarusidestrconsts.lisexecutionstopped
|
|
msgid "Execution stopped"
|
|
msgstr "Suoritus on pysäytetty"
|
|
|
|
#: lazarusidestrconsts.lisexit
|
|
msgctxt "lazarusidestrconsts.lisexit"
|
|
msgid "Exit"
|
|
msgstr "Lopeta"
|
|
|
|
#: lazarusidestrconsts.lisexitcode
|
|
msgid "Exit code %s"
|
|
msgstr "Lopetuskoodi %s"
|
|
|
|
#: lazarusidestrconsts.lisexpandall
|
|
msgid "Expand All (*)"
|
|
msgstr "Laajenna kaikki (*)"
|
|
|
|
#: lazarusidestrconsts.lisexpandallclasses
|
|
msgid "Expand all classes"
|
|
msgstr "Laajenna kaikki luokat"
|
|
|
|
#: lazarusidestrconsts.lisexpandallpackages
|
|
msgid "Expand all packages"
|
|
msgstr "Laajenna kaikki paketit"
|
|
|
|
#: lazarusidestrconsts.lisexpandallunits
|
|
msgid "Expand all units"
|
|
msgstr "Laajenna kaikki käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
|
|
msgid "Expanded filename of current editor file"
|
|
msgstr "Laajenna nykyisen editorin tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.lisexport
|
|
msgctxt "lazarusidestrconsts.lisexport"
|
|
msgid "Export"
|
|
msgstr "Vie"
|
|
|
|
#: lazarusidestrconsts.lisexportall
|
|
msgid "Export all"
|
|
msgstr "Vie kaikki"
|
|
|
|
#: lazarusidestrconsts.lisexportallitemstofile
|
|
msgid "Export All Items to File"
|
|
msgstr "Vie kaikki kohdat tiedostoon"
|
|
|
|
#: lazarusidestrconsts.lisexportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
|
|
msgid "Export environment options"
|
|
msgstr "Vie ympäristön asetukset"
|
|
|
|
#: lazarusidestrconsts.lisexporthtml
|
|
msgid "Export as HTML"
|
|
msgstr "Vie HTML:nä"
|
|
|
|
#: lazarusidestrconsts.lisexportimport
|
|
msgid "Export / Import"
|
|
msgstr "Vie / Tuo"
|
|
|
|
#: lazarusidestrconsts.lisexportlist
|
|
msgid "Export list"
|
|
msgstr "Vie luettelo"
|
|
|
|
#: lazarusidestrconsts.lisexportpackagelistxml
|
|
msgid "Export package list (*.xml)"
|
|
msgstr "Vie pakettiluettelo (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisexportselected
|
|
msgid "Export selected"
|
|
msgstr "Vie valitut"
|
|
|
|
#: lazarusidestrconsts.lisexportsub
|
|
msgid "Export >>"
|
|
msgstr "Vie >>"
|
|
|
|
#: lazarusidestrconsts.lisexpression
|
|
msgid "Expression:"
|
|
msgstr "Ilmaisu:"
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
|
|
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr "Laajenna paketin \"%s\" include-tiedostojen hakupolku tällä:%s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
|
|
msgid "Extend include files search path of project with%s\"%s\"?"
|
|
msgstr "Laajenna projektin include-tiedostojen hakupolku tällä:%s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisextendincludepath
|
|
msgid "Extend include path?"
|
|
msgstr "Laajenna include-tiedostojen polku?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitpath
|
|
msgid "Extend unit path?"
|
|
msgstr "Laajennetaanko käännösyksikköjen polkua?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
|
|
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
|
|
msgstr "Laajenna paketin \"%s\" käännösyksikköjen hakupolku tällä:%s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
|
|
msgid "Extend unit search path of project with%s\"%s\"?"
|
|
msgstr "Laajenna projektin käännösyksikköjen hakupolku tällä:%s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisextract
|
|
msgid "Extract"
|
|
msgstr "Erota"
|
|
|
|
#: lazarusidestrconsts.lisextractprocedure
|
|
msgctxt "lazarusidestrconsts.lisextractprocedure"
|
|
msgid "Extract Procedure"
|
|
msgstr "Erota aliohjelma"
|
|
|
|
#: lazarusidestrconsts.lisextremelyverbose
|
|
msgid "Extremely Verbose"
|
|
msgstr "Hyvin monisanainen"
|
|
|
|
#: lazarusidestrconsts.lisexttoolexternaltools
|
|
msgid "External Tools"
|
|
msgstr "Ulkoiset työkalut"
|
|
|
|
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
|
|
msgid "Maximum Tools reached"
|
|
msgstr "Työkalujen maksimimäärä täyttyi"
|
|
|
|
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
|
|
msgid "There is a maximum of %s tools."
|
|
msgstr "Työkalujen suurin sallittu määrä on %s"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
|
|
msgid "Failed to add %d not unique resource(s)"
|
|
msgstr "%d resurssin lisääminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
|
|
msgid "Failed to create Application Bundle for \"%s\""
|
|
msgstr "\"Application Bundle\" luonti \"%s\":lle epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoloadfoldstat
|
|
msgid "Failed to load fold state"
|
|
msgstr "Laskostuksen lataaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisfailedtoresolvemacros
|
|
msgid "failed to resolve macros"
|
|
msgstr "makrojen selvitys epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisfailedtosavefile
|
|
msgid "Failed to save file."
|
|
msgstr "Tiedoston tallennus epäonnistui."
|
|
|
|
#: lazarusidestrconsts.lisfatal
|
|
msgctxt "lazarusidestrconsts.lisfatal"
|
|
msgid "Fatal"
|
|
msgstr "Tuhoisa"
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
|
|
msgid "Reduce designer painting"
|
|
msgstr "Vähennä lomake-editorin päivittämistä"
|
|
|
|
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
|
|
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
|
|
msgstr "Piirrä lomake-editori vain joutoaikana (vähentää viivettä hitaalla tietokoneella)"
|
|
|
|
#: lazarusidestrconsts.lisfile
|
|
msgid "File"
|
|
msgstr "Tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisfile2
|
|
msgid "File: "
|
|
msgstr "Tiedosto: "
|
|
|
|
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
|
|
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
|
|
msgstr "Tiedosto \"%s\"%s ei näytä olevan tekstitiedosto.%s Yritetäänkö silti avata?"
|
|
|
|
#: lazarusidestrconsts.lisfileextensionofprograms
|
|
msgid "File extension of programs"
|
|
msgstr "Ohjelmien tiedostopääte"
|
|
|
|
#: lazarusidestrconsts.lisfilefilter
|
|
msgid "File filter"
|
|
msgstr "Tiedoston suodin"
|
|
|
|
#: lazarusidestrconsts.lisfilefilters
|
|
msgid "File Filters"
|
|
msgstr "Tiedostosuotimet"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersaddrow
|
|
msgid "Add Row"
|
|
msgstr "Lisää rivi loppuun"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersdeleterow
|
|
msgid "Delete Row"
|
|
msgstr "Poista rivi"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersinsertrow
|
|
msgid "Insert Row"
|
|
msgstr "Lisää rivi"
|
|
|
|
#: lazarusidestrconsts.lisfilefiltersmask
|
|
msgid "File mask"
|
|
msgstr "Tiedostomaski"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterssetdefaults
|
|
msgid "Set defaults"
|
|
msgstr "Aseta oletukset"
|
|
|
|
#: lazarusidestrconsts.lisfilefilterstitle
|
|
msgid "These are file filters that will appear in all File Open dialogs"
|
|
msgstr "Nämä tiedostosuotimet näkyvät kaikissa 'Avaa Tiedosto' -ikkunoissa"
|
|
|
|
#: lazarusidestrconsts.lisfilehaschangedsave
|
|
msgid "File \"%s\" has changed. Save?"
|
|
msgstr "Tiedosto \"%s\" on muuttunut. Talletetaanko?"
|
|
|
|
#: lazarusidestrconsts.lisfilehasnoproject
|
|
msgid "File has no project"
|
|
msgstr "Tiedostolla ei ole projektia"
|
|
|
|
#: lazarusidestrconsts.lisfileisdirectory
|
|
msgid "File is directory"
|
|
msgstr "Tiedosto on hakemisto"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotanexecutable
|
|
msgid "File is not an executable"
|
|
msgstr "Tiedosto ei ole suoritettava"
|
|
|
|
#: lazarusidestrconsts.lisfileisnotwritable
|
|
msgid "File is not writable"
|
|
msgstr "Tiedoston tallentaminen ei onnistunut"
|
|
|
|
#: lazarusidestrconsts.lisfileissymlink
|
|
msgid "File is symlink"
|
|
msgstr "Tiedosto on symbolinen linkki"
|
|
|
|
#: lazarusidestrconsts.lisfileisvirtual
|
|
msgid "File \"%s\" is virtual."
|
|
msgstr "Tiedosto \"%s\" on virtuaalinen."
|
|
|
|
#: lazarusidestrconsts.lisfilelinkerror
|
|
msgid "File link error"
|
|
msgstr "Tiedoston linkkivirhe"
|
|
|
|
#: lazarusidestrconsts.lisfilenameaddress
|
|
msgid "Filename/Address"
|
|
msgstr "Tiedoston nimi / osoite"
|
|
|
|
#: lazarusidestrconsts.lisfilenamestyle
|
|
msgid "Filename Style"
|
|
msgstr "Tiedostonimen tyyli"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound
|
|
msgid "File not found"
|
|
msgstr "Tiedostoa ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound2
|
|
msgctxt "lazarusidestrconsts.lisfilenotfound2"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Tiedostoa \"%s\" ei löytynyt."
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound3
|
|
msgid "file %s not found"
|
|
msgstr "tiedostoa %s ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound4
|
|
msgid "file not found"
|
|
msgstr "tiedostoa ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfound5
|
|
msgid "File not found:%s%s"
|
|
msgstr "Tiedostoa ei löytynyt:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
|
|
msgid "File \"%s\" not found.%sDo you want to create it?"
|
|
msgstr "Tiedostoa \"%s\" ei löytynyt.%sHaluatko luoda sen?"
|
|
|
|
#: lazarusidestrconsts.lisfilenotlowercase
|
|
msgid "File not lowercase"
|
|
msgstr "Tiedosto ei ole pienillä kirjoitettu"
|
|
|
|
#: lazarusidestrconsts.lisfilenottext
|
|
msgid "File not text"
|
|
msgstr "Tiedosto ei ole tekstiä"
|
|
|
|
#: lazarusidestrconsts.lisfilesettings
|
|
msgid "File Settings"
|
|
msgstr "Tiedoston asetukset"
|
|
|
|
#: lazarusidestrconsts.lisfileshasincorrectsyntax
|
|
msgid "File %s has incorrect syntax."
|
|
msgstr "Tiedoston %s syntaksi on väärä."
|
|
|
|
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
|
|
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
|
|
msgstr "Tiedostolla: %s, on Register aliohjelma: %s, paketin uses-lauseessa: %s"
|
|
|
|
#: lazarusidestrconsts.lisfileshaverightencoding
|
|
msgid "*** All found files already have the right encoding ***"
|
|
msgstr "*** Kaikilla löydetyillä tiedostoilla on oikea merkkikoodaus ***"
|
|
|
|
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
|
|
msgid "Files in ASCII or UTF-8 encoding"
|
|
msgstr "ASCII- tai UTF-8-koodatut tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
|
|
msgid "File %s is converted to text format."
|
|
msgstr "Tiedosto %s on muunnettu tekstiksi."
|
|
|
|
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
|
|
msgid "Files not in ASCII nor UTF-8 encoding"
|
|
msgstr "Muut kuin ASCII- tai UTF-8-koodatut tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
|
|
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
|
|
msgstr "Tiedosto mihin virheenjäljitys-tuloste kirjoitetaan. Jollei määritelty, kirjoitetaan konsoliin."
|
|
|
|
#: lazarusidestrconsts.lisfilter
|
|
msgid "Filter"
|
|
msgstr "Suodatin"
|
|
|
|
#: lazarusidestrconsts.lisfilter3
|
|
msgid "Filter: %s"
|
|
msgstr "Suodatin: %s"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
|
|
msgid "Filter all messages of certain type"
|
|
msgstr "Suodata kaikki tietyn tyyppiset viestit"
|
|
|
|
#: lazarusidestrconsts.lisfilterallmessagesoftype
|
|
msgid "Filter all messages of type %s"
|
|
msgstr "Suodata kaikki %s tyyppiset viestit"
|
|
|
|
#: lazarusidestrconsts.lisfilteralreadyexists
|
|
msgid "Filter already exists"
|
|
msgstr "Suodatin on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
|
|
msgid "Filter Debug Messages and below"
|
|
msgstr "Suodata virheenjäljitysviestit ja sitä alemmat"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintsandbelow
|
|
msgid "Filter Hints and below"
|
|
msgstr "Suodata vihjeet ja sitä alemmat"
|
|
|
|
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
|
|
msgid "Filter Hints without Source Position"
|
|
msgstr "Suodata vihjeet ilman lähdekoodin sijaintia"
|
|
|
|
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
|
|
msgid "Filter None, do not filter by urgency"
|
|
msgstr "Älä suodata tärkeyden mukaan"
|
|
|
|
#: lazarusidestrconsts.lisfilternonurgentmessages
|
|
msgid "Filter non urgent Messages"
|
|
msgstr "Suodata vähemmän tärkeät viestit"
|
|
|
|
#: lazarusidestrconsts.lisfilternotesandbelow
|
|
msgid "Filter Notes and below"
|
|
msgstr "Suodata muistutukset ja sitä alemmat"
|
|
|
|
#: lazarusidestrconsts.lisfiltersets
|
|
msgid "Filter Sets"
|
|
msgstr "Suodatinryhmät"
|
|
|
|
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
|
|
msgid "Filter the available options list"
|
|
msgstr "Suodata tarjolla olevat asetukset"
|
|
|
|
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
|
|
msgid "Filter Verbose Messages and below"
|
|
msgstr "Suodata monisanaiset viestit ja sitä alemmat"
|
|
|
|
#: lazarusidestrconsts.lisfilterwarningsandbelow
|
|
msgid "Filter Warnings and below"
|
|
msgstr "Suodata varoitukset ja sitä alemmat"
|
|
|
|
#: lazarusidestrconsts.lisfind
|
|
msgid "Find ..."
|
|
msgstr "Etsi ..."
|
|
|
|
#: lazarusidestrconsts.lisfinddeclarationof
|
|
msgid "Find Declaration of %s"
|
|
msgstr "Etsi %s:n määritys"
|
|
|
|
#: lazarusidestrconsts.lisfindfiledirectories
|
|
msgid "D&irectories"
|
|
msgstr "Hakemistot"
|
|
|
|
#: lazarusidestrconsts.lisfindfilefilemask
|
|
msgid "Fi&le mask"
|
|
msgstr "&Tiedostomaski"
|
|
|
|
#: lazarusidestrconsts.lisfindfileincludesubdirectories
|
|
msgid "Include &sub directories"
|
|
msgstr "&Sisällytä myös alikansiot "
|
|
|
|
#: lazarusidestrconsts.lisfindfilemultilinepattern
|
|
msgid "&Multiline pattern"
|
|
msgstr "&Monirivinen"
|
|
|
|
#: lazarusidestrconsts.lisfindfileonlytextfiles
|
|
msgid "Only text files"
|
|
msgstr "Vain tekstitiedostot"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
|
|
msgid "search all files in &project"
|
|
msgstr "etsi &projektin kaikista tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
|
|
msgid "search all &open files"
|
|
msgstr "etsi kaikista &avoinna olevista tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchinactivefile
|
|
msgid "search in &active file"
|
|
msgstr "etsi &aktiivisesta tiedostosta"
|
|
|
|
#: lazarusidestrconsts.lisfindfilesearchindirectories
|
|
msgid "search in &directories"
|
|
msgstr "etsi &kansioista"
|
|
|
|
#: lazarusidestrconsts.lisfindfilewhere
|
|
msgid "Where"
|
|
msgstr "Mistä"
|
|
|
|
#: lazarusidestrconsts.lisfindkeycombination
|
|
msgid "Find key combination"
|
|
msgstr "Etsi näppäinyhdistelmä"
|
|
|
|
#: lazarusidestrconsts.lisfindmissingunit
|
|
msgid "Find missing unit"
|
|
msgstr "Etsi puuttuva käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisfirst
|
|
msgid "First"
|
|
msgstr "Ensimmäinen"
|
|
|
|
#: lazarusidestrconsts.lisfirsttest
|
|
msgid "&First test"
|
|
msgstr "&Ensimmäinen testi"
|
|
|
|
#: lazarusidestrconsts.lisfixlfmfile
|
|
msgid "Fix LFM file"
|
|
msgstr "LFM-tiedoston korjaus"
|
|
|
|
#: lazarusidestrconsts.lisfloatingpoin
|
|
msgid "Floating Point"
|
|
msgstr "Liukuluku"
|
|
|
|
#: lazarusidestrconsts.lisfocushint
|
|
msgid "Focus hint"
|
|
msgstr "Fokusoi vihje"
|
|
|
|
#: lazarusidestrconsts.lisforcerenaming
|
|
msgid "Force renaming"
|
|
msgstr "Pakota mineäminen"
|
|
|
|
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
|
|
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
|
|
msgstr "Esimerkiksi näytä ylhäällä paikalliset muuttujat, sitten luokan jäsenet, sitten emoluokan, sitten nykyisen ja lopuksi käytettyjen käännösyksiköiden muuttujat"
|
|
|
|
#: lazarusidestrconsts.lisform
|
|
msgid "Form"
|
|
msgstr "Lomake"
|
|
|
|
#: lazarusidestrconsts.lisformacosdarwin
|
|
msgid "For macOS (Darwin)"
|
|
msgstr "macOS:lle (Darwin)"
|
|
|
|
#: lazarusidestrconsts.lisformaterror
|
|
msgid "Format error"
|
|
msgstr "Muotoiluvirhe"
|
|
|
|
#: lazarusidestrconsts.lisforwindows
|
|
msgid "For Windows"
|
|
msgstr "Windowsille"
|
|
|
|
#: lazarusidestrconsts.lisfoundversionexpected
|
|
msgid "Found version %s, expected %s"
|
|
msgstr "Versio %s löytyi, odotettiin versiota %s"
|
|
|
|
#: lazarusidestrconsts.lisfpccfgismissing
|
|
msgid "fpc.cfg is missing."
|
|
msgstr "fpc.cfg puuttuu"
|
|
|
|
#: lazarusidestrconsts.lisfpcfullversioneg20701
|
|
msgid "FPC version as one number (e.g. 20701)"
|
|
msgstr "FPC versio numerona (esim. 20701)"
|
|
|
|
#: lazarusidestrconsts.lisfpcmakefailed
|
|
msgid "fpcmake failed"
|
|
msgstr "fpcmake epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagefile2
|
|
msgid "FPC message file:"
|
|
msgstr "FPC viestitiedosto:"
|
|
|
|
#: lazarusidestrconsts.lisfpcmessagesappendix
|
|
msgid "FPC messages: Appendix"
|
|
msgstr "FPC viestit: Lisäys"
|
|
|
|
#: lazarusidestrconsts.lisfpcresources
|
|
msgid "FPC resources (.res)"
|
|
msgstr "FPC-resurssit (.res)"
|
|
|
|
#: lazarusidestrconsts.lisfpcsources
|
|
msgid "FPC sources"
|
|
msgstr "FPC-lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.lisfpctooold
|
|
msgid "FPC too old"
|
|
msgstr "FPC on liian vanha"
|
|
|
|
#: lazarusidestrconsts.lisfpcversion
|
|
msgid "FPC Version: "
|
|
msgstr "FPC-versio: "
|
|
|
|
#: lazarusidestrconsts.lisfpcversioneg222
|
|
msgid "FPC Version (e.g. 2.2.2)"
|
|
msgstr "FPC-versio (esim. 2.2.2)"
|
|
|
|
#: lazarusidestrconsts.lisfpdoceditor
|
|
msgctxt "lazarusidestrconsts.lisfpdoceditor"
|
|
msgid "FPDoc Editor"
|
|
msgstr "FPDoc-muokkain"
|
|
|
|
#: lazarusidestrconsts.lisfpdocerrorwriting
|
|
msgid "Error writing \"%s\"%s%s"
|
|
msgstr "Virhe kirjoitettaessa \"%s\"%s%s"
|
|
|
|
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
|
|
msgid "FPDoc syntax error"
|
|
msgstr "FPDoc-kielioppivirhe"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagename
|
|
msgid "FPDoc package name:"
|
|
msgstr "FPDoc paketin nimi:"
|
|
|
|
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
|
|
msgid "FPDoc package name. Default is project file name."
|
|
msgstr "FPDoc paketin nimi. Oletus on projektin tiedostonimi."
|
|
|
|
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
|
|
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
|
|
msgstr "FPDoc-elementissä \"%s\":%s%s on kielioppivirhe"
|
|
|
|
#: lazarusidestrconsts.lisframe
|
|
msgid "Frame"
|
|
msgstr "Kehys"
|
|
|
|
#: lazarusidestrconsts.lisfrbackwardsearch
|
|
msgid "&Backward search"
|
|
msgstr "&Taaksepäin haku"
|
|
|
|
#: lazarusidestrconsts.lisfreeingbufferlines
|
|
msgid "freeing buffer lines: %s"
|
|
msgstr "vapauttaa puskurin rivit: %s"
|
|
|
|
#: lazarusidestrconsts.lisfreepascalcompilermessages
|
|
msgid "Free Pascal Compiler messages"
|
|
msgstr "Free Pascal -kääntäjän viestit"
|
|
|
|
#: lazarusidestrconsts.lisfreepascalsourcedirectory
|
|
msgid "Free Pascal source directory"
|
|
msgstr "Free Pascal -lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lisfrforwardsearch
|
|
msgid "Forwar&d search"
|
|
msgstr "&Eteenpäin"
|
|
|
|
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
|
|
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
|
|
msgstr "Laajennetaan toiminta koskemaan myös näihin tiedostoihin (esim. /path/*.pas;/path2/*.pp)"
|
|
|
|
#: lazarusidestrconsts.lisfrifindorrenameidentifier
|
|
msgid "Find or Rename Identifier"
|
|
msgstr "Etsi tai vaihda tunnisteiden nimiä"
|
|
|
|
#: lazarusidestrconsts.lisfrifindreferences
|
|
msgid "Find References"
|
|
msgstr "Etsi viittaukset"
|
|
|
|
#: lazarusidestrconsts.lisfriidentifier
|
|
msgid "Identifier: %s"
|
|
msgstr "Tunniste: %s"
|
|
|
|
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
|
|
msgid "in all open packages and projects"
|
|
msgstr "kaikissa avoimissa paketeissa ja projekteissa"
|
|
|
|
#: lazarusidestrconsts.lisfriincurrentunit
|
|
msgid "in current unit"
|
|
msgstr "vain käytössä oleva käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisfriinmainproject
|
|
msgid "in main project"
|
|
msgstr "kaikista tämän projektin tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
|
|
msgid "in project/package owning current unit"
|
|
msgstr "paketissa/projektissa, mikä omistaa tämän käännösyksikön"
|
|
|
|
#: lazarusidestrconsts.lisfriinvalididentifier
|
|
msgid "Invalid Identifier"
|
|
msgstr "Kelvoton tunniste"
|
|
|
|
#: lazarusidestrconsts.lisfrirenameallreferences
|
|
msgid "Rename all References"
|
|
msgstr "Nimeä uudelleen viittaukset"
|
|
|
|
#: lazarusidestrconsts.lisfrirenaming
|
|
msgid "Renaming"
|
|
msgstr "Uudelleen nimeys"
|
|
|
|
#: lazarusidestrconsts.lisfrisearch
|
|
msgid "Search"
|
|
msgstr "Etsi"
|
|
|
|
#: lazarusidestrconsts.lisfrisearchincommentstoo
|
|
msgid "Search in comments too"
|
|
msgstr "Käy myös kommentit läpi"
|
|
|
|
#: lazarusidestrconsts.lisfull
|
|
msgid "Full"
|
|
msgstr "Täysi"
|
|
|
|
#: lazarusidestrconsts.lisfunction
|
|
msgctxt "lazarusidestrconsts.lisfunction"
|
|
msgid "Function"
|
|
msgstr "Funktio"
|
|
|
|
#: lazarusidestrconsts.lisgeneral
|
|
msgctxt "lazarusidestrconsts.lisgeneral"
|
|
msgid "General"
|
|
msgstr "Yleistä"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
|
|
msgid "get word at current cursor position"
|
|
msgstr "palauta sana kursorin kohdasta"
|
|
|
|
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
|
|
msgid "Get word at current cursor position."
|
|
msgstr "Palauta sana kursorin kohdasta."
|
|
|
|
#: lazarusidestrconsts.lisglobalsettings
|
|
msgid "Global settings"
|
|
msgstr "Julkiset asetukset"
|
|
|
|
#: lazarusidestrconsts.lisgotoline
|
|
msgid "Goto Line"
|
|
msgstr "Mene riville"
|
|
|
|
#: lazarusidestrconsts.lisgotoselected
|
|
msgid "Goto selected"
|
|
msgstr "Mene valintaan"
|
|
|
|
#: lazarusidestrconsts.lisgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
|
|
"\n"
|
|
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisgroup
|
|
msgid "Group"
|
|
msgstr "Ryhmä"
|
|
|
|
#: lazarusidestrconsts.lisgroupassignexisting
|
|
msgid "Assign to existing \"%s\" group?"
|
|
msgstr "Siirrä olemassa olevaan \"%s\" ryhmään?"
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydelete
|
|
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
|
|
msgstr "Ryhmässä \"%s\" ei ole enää keskeytyskohtia, poista se?"
|
|
|
|
#: lazarusidestrconsts.lisgroupemptydeletemore
|
|
msgid "%sThere are %d more empty groups, delete all?"
|
|
msgstr "%sJäljellä on %d tyhjää ryhmää, poista kaikki?"
|
|
|
|
#: lazarusidestrconsts.lisgrouplocalvariables
|
|
msgid "Group automatically defined local variables"
|
|
msgstr "Ryhmittele automaattisesti luodut paikalliset muuttujat"
|
|
|
|
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
|
|
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
|
|
msgstr "Ryhmän nimi ei saa olla tyhjä. Tyhjennä keskeytyskohtien ryhmä(t)?"
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinput
|
|
msgid "Group name:"
|
|
msgstr "Ryhmän nimi:"
|
|
|
|
#: lazarusidestrconsts.lisgroupnameinvalid
|
|
msgid "BreakpointGroup name must be a valid Pascal identifier name."
|
|
msgstr "BreakpointGroup nimen pitää olla kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnew
|
|
msgid "Set new group ..."
|
|
msgstr "Aseta uusi ryhmä ..."
|
|
|
|
#: lazarusidestrconsts.lisgroupsetnone
|
|
msgid "Clear group(s)"
|
|
msgstr "Tyhjennä ryhmä(t)"
|
|
|
|
#: lazarusidestrconsts.lisgroupsfordebugoutput
|
|
msgid "Enable or Disable groups of debug output. Valid Options are:"
|
|
msgstr "Salli tai estä virheenjäljitysviestien ryhmät. Mahdolliset asetukset ovat:"
|
|
|
|
#: lazarusidestrconsts.lisgrowtolarges
|
|
msgid "Grow to Largest"
|
|
msgstr "Kasvata suurimpaan"
|
|
|
|
#: lazarusidestrconsts.lishashelp
|
|
msgid "Has Help"
|
|
msgstr "Ohje löytyy"
|
|
|
|
#: lazarusidestrconsts.lisheadercolors
|
|
msgid "Header colors"
|
|
msgstr "Otsikon värit"
|
|
|
|
#: lazarusidestrconsts.lisheadercommentforclass
|
|
msgid "Header comment for class"
|
|
msgstr "Luokan pääkommentti"
|
|
|
|
#: lazarusidestrconsts.lishelp
|
|
msgctxt "lazarusidestrconsts.lishelp"
|
|
msgid "Help"
|
|
msgstr "Ohje"
|
|
|
|
#: lazarusidestrconsts.lishelpentries
|
|
msgid "Help entries"
|
|
msgstr "Ohjemerkinnät"
|
|
|
|
#: lazarusidestrconsts.lishelpselectordialog
|
|
msgid "Help selector"
|
|
msgstr "Ohjeen valinta"
|
|
|
|
#: lazarusidestrconsts.lishexadecimal
|
|
msgid "Hexadecimal"
|
|
msgstr "Heksadesimaali"
|
|
|
|
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
|
|
msgid "Help for Free Pascal Compiler message"
|
|
msgstr "Free Pascal -kääntäjän viestien ohje"
|
|
|
|
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
|
|
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
|
|
msgstr "Piilota kaikki vihjeet ja varoitukset lisäämällä IDE:n ohje {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
|
|
msgid "Hide message at %s by inserting IDE directive {%H-}"
|
|
msgstr "Piilota viesti %s:ssa lisäämällä IDE:n ohje {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
|
|
msgid "Hide message by inserting IDE directive {%H-}"
|
|
msgstr "Piilota viesti lisäämällä IDE:n ohje {%H-}"
|
|
|
|
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
|
|
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lishidesearch
|
|
msgid "Hide Search"
|
|
msgstr "Piilota haku"
|
|
|
|
#: lazarusidestrconsts.lishidewindow
|
|
msgctxt "lazarusidestrconsts.lishidewindow"
|
|
msgid "Hide window"
|
|
msgstr "Piilota ikkuna"
|
|
|
|
#: lazarusidestrconsts.lishidewithpackageoptionvm
|
|
msgid "Hide with package option (-vm%s)"
|
|
msgstr "Piilota pakettivalinnan (-vm%s) kanssa"
|
|
|
|
#: lazarusidestrconsts.lishidewithprojectoptionvm
|
|
msgid "Hide with project option (-vm%s)"
|
|
msgstr "Piilota projektivalinnan (-vm%s) kanssa"
|
|
|
|
#: lazarusidestrconsts.lishint
|
|
msgctxt "lazarusidestrconsts.lishint"
|
|
msgid "Hint"
|
|
msgstr "Vihje"
|
|
|
|
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
|
|
msgid "Hint: A default value can be defined in the conditionals."
|
|
msgstr "Vihje: oletusarvo voidaan määritellä ehtolauseessa."
|
|
|
|
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
|
|
msgid "A hint at property's name shows its description."
|
|
msgstr "Ominaisuuden nimen vihje näyttää sen selityksen."
|
|
|
|
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
|
|
msgid "Hint: Check if two packages contain a unit with the same name."
|
|
msgstr "Vihje: Tarkista sisältääkö kaksi pakettia käännösyksikön samalla nimellä."
|
|
|
|
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
|
|
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
|
|
msgstr "Vihje: Klikkaa \"Näytä asetukset\" nähdäksesi mistä periytyvät polut tulevat."
|
|
|
|
#: lazarusidestrconsts.lishints
|
|
msgid ", Hints: %s"
|
|
msgstr ", Vihjeet: %s"
|
|
|
|
#: lazarusidestrconsts.lishintsaveall
|
|
msgid "Save all"
|
|
msgstr "Tallenna kaikki"
|
|
|
|
#: lazarusidestrconsts.lishintstepinto
|
|
msgid "Step Into"
|
|
msgstr "Askella sisään"
|
|
|
|
#: lazarusidestrconsts.lishintstepout
|
|
msgid "Run until function returns"
|
|
msgstr "Jatka funktion loppuun asti"
|
|
|
|
#: lazarusidestrconsts.lishintstepover
|
|
msgid "Step Over"
|
|
msgstr "Askella yli"
|
|
|
|
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
|
|
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
|
|
msgstr "Vihje: \"Tee resurssiteksti\" funktio olettaa merkkijonovakiota.%sValitse lauseke ja yritä uudelleen."
|
|
|
|
#: lazarusidestrconsts.lishinttoggleformunit
|
|
msgid "Toggle Form/Unit"
|
|
msgstr "Vaihda lomake/käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lishintviewforms
|
|
msgid "View Forms"
|
|
msgstr "Näytä lomakkeet"
|
|
|
|
#: lazarusidestrconsts.lishintviewunits
|
|
msgid "View Units"
|
|
msgstr "Näytä käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lishitcount
|
|
msgid "Hitcount"
|
|
msgstr "Osumien määrä"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsdatabases
|
|
msgid "Databases"
|
|
msgstr "Tietokannat"
|
|
|
|
#: lazarusidestrconsts.lishlpoptshelpoptions
|
|
msgid "Help Options"
|
|
msgstr "Ohjeen asetukset"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsproperties
|
|
msgid "Properties:"
|
|
msgstr "Ominaisuudet:"
|
|
|
|
#: lazarusidestrconsts.lishlpoptsviewers
|
|
msgid "Viewers"
|
|
msgstr "Katselimet"
|
|
|
|
#: lazarusidestrconsts.lishofpcdochtmlpath
|
|
msgid "FPC Doc HTML Path"
|
|
msgstr "FPC Doc HTML-polku"
|
|
|
|
#: lazarusidestrconsts.lishorizontal
|
|
msgid "Horizontal"
|
|
msgstr "Vaakasuunta"
|
|
|
|
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
|
|
msgid "Horizontal lines between properties."
|
|
msgstr "Vaakasuorat viivat ominaisuuksien välissä."
|
|
|
|
#: lazarusidestrconsts.lisid
|
|
msgctxt "lazarusidestrconsts.lisid"
|
|
msgid "ID"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidcaddition
|
|
msgid "Addition"
|
|
msgstr "Lisäys"
|
|
|
|
#: lazarusidestrconsts.lisidcopening
|
|
msgid "Opening"
|
|
msgstr "Avaus"
|
|
|
|
#: lazarusidestrconsts.liside
|
|
msgid "IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidebuildoptions
|
|
msgid "IDE build options"
|
|
msgstr "IDEn kokoamisen asetukset"
|
|
|
|
#: lazarusidestrconsts.lisidecompileandrestart
|
|
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
|
|
msgstr "IDE käännetään ja käynnistetään pakettien asennuksen/poistamisen aikana."
|
|
|
|
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
|
|
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
|
|
msgstr "Tervetuloa Lazarukseen.%0:sLöydetyt IDE:n asetukset kuuluvat toiselle Lazarus-asennukselle.%0:sEri Lazarus-asennusten ei pitäisi jakaa samoja asetuksia. Se voi johtaa ristiriitoihin eikä Lazarus-asennus enää toimi kunnolla.%0:s%0:sJos on vain yksi asennus ja Lazarus on kopioitu, asetukset voi huoletta päivittää.%0:s%1:s%0:s%0:sValitse:%0:s%0:s* Päivitys-info: Käytä näitä asetuksia ja päivitä ne käytettäväksi Lazaruksen kanssa jatkossa. Vanha asennus ei enää käytä sitä.%0:s* Ohita: Käytä näitä asetuksia, mutta varoita uudelleen jatkossa. Tämä voi johtaa ristiriitaan toisten asennusten kanssa.%0:s* Keskeytä: Poistu nyt. Ongelmat voi sen jälkeen ratkaista käynnistämällä Lazarus oikeiden asetusten kanssa.%0:s%0:sLisätietoa:%0:sNämä asetukset ovat: %2:s%0:sNe kuuluvat Lazarus asennukseen täällä: %3:s%0:sNykyinen IDE käynnistettiin täältä: %4:s%0:s"
|
|
|
|
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
|
|
msgid "Creating Makefile for package %s"
|
|
msgstr "Luodaan Make-tiedosto paketille %s"
|
|
|
|
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
|
|
msgid "Error: running 'compile after' tool failed for package %s"
|
|
msgstr "Virhe: 'käännä jälkeen' työkalu paketille %s epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisideinfoinformationabouttheide
|
|
msgid "Information about the IDE"
|
|
msgstr "Tietoja IDE:sta"
|
|
|
|
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
|
|
msgid "WARNING: unit name invalid %s, package=%s"
|
|
msgstr "Varoitus: käännösyksikön %s nimi ei kelpaa, paketti=%s"
|
|
|
|
#: lazarusidestrconsts.lisidemacros
|
|
msgid "IDE Macros"
|
|
msgstr "IDE-makrot"
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
|
|
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
|
|
msgid "The IDE maintains the title in main unit."
|
|
msgstr "IDE pitää yllä otsikkoa päätiedostossa."
|
|
|
|
#: lazarusidestrconsts.lisidentifier
|
|
msgid "identifier"
|
|
msgstr "tunniste"
|
|
|
|
#: lazarusidestrconsts.lisidentifierbeginswith
|
|
msgid "Identifier begins with ..."
|
|
msgstr "Tunniste alkaa ..."
|
|
|
|
#: lazarusidestrconsts.lisidentifiercontains
|
|
msgid "Identifier contains ..."
|
|
msgstr "Tunniste sisältää ..."
|
|
|
|
#: lazarusidestrconsts.lisideoptions
|
|
msgid "IDE Options:"
|
|
msgstr "IDEn asetukset:"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsbuildmode
|
|
msgid "IDE title shows selected build mode"
|
|
msgstr "IDEn otsikko näyttää valitun koontamoodin"
|
|
|
|
#: lazarusidestrconsts.lisidetitleshowsprojectdir
|
|
msgid "IDE title shows project directory"
|
|
msgstr "IDEn otsikko näyttää projektihakemiston"
|
|
|
|
#: lazarusidestrconsts.lisidetitlestartswithprojectname
|
|
msgid "IDE title starts with project name"
|
|
msgstr "IDEn otsikko alkaa projektin nimellä"
|
|
|
|
#: lazarusidestrconsts.lisiecoallbuildmodes
|
|
msgid "All build modes"
|
|
msgstr "Kaikki koontamoodit"
|
|
|
|
#: lazarusidestrconsts.lisiecocompileroptionsof
|
|
msgid "Compiler options of"
|
|
msgstr "Kääntäjän valinnat"
|
|
|
|
#: lazarusidestrconsts.lisiecocurrentbuildmode
|
|
msgid "Current build mode"
|
|
msgstr "Nykyinen koontamoodi"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxml
|
|
msgid "Error opening XML"
|
|
msgstr "Virhe avattaessa XML:ää"
|
|
|
|
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
|
|
msgid "Error opening XML file \"%s\":%s%s"
|
|
msgstr "Virhe avattaessa XML tiedostoa \"%s\":%s%s"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportcompileroptions
|
|
msgid "Export Compiler Options"
|
|
msgstr "Vie kääntäjän valinnat"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexists
|
|
msgid "Export file exists"
|
|
msgstr "Vietävä tiedosto on olemassa"
|
|
|
|
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
|
|
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
|
|
msgstr "Vietävä tiedosto \"%s\" on olemassa.%sAvaa tiedosto ja korvaa vain kääntäjän asetukset?%s(Muut asetukset säilyvät.)"
|
|
|
|
#: lazarusidestrconsts.lisiecoimportcompileroptions
|
|
msgid "Import Compiler Options"
|
|
msgstr "Tuo kääntäjän valinnat"
|
|
|
|
#: lazarusidestrconsts.lisiecoloadfromfile
|
|
msgid "Load from file"
|
|
msgstr "Lataa tiedostosta"
|
|
|
|
#: lazarusidestrconsts.lisieconocompileroptionsinfile
|
|
msgid "File \"%s\" does not contain compiler options."
|
|
msgstr "Tiedosto \"%s\" ei sisällä kääntäjän valintoja."
|
|
|
|
#: lazarusidestrconsts.lisiecorecentfiles
|
|
msgid "Recent files"
|
|
msgstr "Äskeiset tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisiecosavetofile
|
|
msgid "Save to file"
|
|
msgstr "Tallenna tiedostoon"
|
|
|
|
#: lazarusidestrconsts.lisifnotchecked
|
|
msgid "If not checked:"
|
|
msgstr "Jos ei ruksattu:"
|
|
|
|
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
|
|
msgid "If only the session info changed, ask about saving it."
|
|
msgstr "Jos vain istunnon tiedot muuttuivat, kysy niiden tallentamisesta."
|
|
|
|
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
|
|
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
|
|
msgstr "Haluttaessa kaksi eri Lazarus versiota, pitää toinen käynnistää parametrin primary-config-path tai pcp kanssa.%sEsimerkiksi:"
|
|
|
|
#: lazarusidestrconsts.lisignore
|
|
msgid "Ignore"
|
|
msgstr "Ohita"
|
|
|
|
#: lazarusidestrconsts.lisignoreall
|
|
msgid "Ignore all"
|
|
msgstr "Ohita kaikki"
|
|
|
|
#: lazarusidestrconsts.lisignoreandcontinue
|
|
msgid "Ignore and continue"
|
|
msgstr "Jätä huomiotta ja jatka"
|
|
|
|
#: lazarusidestrconsts.lisignorebinaries
|
|
msgid "Ignore binaries"
|
|
msgstr "Jätä huomiotta binaarit"
|
|
|
|
#: lazarusidestrconsts.lisignoreexceptiontype
|
|
msgid "Ignore this exception type"
|
|
msgstr "Ohita tämän tyyppiset poikkeukset"
|
|
|
|
#: lazarusidestrconsts.lisignoreuseasancestor
|
|
msgid "Ignore, use %s as ancestor"
|
|
msgstr "Ohita, käytä %s kantatyyppinä"
|
|
|
|
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
|
|
msgid "Imitate indentation of current unit, project or package"
|
|
msgstr "Matki nykyisen käännösyksikön, projektin tai paketin sisennystä"
|
|
|
|
#: lazarusidestrconsts.lisimplementationcommentforclass
|
|
msgid "Implementation comment for class"
|
|
msgstr "Luokan toteutusosan kommentti"
|
|
|
|
#: lazarusidestrconsts.lisimport
|
|
msgctxt "lazarusidestrconsts.lisimport"
|
|
msgid "Import"
|
|
msgstr "Tuo"
|
|
|
|
#: lazarusidestrconsts.lisimportant
|
|
msgctxt "lazarusidestrconsts.lisimportant"
|
|
msgid "Important"
|
|
msgstr "Tärkeä"
|
|
|
|
#: lazarusidestrconsts.lisimportenvironmentoptions
|
|
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
|
|
msgid "Import environment options"
|
|
msgstr "Tuo ympäristön asetukset"
|
|
|
|
#: lazarusidestrconsts.lisimportfromfile
|
|
msgid "Import from File"
|
|
msgstr "Tuo tiedostosta"
|
|
|
|
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
|
|
msgid "Importing BuildModes is not supported for packages."
|
|
msgstr "Koontamoodien tuontia paketteihin ei tueta."
|
|
|
|
#: lazarusidestrconsts.lisimportlist
|
|
msgid "Import list"
|
|
msgstr "Tuo luettelo"
|
|
|
|
#: lazarusidestrconsts.lisimportpackagelistxml
|
|
msgid "Import package list (*.xml)"
|
|
msgstr "Tuo pakettiluettelo (*.xml)"
|
|
|
|
#: lazarusidestrconsts.lisimpossible
|
|
msgid "Impossible"
|
|
msgstr "Mahdoton"
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
|
|
msgid "In a source directory of the package \"%s\"."
|
|
msgstr "Paketin \"%s\" lähdehakemistossa."
|
|
|
|
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
|
|
msgid "In a source directory of the project. Check for duplicates."
|
|
msgstr "Projektin lähdehakemistossa. Tarkista kaksoiskappaleet."
|
|
|
|
#: lazarusidestrconsts.lisincludeallsubdirectories
|
|
msgid "Include all subdirectories"
|
|
msgstr "Kaikki alihakemistot"
|
|
|
|
#: lazarusidestrconsts.lisincludefilter
|
|
msgid "Include filter"
|
|
msgstr "Lisäyssuodatin"
|
|
|
|
#: lazarusidestrconsts.lisincludepath
|
|
msgid "include path"
|
|
msgstr "Include polku"
|
|
|
|
#: lazarusidestrconsts.lisincludepaths
|
|
msgid "Include paths"
|
|
msgstr "Include polut"
|
|
|
|
#: lazarusidestrconsts.lisincludesubdirectories
|
|
msgid "Include subdirectories"
|
|
msgstr "Mukaanotettavat alihakemistot"
|
|
|
|
#: lazarusidestrconsts.lisincompatibleppu
|
|
msgid ", incompatible ppu=%s"
|
|
msgstr ", ei-yhteensopiva ppu=%s"
|
|
|
|
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
|
|
msgid "Incorrect configuration directory found"
|
|
msgstr "Löytyi väärä asetushakemisto"
|
|
|
|
#: lazarusidestrconsts.lisindentationforpascalsources
|
|
msgid "Indentation for Pascal sources"
|
|
msgstr "Pascal-lähdekoodin sisennys"
|
|
|
|
#: lazarusidestrconsts.lisindex
|
|
msgid "Index"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinformation
|
|
msgid "Information"
|
|
msgstr "Tietoja"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutunit
|
|
msgid "Information about %s"
|
|
msgstr "Tietoja %s tiedostosta"
|
|
|
|
#: lazarusidestrconsts.lisinformationaboutusedfpc
|
|
msgid "Information about used FPC"
|
|
msgstr "Tietoa käytetystä FPC:stä"
|
|
|
|
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
|
|
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
|
|
msgstr "FPC käännösyksikön hakupolussa. Ehkä FPC paketti on asentanut. Tarkista ovatko kääntäjä ja ppu tiedosto samasta asennuksesta."
|
|
|
|
#: lazarusidestrconsts.lisinfrontofrelated
|
|
msgid "In front of related"
|
|
msgstr "Samankaltaisten edelle"
|
|
|
|
#: lazarusidestrconsts.lisinheriteditem
|
|
msgid "Inherited Item"
|
|
msgstr "Periytyvä kohta"
|
|
|
|
#: lazarusidestrconsts.lisinheritedparameters
|
|
msgid "Inherited parameters"
|
|
msgstr "Periytyvät parametrit"
|
|
|
|
#: lazarusidestrconsts.lisinheritedprojectcomponent
|
|
msgid "Inherited project component"
|
|
msgstr "Periytyvä projektin komponentti"
|
|
|
|
#: lazarusidestrconsts.lisinitializelocalvariable
|
|
msgid "Initialize Local Variable"
|
|
msgstr "Alusta paikallinen muuttuja"
|
|
|
|
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
|
|
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
|
|
msgstr "Tehtäessä puhdasta kopiota projektista/paketista, kaikki tiedostot seuraavassa hakemistossa poistetaan ja sisältö menetetään.%sPoistetaanko kaikki tiedostot: \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisinsert
|
|
msgctxt "lazarusidestrconsts.lisinsert"
|
|
msgid "Insert"
|
|
msgstr "Lisää"
|
|
|
|
#: lazarusidestrconsts.lisinsertassignment
|
|
msgid "Insert Assignment %s := ..."
|
|
msgstr "Lisää operaattori %s := ..."
|
|
|
|
#: lazarusidestrconsts.lisinsertdate
|
|
msgid "insert date"
|
|
msgstr "lisää päivämäärä"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtime
|
|
msgid "insert date and time"
|
|
msgstr "lisää päivämäärä ja aika"
|
|
|
|
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
|
|
msgid "Insert date and time. Optional: format string."
|
|
msgstr "Lisää päivämäärä ja aika. Valinnaisesti muotoile merkkijono."
|
|
|
|
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
|
|
msgid "Insert date. Optional: format string."
|
|
msgstr "Lisää päivämäärä. Valinnaisesti muotoile merkkijono."
|
|
|
|
#: lazarusidestrconsts.lisinsertendifneeded
|
|
msgid "insert end if needed"
|
|
msgstr "lisää end tarvittaessa"
|
|
|
|
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
|
|
msgid ""
|
|
"Insert header of current procedure.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
|
|
"WithoutClassKeyword,// without 'class' proc keyword\n"
|
|
"AddClassName, // extract/add ClassName.\n"
|
|
"WithoutClassName, // skip classname\n"
|
|
"WithoutName, // skip function name\n"
|
|
"WithoutParamList, // skip param list\n"
|
|
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
|
|
"WithParameterNames, // extract parameter names\n"
|
|
"WithoutParamTypes, // skip colon, param types and default values\n"
|
|
"WithDefaultValues, // extract default values\n"
|
|
"WithResultType, // extract colon + result type\n"
|
|
"WithOfObject, // extract 'of object'\n"
|
|
"WithCallingSpecs, // extract cdecl; inline;\n"
|
|
"WithProcModifiers, // extract forward; alias; external;\n"
|
|
"WithComments, // extract comments and spaces\n"
|
|
"InUpperCase, // turn to uppercase\n"
|
|
"CommentsToSpace, // replace comments with a single space\n"
|
|
" // (default is to skip unnecessary space,\n"
|
|
" // e.g 'Do ;' normally becomes 'Do;'\n"
|
|
" // with this option you get 'Do ;')\n"
|
|
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
|
|
"WithoutSemicolon, // skip semicolon at end\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisinsertmacro
|
|
msgid "Insert Macro"
|
|
msgstr "Lisää makro"
|
|
|
|
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
|
|
msgid "Insert name of current procedure."
|
|
msgstr "Lisää nykyisen funktion nimi."
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag
|
|
msgid "Insert PrintShort tag"
|
|
msgstr "Lisää PrintShort merkki"
|
|
|
|
#: lazarusidestrconsts.lisinsertprintshorttag2
|
|
msgid "Insert printshort tag"
|
|
msgstr "Lisää printshort merkki"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurehead
|
|
msgid "insert procedure head"
|
|
msgstr "Lisää aliohjelman alku"
|
|
|
|
#: lazarusidestrconsts.lisinsertprocedurename
|
|
msgid "insert procedure name"
|
|
msgstr "Lisää aliohjelman nimi"
|
|
|
|
#: lazarusidestrconsts.lisinsertsemicolonifneeded
|
|
msgid "Insert semicolon if needed"
|
|
msgstr "Lisää puolipiste tarvittaessa"
|
|
|
|
#: lazarusidestrconsts.lisinserttime
|
|
msgid "insert time"
|
|
msgstr "lisää aika"
|
|
|
|
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
|
|
msgid "Insert time. Optional: format string."
|
|
msgstr "Lisää aika. Valinnaisesti muotoile merkkijono."
|
|
|
|
#: lazarusidestrconsts.lisinserturltag
|
|
msgid "Insert url tag"
|
|
msgstr "Lisää URL tagi"
|
|
|
|
#: lazarusidestrconsts.lisinsession
|
|
msgid "In session"
|
|
msgstr "Istunnossa"
|
|
|
|
#: lazarusidestrconsts.lisinspect
|
|
msgid "&Inspect"
|
|
msgstr "&Tutki"
|
|
|
|
#: lazarusidestrconsts.lisinspectclassinherit
|
|
msgid "%s : Class %s inherits from %s"
|
|
msgstr "%s : Luokka %s periytyy %s:sta"
|
|
|
|
#: lazarusidestrconsts.lisinspectdata
|
|
msgid "Data"
|
|
msgstr "Tieto"
|
|
|
|
#: lazarusidestrconsts.lisinspectdialog
|
|
msgid "Debug Inspector"
|
|
msgstr "Virheenjäljittimen hallinta"
|
|
|
|
#: lazarusidestrconsts.lisinspectmethods
|
|
msgid "Methods"
|
|
msgstr "Metodit"
|
|
|
|
#: lazarusidestrconsts.lisinspectpointerto
|
|
msgid "Pointer to %s"
|
|
msgstr "Osoitin %s:hen"
|
|
|
|
#: lazarusidestrconsts.lisinspectproperties
|
|
msgctxt "lazarusidestrconsts.lisinspectproperties"
|
|
msgid "Properties"
|
|
msgstr "Ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolclass
|
|
msgid "Show class column"
|
|
msgstr "Näytä luokan sarake"
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcoltype
|
|
msgid "Show type column"
|
|
msgstr "Näytä tyypin sarake"
|
|
|
|
#: lazarusidestrconsts.lisinspectshowcolvisibility
|
|
msgid "Show visibility column"
|
|
msgstr "Näytä näkyvyyden sarake"
|
|
|
|
#: lazarusidestrconsts.lisinspectunavailable
|
|
msgid "%s : unavailable"
|
|
msgstr "%s : ei saatavilla"
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstance
|
|
msgid "Instance"
|
|
msgstr "Ilmentymä"
|
|
|
|
#: lazarusidestrconsts.lisinspectuseinstancehint
|
|
msgid "Use instance class"
|
|
msgstr "Käytä ilmentymäluokkaa"
|
|
|
|
#: lazarusidestrconsts.lisinstallationfailed
|
|
msgid "Installation failed"
|
|
msgstr "Asennus epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisinstalled
|
|
msgid "installed"
|
|
msgstr "asennettu"
|
|
|
|
#: lazarusidestrconsts.lisinstallitilikethefat
|
|
msgid "Install it, I like the fat"
|
|
msgstr "Asenna, pidän siitä turvonneena"
|
|
|
|
#: lazarusidestrconsts.lisinstallselection
|
|
msgid "Install selection"
|
|
msgstr "Asenna valinta"
|
|
|
|
#: lazarusidestrconsts.lisinstalluninstallpackages
|
|
msgid "Install/Uninstall Packages"
|
|
msgstr "Asenna/Poista paketteja"
|
|
|
|
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
|
|
msgid "Instead of compile package create a simple Makefile."
|
|
msgstr "Paketin kääntämisen sijaan tee yksinkertainen Makefile."
|
|
|
|
#: lazarusidestrconsts.lisinsufficientencoding
|
|
msgid "Insufficient encoding"
|
|
msgstr "Riittämätön merkkikoodaus"
|
|
|
|
#: lazarusidestrconsts.lisinteractive
|
|
msgid "Interactive"
|
|
msgstr "Vuorovaikutteinen"
|
|
|
|
#: lazarusidestrconsts.lisinternalerror
|
|
msgid "internal error: %s"
|
|
msgstr "sisäinen virhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidcommand
|
|
msgid "Invalid command"
|
|
msgstr "Kelvoton komento"
|
|
|
|
#: lazarusidestrconsts.lisinvaliddelete
|
|
msgid "Invalid delete"
|
|
msgstr "Onnistumaton poisto"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutable
|
|
msgid "Invalid Executable"
|
|
msgstr "Kelvoton ohjelma"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
|
|
msgid "The file \"%s\" is not executable."
|
|
msgstr "Tiedosto \"%s\" ei ole ohjelma."
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpression
|
|
msgid "Invalid expression:%s%s%s%s"
|
|
msgstr "Kelvoton lauseke:%s%s%s%s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
|
|
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
|
|
msgstr "Kelvoton lauseke.%sVihje: \"Tee resurssiteksti\" funktio olettaa merkkijonovakiota yhdessä tiedostossa. Valitse lauseke ja yritä uudelleen."
|
|
|
|
#: lazarusidestrconsts.lisinvalidfilter
|
|
msgid "Invalid filter"
|
|
msgstr "Kelvoton suodatin"
|
|
|
|
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
|
|
msgid "Invalid line, column in message%s%s"
|
|
msgstr "Kelvoton rivi, sarake viestissä%s%s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosin
|
|
msgid "Invalid macros in \"%s\""
|
|
msgstr "Kelvottomia makroja \"%s\":ssa"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
|
|
msgid "Invalid macros \"%s\" in external tool \"%s\""
|
|
msgstr "Kelvottomia makroja \"%s\" ulkoisessa työkalussa \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
|
|
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
|
|
msgstr "Kelvoton makro \"%s\". Nimen pitää olla Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
|
|
msgid "Invalid macro name \"%s\". The name is a keyword."
|
|
msgstr "Kelvoton makron nimi \"%s\". Nimi on avainsana."
|
|
|
|
#: lazarusidestrconsts.lisinvalidmask
|
|
msgid "Invalid Mask"
|
|
msgstr "Kelvoton maski"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmode
|
|
msgid "Invalid mode %s"
|
|
msgstr "Kelvoton moodi %s"
|
|
|
|
#: lazarusidestrconsts.lisinvalidmultiselection
|
|
msgid "Invalid multiselection"
|
|
msgstr "Kelvoton monivalinta"
|
|
|
|
#: lazarusidestrconsts.lisinvalidoff
|
|
msgid "Invalid (Off)"
|
|
msgstr "Kelvoton (Pois)"
|
|
|
|
#: lazarusidestrconsts.lisinvalidon
|
|
msgid "Invalid (On)"
|
|
msgstr "Kelvoton (Päällä)"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
|
|
msgid "Invalid Pascal Identifier"
|
|
msgstr "Kelvoton Pascal-tunniste"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
|
|
msgid "The name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Nimi \"%s\" ei ole kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisinvalidprocname
|
|
msgid "Invalid proc name"
|
|
msgstr "Vääränlainen aliohjelman nimi"
|
|
|
|
#: lazarusidestrconsts.lisinvalidprojectfilename
|
|
msgid "Invalid project filename"
|
|
msgstr "Vääränlainen projektitiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.lisinvalidpublishingdirectory
|
|
msgid "Invalid publishing Directory"
|
|
msgstr "Kelvoton julkaisuhakemisto"
|
|
|
|
#: lazarusidestrconsts.lisinvalidselection
|
|
msgid "Invalid selection"
|
|
msgstr "Kelvoton valinta"
|
|
|
|
#: lazarusidestrconsts.lisinvalidversionin
|
|
msgid "invalid version in %s"
|
|
msgstr "kelvoton versio %s:ssa"
|
|
|
|
#: lazarusidestrconsts.lisisalreadypartoftheproject
|
|
msgid "%s is already part of the Project."
|
|
msgstr "%s on jo osa projektia."
|
|
|
|
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
|
|
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
|
|
msgstr "\"%s\" on kelvoton projektin nimi.%sValitse joku muu (esim. projekti1.lpi)"
|
|
|
|
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
|
|
msgid "%s is a %s.%sThis circular dependency is not allowed."
|
|
msgstr "%s on %s.%sTämä kehäriippuvuus ei ole sallittu"
|
|
|
|
#: lazarusidestrconsts.lisisddirectorynotfound
|
|
msgid "directory not found"
|
|
msgstr "hakemistoa ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisissues
|
|
msgid "Issues"
|
|
msgstr "Ongelmia"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
|
|
msgid "I wonder how you did that. Error in the %s:"
|
|
msgstr "Miten onnistuit tekemään sen? Virhe %s:"
|
|
|
|
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
|
|
msgid "I wonder how you did that: Error in the base directory:"
|
|
msgstr "Miten onnistuit tekemään sen? Virhe kantahakemistossa:"
|
|
|
|
#: lazarusidestrconsts.lisjhjumphistory
|
|
msgctxt "lazarusidestrconsts.lisjhjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Hyppyhistoria"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerror
|
|
msgid "Jump to error"
|
|
msgstr "Hyppää virheeseen"
|
|
|
|
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
|
|
msgid "When an error in the sources is found at identifier completion, jump to it."
|
|
msgstr "Kun koodissa havaitaan virhe tunnistetta täydennettäessä, hyppää siihen."
|
|
|
|
#: lazarusidestrconsts.lisjumptoprocedure
|
|
msgid "Jump to procedure %s"
|
|
msgstr "Hyppy aliohjelmaan %s"
|
|
|
|
#: lazarusidestrconsts.liskb
|
|
msgid "%s KB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskeep2
|
|
msgid "Keep"
|
|
msgstr "Säilytä"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopen
|
|
msgid "Keep converted files open in editor"
|
|
msgstr "Pidä muunnetut tiedostot auki editorissa"
|
|
|
|
#: lazarusidestrconsts.liskeepfileopenhint
|
|
msgid "All project files will be open in editor after conversion"
|
|
msgstr "Kaikki projektin tiedostot ovat auki editorissa konversion jälkeen"
|
|
|
|
#: lazarusidestrconsts.liskeepininstalllist
|
|
msgid "Keep in install list"
|
|
msgstr "Pidetään asennuksessa"
|
|
|
|
#: lazarusidestrconsts.liskeepname
|
|
msgid "Keep name"
|
|
msgstr "Hyväksy nimi tällaisenaan"
|
|
|
|
#: lazarusidestrconsts.liskeepopen
|
|
msgid "Keep open"
|
|
msgstr "Pidä auki"
|
|
|
|
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
|
|
msgid "Keep relative indentation of multi line template"
|
|
msgstr "Säilytä monirivisten mallineiden suhteellinen sisennys"
|
|
|
|
#: lazarusidestrconsts.liskeepsubindentation
|
|
msgid "Keep indentation"
|
|
msgstr "Säilytä sisennys"
|
|
|
|
#: lazarusidestrconsts.liskeepthemandcontinue
|
|
msgid "Keep them and continue"
|
|
msgstr "Pidä ne ja jatka"
|
|
|
|
#: lazarusidestrconsts.liskey
|
|
msgctxt "lazarusidestrconsts.liskey"
|
|
msgid "Key"
|
|
msgstr "Näppäin"
|
|
|
|
#: lazarusidestrconsts.liskeycatcustom
|
|
msgid "Custom commands"
|
|
msgstr "Mukautetut komennot"
|
|
|
|
#: lazarusidestrconsts.liskeycatdesigner
|
|
msgid "Designer commands"
|
|
msgstr "Lomake-editorin komennot"
|
|
|
|
#: lazarusidestrconsts.liskeycatobjinspector
|
|
msgid "Object Inspector commands"
|
|
msgstr "Komponenttimuokkaimen komennot"
|
|
|
|
#: lazarusidestrconsts.liskeyor2keysequence
|
|
msgid "Key (or 2 key sequence)"
|
|
msgstr "Näppäin (tai 2 peräkkäistä yhdistelmää)"
|
|
|
|
#: lazarusidestrconsts.liskmabortbuilding
|
|
msgid "Abort building"
|
|
msgstr "Keskeytä kokoaminen"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpaddress
|
|
msgid "Add Address Breakpoint"
|
|
msgstr "Lisää keskeytyskohta osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpsource
|
|
msgid "Add Source Breakpoint"
|
|
msgstr "Lisää keskeytyskohta lähdekoodiin"
|
|
|
|
#: lazarusidestrconsts.liskmaddbpwatchpoint
|
|
msgid "Add Data/WatchPoint"
|
|
msgstr "Lisää Tieto/Vahtipiste"
|
|
|
|
#: lazarusidestrconsts.liskmaddwatch
|
|
msgid "Add watch"
|
|
msgstr "Lisää vahti"
|
|
|
|
#: lazarusidestrconsts.liskmbuildmanymodes
|
|
msgid "Build many modes"
|
|
msgstr "Kokoa monta moodia"
|
|
|
|
#: lazarusidestrconsts.liskmbuildprojectprogram
|
|
msgid "Build project/program"
|
|
msgstr "Kokoa projekti/ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmchoosekeymappingscheme
|
|
msgid "Choose Keymapping scheme"
|
|
msgstr "Valitse näppäinkartan kaava"
|
|
|
|
#: lazarusidestrconsts.liskmclassic
|
|
msgid "Classic"
|
|
msgstr "Klassinen"
|
|
|
|
#: lazarusidestrconsts.liskmcleanupandbuild
|
|
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
|
|
msgid "Clean up and build"
|
|
msgstr "Siivoa ja kokoa"
|
|
|
|
#: lazarusidestrconsts.liskmcloseproject
|
|
msgid "Close project"
|
|
msgstr "Sulje projekti"
|
|
|
|
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
|
|
msgid "CodeTools defines editor"
|
|
msgstr "CodeTools-määritysten muokkain"
|
|
|
|
#: lazarusidestrconsts.liskmcompileprojectprogram
|
|
msgid "Compile project/program"
|
|
msgstr "Käännä projekti/ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmconfigbuildfile
|
|
msgid "Config \"Build File\""
|
|
msgstr "Konfiguroi \"Kokoa tiedosto\""
|
|
|
|
#: lazarusidestrconsts.liskmconfigurecustomcomponents
|
|
msgid "Configure Custom Components"
|
|
msgstr "Konfiguroi mukautetut komponentit"
|
|
|
|
#: lazarusidestrconsts.liskmcontextsensitivehelp
|
|
msgid "Context sensitive help"
|
|
msgstr "Tilannekohtainen ohje"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
|
|
msgid "Convert Delphi package to Lazarus package"
|
|
msgstr "Muunna Delphi-paketti Lazarukselle"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
|
|
msgid "Convert Delphi Project to Lazarus Project"
|
|
msgstr "Muunna Delphi-projekti Lazarukselle"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit"
|
|
msgstr "Muunna Delphi-käännösyksikkö Lazarukselle"
|
|
|
|
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
|
|
msgid "Convert DFM File to LFM"
|
|
msgstr "Muunna DFM-tiedosto LFM:ksi"
|
|
|
|
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Copy selected Components to clipboard"
|
|
msgid "Copy selected components"
|
|
msgstr "Kopioi valitut komponentit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
|
|
#, fuzzy
|
|
#| msgid "Cut selected Components to clipboard"
|
|
msgid "Cut selected components"
|
|
msgstr "Leikkaa valitut komponentit leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.liskmdefaulttoosx
|
|
msgid "Default adapted to OS X"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liskmdeletelastchar
|
|
msgid "Delete last char"
|
|
msgstr "Poista viimeksi kirjoitettu merkki"
|
|
|
|
#: lazarusidestrconsts.liskmdiffeditorfiles
|
|
msgid "Diff Editor Files"
|
|
msgstr "Editorin tiedostojen erot"
|
|
|
|
#: lazarusidestrconsts.liskmeditcodetemplates
|
|
msgid "Edit Code Templates"
|
|
msgstr "Muokkaa koodimalleja"
|
|
|
|
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
|
|
msgid "Edit context sensitive help"
|
|
msgstr "Muokkaa tilannekohtaista ohjetta"
|
|
|
|
#: lazarusidestrconsts.liskmencloseselection
|
|
msgid "Enclose Selection"
|
|
msgstr "Kapseloi valinta"
|
|
|
|
#: lazarusidestrconsts.liskmevaluatemodify
|
|
msgid "Evaluate/Modify"
|
|
msgstr "Arvioi/Muuta"
|
|
|
|
#: lazarusidestrconsts.liskmexampleprojects
|
|
msgid "Example Projects"
|
|
msgstr "Esimerkkiprojektit"
|
|
|
|
#: lazarusidestrconsts.liskmexternaltoolssettings
|
|
msgid "External Tools settings"
|
|
msgstr "Ulkoisten työkalujen asetukset"
|
|
|
|
#: lazarusidestrconsts.liskmfindincremental
|
|
msgid "Find Incremental"
|
|
msgstr "Etsi kirjain kerrallaan"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker0
|
|
msgid "Go to bookmark 0"
|
|
msgstr "Siirry kirjanmerkkiin 0"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker1
|
|
msgid "Go to bookmark 1"
|
|
msgstr "Siirry kirjanmerkkiin 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker2
|
|
msgid "Go to bookmark 2"
|
|
msgstr "Siirry kirjanmerkkiin 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker3
|
|
msgid "Go to bookmark 3"
|
|
msgstr "Siirry kirjanmerkkiin 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker4
|
|
msgid "Go to bookmark 4"
|
|
msgstr "Siirry kirjanmerkkiin 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker5
|
|
msgid "Go to bookmark 5"
|
|
msgstr "Siirry kirjanmerkkiin 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker6
|
|
msgid "Go to bookmark 6"
|
|
msgstr "Siirry kirjanmerkkiin 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker7
|
|
msgid "Go to bookmark 7"
|
|
msgstr "Siirry kirjanmerkkiin 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker8
|
|
msgid "Go to bookmark 8"
|
|
msgstr "Siirry kirjanmerkkiin 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotomarker9
|
|
msgid "Go to bookmark 9"
|
|
msgstr "Siirry kirjanmerkkiin 9"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor1
|
|
msgid "Go to source editor 1"
|
|
msgstr "Siirry editoriin 1"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor10
|
|
msgid "Go to source editor 10"
|
|
msgstr "Siirry editoriin 10"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor2
|
|
msgid "Go to source editor 2"
|
|
msgstr "Siirry editoriin 2"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor3
|
|
msgid "Go to source editor 3"
|
|
msgstr "Siirry editoriin 3"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor4
|
|
msgid "Go to source editor 4"
|
|
msgstr "Siirry editoriin 4"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor5
|
|
msgid "Go to source editor 5"
|
|
msgstr "Siirry editoriin 5"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor6
|
|
msgid "Go to source editor 6"
|
|
msgstr "Siirry editoriin 6"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor7
|
|
msgid "Go to source editor 7"
|
|
msgstr "Siirry editoriin 7"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor8
|
|
msgid "Go to source editor 8"
|
|
msgstr "Siirry editoriin 8"
|
|
|
|
#: lazarusidestrconsts.liskmgotosourceeditor9
|
|
msgid "Go to source editor 9"
|
|
msgstr "Siirry editoriin 9"
|
|
|
|
#: lazarusidestrconsts.liskminsertdateandtime
|
|
msgid "Insert date and time"
|
|
msgstr "Liitä päivämäärä ja aika"
|
|
|
|
#: lazarusidestrconsts.liskminsertusername
|
|
msgid "Insert username"
|
|
msgstr "Liitä käyttäjänimi"
|
|
|
|
#: lazarusidestrconsts.liskminspect
|
|
msgid "Inspect"
|
|
msgstr "Tutki"
|
|
|
|
#: lazarusidestrconsts.liskmkeymappingscheme
|
|
msgid "Keymapping Scheme"
|
|
msgstr "Näppäinkartan kaava"
|
|
|
|
#: lazarusidestrconsts.liskmlazarusdefault
|
|
msgid "Lazarus (default)"
|
|
msgstr "Lazarus (oletus)"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxapple
|
|
msgid "Mac OS X (Apple style)"
|
|
msgstr "Mac OS X (Applen tyyli)"
|
|
|
|
#: lazarusidestrconsts.liskmmacosxlaz
|
|
msgid "Mac OS X (Lazarus style)"
|
|
msgstr "Mac OS X (Lazarus tyyli)"
|
|
|
|
#: lazarusidestrconsts.liskmnewpackage
|
|
msgid "New package"
|
|
msgstr "Uusi paketti"
|
|
|
|
#: lazarusidestrconsts.liskmnewproject
|
|
msgid "New project"
|
|
msgstr "Uusi projekti"
|
|
|
|
#: lazarusidestrconsts.liskmnewprojectfromfile
|
|
msgid "New project from file"
|
|
msgstr "Uusi projekti tiedostosta"
|
|
|
|
#: lazarusidestrconsts.liskmnewunit
|
|
msgctxt "lazarusidestrconsts.liskmnewunit"
|
|
msgid "New Unit"
|
|
msgstr "Uusi käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
|
|
msgid "Note: All keys will be set to the values of the chosen scheme."
|
|
msgstr "Huom.: kaikki näppäimet asetetaan valitun kaavan mukaisiksi."
|
|
|
|
#: lazarusidestrconsts.liskmopenpackagefile
|
|
msgid "Open package file"
|
|
msgstr "Avaa pakettitiedosto"
|
|
|
|
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
|
|
#, fuzzy
|
|
#| msgid "Paste Components from clipboard"
|
|
msgid "Paste Components"
|
|
msgstr "Liitä komponentit leikepöydältä"
|
|
|
|
#: lazarusidestrconsts.liskmpauseprogram
|
|
msgid "Pause program"
|
|
msgstr "Keskeytä ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmpublishproject
|
|
msgid "Publish project"
|
|
msgstr "Julkaise ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmquickcompilenolinking
|
|
msgid "Quick compile, no linking"
|
|
msgstr "Nopea käännös, ei linkitystä"
|
|
|
|
#: lazarusidestrconsts.liskmremoveactivefilefromproject
|
|
msgid "Remove Active File from Project"
|
|
msgstr "Poista aktiivinen tiedosto projektista"
|
|
|
|
#: lazarusidestrconsts.liskmrunprogram
|
|
msgid "Run program"
|
|
msgstr "Suorita ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmsaveall
|
|
msgid "SaveAll"
|
|
msgstr "Tallenna kaikki"
|
|
|
|
#: lazarusidestrconsts.liskmsaveas
|
|
msgid "SaveAs"
|
|
msgstr "Tallenna nimellä"
|
|
|
|
#: lazarusidestrconsts.liskmsaveproject
|
|
msgid "Save project"
|
|
msgstr "Tallenna projekti"
|
|
|
|
#: lazarusidestrconsts.liskmsaveprojectas
|
|
msgid "Save project as"
|
|
msgstr "Tallenna projekti nimellä"
|
|
|
|
#: lazarusidestrconsts.liskmselectlineend
|
|
msgctxt "lazarusidestrconsts.liskmselectlineend"
|
|
msgid "Select Line End"
|
|
msgstr "Valitse rivin loppu"
|
|
|
|
#: lazarusidestrconsts.liskmselectlinestart
|
|
msgctxt "lazarusidestrconsts.liskmselectlinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Valitse rivin alku"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagebottom
|
|
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Valitse sivun loppu"
|
|
|
|
#: lazarusidestrconsts.liskmselectpagetop
|
|
msgctxt "lazarusidestrconsts.liskmselectpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Valitse sivun alku"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordleft
|
|
msgctxt "lazarusidestrconsts.liskmselectwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Valitse sana vasemmalla"
|
|
|
|
#: lazarusidestrconsts.liskmselectwordright
|
|
msgctxt "lazarusidestrconsts.liskmselectwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Valitse sana oikealla"
|
|
|
|
#: lazarusidestrconsts.liskmsetfreebookmark
|
|
msgid "Set free Bookmark"
|
|
msgstr "Aseta vapaa kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker0
|
|
msgid "Set bookmark 0"
|
|
msgstr "Aseta kirjanmerkki 0"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker1
|
|
msgid "Set bookmark 1"
|
|
msgstr "Aseta kirjanmerkki 1"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker2
|
|
msgid "Set bookmark 2"
|
|
msgstr "Aseta kirjanmerkki 2"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker3
|
|
msgid "Set bookmark 3"
|
|
msgstr "Aseta kirjanmerkki 3"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker4
|
|
msgid "Set bookmark 4"
|
|
msgstr "Aseta kirjanmerkki 4"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker5
|
|
msgid "Set bookmark 5"
|
|
msgstr "Aseta kirjanmerkki 5"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker6
|
|
msgid "Set bookmark 6"
|
|
msgstr "Aseta kirjanmerkki 6"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker7
|
|
msgid "Set bookmark 7"
|
|
msgstr "Aseta kirjanmerkki 7"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker8
|
|
msgid "Set bookmark 8"
|
|
msgstr "Aseta kirjanmerkki 8"
|
|
|
|
#: lazarusidestrconsts.liskmsetmarker9
|
|
msgid "Set bookmark 9"
|
|
msgstr "Aseta kirjanmerkki 9"
|
|
|
|
#: lazarusidestrconsts.liskmstopprogram
|
|
msgid "Stop Program"
|
|
msgstr "Pysäytä ohjelma"
|
|
|
|
#: lazarusidestrconsts.liskmtogglebetweenunitandform
|
|
msgid "Toggle between Unit and Form"
|
|
msgstr "Siirry käännösyksikön ja lomakkeen välillä"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker0
|
|
msgid "Toggle bookmark 0"
|
|
msgstr "Vaihda kirjanmerkki 0"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker1
|
|
msgid "Toggle bookmark 1"
|
|
msgstr "Vaihda kirjanmerkki 1"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker2
|
|
msgid "Toggle bookmark 2"
|
|
msgstr "Vaihda kirjanmerkki 2"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker3
|
|
msgid "Toggle bookmark 3"
|
|
msgstr "Vaihda kirjanmerkki 3"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker4
|
|
msgid "Toggle bookmark 4"
|
|
msgstr "Vaihda kirjanmerkki 4"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker5
|
|
msgid "Toggle bookmark 5"
|
|
msgstr "Vaihda kirjanmerkki 5"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker6
|
|
msgid "Toggle bookmark 6"
|
|
msgstr "Vaihda kirjanmerkki 6"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker7
|
|
msgid "Toggle bookmark 7"
|
|
msgstr "Vaihda kirjanmerkki 7"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker8
|
|
msgid "Toggle bookmark 8"
|
|
msgstr "Vaihda kirjanmerkki 8"
|
|
|
|
#: lazarusidestrconsts.liskmtogglemarker9
|
|
msgid "Toggle bookmark 9"
|
|
msgstr "Vaihda kirjanmerkki 9"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewassembler
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
|
|
msgid "View Assembler"
|
|
msgstr "Näytä Assembler"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
|
|
msgid "View Breakpoints"
|
|
msgstr "Näytä keskeytyskohdat"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcallstack
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Näytä kutsu-pino"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
|
|
msgid "Toggle view Code Browser"
|
|
msgstr "Vaihda näkymä koodin selaimeen"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
|
|
msgid "Toggle view Code Explorer"
|
|
msgstr "Vaihda näkymä koodin tutkijaan"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
|
|
msgid "Toggle View Component Palette"
|
|
msgstr "Vaihda komponenttipaletti näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebugevents
|
|
msgid "View Debuger Event Log"
|
|
msgstr "Näytä virheenjäljittimen tapahtumat"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
|
|
msgid "View Debugger Output"
|
|
msgstr "Näytä virheenjäljittimen tuloste"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
|
|
msgid "Toggle view Documentation Editor"
|
|
msgstr "Vaihda dokumentti-editori näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewhistory
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
|
|
msgid "View History"
|
|
msgstr "Näytä historia"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
|
|
msgid "Toggle view IDE speed buttons"
|
|
msgstr "Vaihda IDEn pikavalintojen näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
|
|
msgid "View Local Variables"
|
|
msgstr "Näytä paikalliset muuttujat"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewmessages
|
|
msgid "Toggle view Messages"
|
|
msgstr "Vaihda viestien näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
|
|
msgid "Toggle view Object Inspector"
|
|
msgstr "Vaihda komponenttimuokkain näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr "Näytä komentorivituloste"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewregisters
|
|
msgid "View Registers"
|
|
msgstr "Näytä rekisterit"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsearchresults
|
|
msgid "Toggle view Search Results"
|
|
msgstr "Vaihda hakutuloksien näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
|
|
msgid "Toggle view Source Editor"
|
|
msgstr "Vaihda lähdekoodimuokkaimen näkymä"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewthreads
|
|
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Näytä säikeet"
|
|
|
|
#: lazarusidestrconsts.liskmtoggleviewwatches
|
|
msgid "View Watches"
|
|
msgstr "Näytä vahdit"
|
|
|
|
#: lazarusidestrconsts.liskmviewjumphistory
|
|
msgid "View jump history"
|
|
msgstr "Näytä hyppyhistoria"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectoptions
|
|
msgid "View project options"
|
|
msgstr "Näytä projektin asetukset"
|
|
|
|
#: lazarusidestrconsts.liskmviewprojectsource
|
|
msgid "View Project Source"
|
|
msgstr "Näytä projektin lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.liskmviewunitinfo
|
|
msgid "View Unit Info"
|
|
msgstr "Näytä käännösyksikön tietoja"
|
|
|
|
#: lazarusidestrconsts.lislastopened
|
|
msgid "Last opened"
|
|
msgstr "Viimeinen avattu"
|
|
|
|
#: lazarusidestrconsts.lislaunchingapplicationinvalid
|
|
msgid "Launching application invalid"
|
|
msgstr "Käynnistävä ohjelma on kelvoton"
|
|
|
|
#: lazarusidestrconsts.lislaunchingcmdline
|
|
msgid "Launching target command line"
|
|
msgstr "Käynnistävä kohteen komentorivi"
|
|
|
|
#: lazarusidestrconsts.lislazarus
|
|
msgctxt "lazarusidestrconsts.lislazarus"
|
|
msgid "Lazarus"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazarusdefault
|
|
msgid "Lazarus Default"
|
|
msgstr "Lazarus oletukset"
|
|
|
|
#: lazarusidestrconsts.lislazarusdirectory
|
|
msgid "Lazarus directory"
|
|
msgstr "Lazaruksen hakemisto"
|
|
|
|
#: lazarusidestrconsts.lislazarusdiroverride
|
|
msgid "directory, to be used as a basedirectory"
|
|
msgstr "hakemisto, käytetään kantahakemistona"
|
|
|
|
#: lazarusidestrconsts.lislazaruseditorv
|
|
msgid "Lazarus IDE v%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruside
|
|
msgid "Lazarus IDE"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguageid
|
|
msgid "Lazarus language ID (e.g. en, de, br, fi)"
|
|
msgstr "Lazarus kieli-ID (esim. en, de, br, fi)"
|
|
|
|
#: lazarusidestrconsts.lislazaruslanguagename
|
|
msgid "Lazarus language name (e.g. english, deutsch)"
|
|
msgstr "Lazarus kieli-nimi (esim. english, deutsch)"
|
|
|
|
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
|
|
msgid "lazarus [options] <project-filename>"
|
|
msgstr "lazarus [valinnat] <projekti-tiedosto>"
|
|
|
|
#: lazarusidestrconsts.lislazbuildaboaction
|
|
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
|
|
msgid "Action"
|
|
msgstr "Toiminta"
|
|
|
|
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
|
|
msgid "Choose output directory of the IDE executable "
|
|
msgstr "Valitse IDE:n käännöshakemisto "
|
|
|
|
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
|
|
msgid "Are you sure you want to delete this build profile?"
|
|
msgstr "Tahdotko varmasti poistaa tämän koontaprofiilin?"
|
|
|
|
#: lazarusidestrconsts.lislazbuildbuildmany
|
|
msgid "Build Many"
|
|
msgstr "Kokoa monta"
|
|
|
|
#: lazarusidestrconsts.lislazbuildcommonsettings
|
|
msgid "Common Settings"
|
|
msgstr "Yleiset asetukset"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmbuild
|
|
msgid "Confirm before build"
|
|
msgstr "Varmista ennen kokoamista"
|
|
|
|
#: lazarusidestrconsts.lislazbuildconfirmdeletion
|
|
msgid "Confirm deletion"
|
|
msgstr "Varmista poistaminen"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddebugide
|
|
msgid "Debug IDE"
|
|
msgstr "Virheenjäljitys-IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefines
|
|
msgid "Defines"
|
|
msgstr "Määritteet"
|
|
|
|
#: lazarusidestrconsts.lislazbuilddefineswithoutd
|
|
msgid "Defines without -d"
|
|
msgstr "Määrite ilman -d"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditdefines
|
|
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
|
|
msgid "Edit Defines"
|
|
msgstr "Muokkaa määritteitä"
|
|
|
|
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
|
|
msgid "Edit list of defines which can be used by any profile"
|
|
msgstr "Muokkaa määrite-luetteloa, mitä voidaan käyttää kaikille profiileille"
|
|
|
|
#: lazarusidestrconsts.lislazbuilderrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Virhe kirjoitettaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
|
|
msgid "%s%s%s%slazbuild is non interactive, aborting now."
|
|
msgstr "%s%s%s%slazbuild ei ole interaktiivinen, poistutaan."
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles
|
|
msgid "Manage Build Profiles"
|
|
msgstr "Hallinnoi koontaprofiileja"
|
|
|
|
#: lazarusidestrconsts.lislazbuildmanageprofiles2
|
|
msgid "Manage profiles"
|
|
msgstr "Hallinnoi profiileja"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
|
|
msgid "Name of the active profile"
|
|
msgstr "Aktiivisen profiilin nimi"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprof
|
|
msgid "Add New Profile"
|
|
msgstr "Lisää uusi profiili"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnewprofinfo
|
|
msgid "Current build options will be associated with:"
|
|
msgstr "Nykyiset koonta-asetukset liitetään:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildnormalide
|
|
msgid "Normal IDE"
|
|
msgstr "Normaali IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptimizedide
|
|
msgid "Optimized IDE"
|
|
msgstr "Optimoitu IDE"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptions
|
|
msgid "Options:"
|
|
msgstr "Asetukset:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
|
|
msgid "Options passed to compiler"
|
|
msgstr "Kääntäjän saamat asetukset"
|
|
|
|
#: lazarusidestrconsts.lislazbuildprofile
|
|
msgid "Profile to build"
|
|
msgstr "Koottava profiili"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprof
|
|
msgid "Rename Profile"
|
|
msgstr "Nimeä profiili uudestaan"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrenameprofinfo
|
|
msgid "New name for profile:"
|
|
msgstr "Profiilin uusi nimi:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartafterbuild
|
|
msgid "Restart after building IDE"
|
|
msgstr "Käynnistä uudelleen kokoamisen jälkeen"
|
|
|
|
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
|
|
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
|
|
msgstr "Käynnistä Lazarus automaattisesti IDE:n kokoamisen jälkeen (ei vaikuta, kun kootaan muita osia)"
|
|
|
|
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
|
|
msgid "Select profiles to build"
|
|
msgstr "Valitse koottavat profiilit"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
|
|
msgid "Show confirmation dialog when building directly from Tools menu"
|
|
msgstr "Kysy varmistusta, kun kootaan suoraan Työkalut-valikosta"
|
|
|
|
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
|
|
msgid "Show options and defines for command line"
|
|
msgstr "Näytä komentorivin asetukset ja määritteet"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetcpu
|
|
msgid "Target CPU:"
|
|
msgstr "Kohde-CPU:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetdirectory
|
|
msgid "Target directory:"
|
|
msgstr "Kohdehakemisto:"
|
|
|
|
#: lazarusidestrconsts.lislazbuildtargetos
|
|
msgid "Target OS:"
|
|
msgstr "Kohdekäyttöjärjestelmä"
|
|
|
|
#: lazarusidestrconsts.lislazbuildunabletowritefile
|
|
msgid "Unable to write file \"%s\":%s"
|
|
msgstr "Tiedoston \"%s\":%s tallennus epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevinc
|
|
msgid "Update revision.inc"
|
|
msgstr "Päivitä revision.inc"
|
|
|
|
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
|
|
msgid "Update revision info in \"About Lazarus\" dialog"
|
|
msgstr "Päivitä revisiokenttä \"Tietoja Lazaruksesta\" ikkunassa"
|
|
|
|
#: lazarusidestrconsts.lislazcleanupbuildall
|
|
msgid "Clean Up + Build all"
|
|
msgstr "Siivoa + kokoa kaikki"
|
|
|
|
#: lazarusidestrconsts.lislazver
|
|
msgid "Lazarus Version (e.g. 1.2.4)"
|
|
msgstr "Lazarus Versio (esim. 1.2.4)"
|
|
|
|
#: lazarusidestrconsts.lislclwidgettype
|
|
msgid "LCL widget type"
|
|
msgstr "LCL-käyttöliittymäkirjasto"
|
|
|
|
#: lazarusidestrconsts.lisldaddlinktoinherited
|
|
msgid "Add link to inherited"
|
|
msgstr "Lisää linkki perittyyn"
|
|
|
|
#: lazarusidestrconsts.lisldcopyfrominherited
|
|
msgid "Copy from inherited"
|
|
msgstr "Kopioi peritystä"
|
|
|
|
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
|
|
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
|
|
msgstr "%s:lla ei ole kelvollista FPDoc polkua.%sEi voida luoda fpdoc tiedostoa %s:lle"
|
|
|
|
#: lazarusidestrconsts.lisldmoveentriestoinherited
|
|
msgid "Move entries to inherited"
|
|
msgstr "Siirrä kohdat perittyyn"
|
|
|
|
#: lazarusidestrconsts.lisldnovalidfpdocpath
|
|
msgid "No valid FPDoc path"
|
|
msgstr "Ei kelvollista FPDoc polkua"
|
|
|
|
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
|
|
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
|
|
msgstr "Käännösyksikkö %s ei kuulu mihinkään pakettiin tai projektiin.%sLisää se johonkin.%sfpdoc tiedoston luonti ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisleft
|
|
msgctxt "lazarusidestrconsts.lisleft"
|
|
msgid "Left"
|
|
msgstr "Vasen"
|
|
|
|
#: lazarusidestrconsts.lisleftborderspacespinedithint
|
|
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
|
|
msgstr "Vasen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen."
|
|
|
|
#: lazarusidestrconsts.lisleftgroupboxcaption
|
|
msgid "Left anchoring"
|
|
msgstr "Vasemman reunan ankkurointi"
|
|
|
|
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Tämä on naapurikontrolli, mihin vasen reuna on ankkuroitu. Tyhjä tarkoittaa ankkurointia Delphi-tyyliin (BorderSpacing and ReferenceSide eivät vaikuta)."
|
|
|
|
#: lazarusidestrconsts.lisleftsides
|
|
msgid "Left sides"
|
|
msgstr "Vasemmat reunat"
|
|
|
|
#: lazarusidestrconsts.lisleftspaceequally
|
|
msgid "Left space equally"
|
|
msgstr "Tasaa välit vasemmalla"
|
|
|
|
#: lazarusidestrconsts.lisless
|
|
msgctxt "lazarusidestrconsts.lisless"
|
|
msgid "Less"
|
|
msgstr "Vähemmän"
|
|
|
|
#: lazarusidestrconsts.lislevels
|
|
msgid "Levels"
|
|
msgstr "Tasot"
|
|
|
|
#: lazarusidestrconsts.lislfmfile
|
|
msgid "LFM file"
|
|
msgstr "LFM-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
|
|
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
|
|
msgstr "LFM tiedostossa on tuntemattomia ominaisuuksia/luokkia, mitä ei ole LCL:ssä. Ne voidaan korvata tai poistaa."
|
|
|
|
#: lazarusidestrconsts.lislfmfilecorrupt
|
|
msgid "LFM file corrupt"
|
|
msgstr "LFM tiedosto on rikki"
|
|
|
|
#: lazarusidestrconsts.lislfmisok
|
|
msgid "LFM is ok"
|
|
msgstr "LFM on kunnossa"
|
|
|
|
#: lazarusidestrconsts.lislgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lislibrarypath
|
|
msgid "library path"
|
|
msgstr "kirjastopolku"
|
|
|
|
#: lazarusidestrconsts.lislibraryprogramdescriptor
|
|
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
|
|
msgstr "Free Pascal jaettu kirjasto (.dll Windowsissa, .so Linuxissa, .dylib MacOS X:ssä)."
|
|
|
|
#: lazarusidestrconsts.lisline
|
|
msgid "Line:"
|
|
msgstr "Rivi:"
|
|
|
|
#: lazarusidestrconsts.lislinelength
|
|
msgid "Line/Length"
|
|
msgstr "Rivi/Pituus"
|
|
|
|
#: lazarusidestrconsts.lislink
|
|
msgid "Link:"
|
|
msgstr "Linkki:"
|
|
|
|
#: lazarusidestrconsts.lislinkeroptions
|
|
msgid "linker options"
|
|
msgstr "linkittäjän asetukset"
|
|
|
|
#: lazarusidestrconsts.lislinktarget
|
|
msgid "Link target"
|
|
msgstr "Linkityskohde"
|
|
|
|
#: lazarusidestrconsts.lislistofallcasevalues
|
|
msgid "list of all case values"
|
|
msgstr "luettelo kaikista case-arvoista"
|
|
|
|
#: lazarusidestrconsts.lisloadingfailed
|
|
msgid "Loading %s failed."
|
|
msgstr "%s lataus epäonnistui."
|
|
|
|
#: lazarusidestrconsts.lisloadmacrofrom
|
|
msgid "Load macro from"
|
|
msgstr "Lataa makro:"
|
|
|
|
#: lazarusidestrconsts.lislocal
|
|
msgid "&Local"
|
|
msgstr "&Paikallinen"
|
|
|
|
#: lazarusidestrconsts.lislocals
|
|
msgid "Locals"
|
|
msgstr "Paikalliset"
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyname
|
|
msgid "&Copy Name"
|
|
msgstr "&Kopioi nimi"
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
|
|
msgid "Copy &RAW Value"
|
|
msgstr "Kopioi &RAW arvo"
|
|
|
|
#: lazarusidestrconsts.lislocalsdlgcopyvalue
|
|
msgid "C&opy Value"
|
|
msgstr "K&opioi arvo"
|
|
|
|
#: lazarusidestrconsts.lislocalsnotevaluated
|
|
msgid "Locals not evaluated"
|
|
msgstr "Paikallisia ei arvioitu"
|
|
|
|
#: lazarusidestrconsts.lislogcallstack
|
|
msgid "Log Call Stack"
|
|
msgstr "Kirjaa kutsupino"
|
|
|
|
#: lazarusidestrconsts.lislogcallstacklimit
|
|
msgid "(frames limit. 0 - no limits)"
|
|
msgstr "(kehyksen raja. 0 - ei rajoja)"
|
|
|
|
#: lazarusidestrconsts.lislogevalexpression
|
|
msgctxt "lazarusidestrconsts.lislogevalexpression"
|
|
msgid "Eval expression"
|
|
msgstr "Eval lauseke"
|
|
|
|
#: lazarusidestrconsts.lislogmessage
|
|
msgid "Log Message"
|
|
msgstr "Kirjaa viesti"
|
|
|
|
#: lazarusidestrconsts.lislowercasestring
|
|
msgid "lowercase string"
|
|
msgstr "muuta teksti pieneksi"
|
|
|
|
#: lazarusidestrconsts.lislowercasestringgivenasparameter
|
|
msgid "Lowercase string given as parameter."
|
|
msgstr "Muuta parametrin teksti pieneksi."
|
|
|
|
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
|
|
msgid "lpk has vanished on disk. Using as alternative%s"
|
|
msgstr "lpk on kadonnut levyltä. Käytetään vaihtoehtoisena%s"
|
|
|
|
#: lazarusidestrconsts.lislpkismissing
|
|
msgid "lpk is missing"
|
|
msgstr "lpk puuttuu"
|
|
|
|
#: lazarusidestrconsts.lislrsincludefiles
|
|
msgid "Lazarus resources (.lrs) include files"
|
|
msgstr "Lazarus resurssi (.lrs) include-tiedostot"
|
|
|
|
#: lazarusidestrconsts.lismacro
|
|
msgid "Macro %s"
|
|
msgstr "Makro %s"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterdata
|
|
msgid "Enter data"
|
|
msgstr "Anna data"
|
|
|
|
#: lazarusidestrconsts.lismacropromptenterrunparameters
|
|
msgid "Enter run parameters"
|
|
msgstr "Syötä suoritusparametrit"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
|
|
msgid "Main unit has Application.CreateForm statements"
|
|
msgstr "Pääohjelmassa on Application.CreateForm -lause"
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
|
|
msgid "Main unit has Application.Scaled statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
|
|
msgid "Main unit has Application.Title statement"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
|
|
msgid "Main unit has Uses section containing all units of project"
|
|
msgstr "Pääohjelman Uses-lauseessa on kaikki projektin käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsource
|
|
msgid "Main unit is Pascal source"
|
|
msgstr "Päätiedosto on Pascal-koodia"
|
|
|
|
#: lazarusidestrconsts.lismainunitispascalsourcehint
|
|
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
|
|
msgstr "Oleta Pascal vaikkei pääte olisi .pas/.pp."
|
|
|
|
#: lazarusidestrconsts.lismakeexe
|
|
msgid "Make Executable"
|
|
msgstr "Make-ohjelma"
|
|
|
|
#: lazarusidestrconsts.lismakenotfound
|
|
msgid "Make not found"
|
|
msgstr "Make ei löydy"
|
|
|
|
#: lazarusidestrconsts.lismakeresourcestring
|
|
msgid "Make ResourceString"
|
|
msgstr "Tee resurssiteksti"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrappendtosection
|
|
msgid "Append to section"
|
|
msgstr "Lisää osaan"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrchooseanothername
|
|
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
|
|
msgstr "Resurssiteksti \"%s\" on jo olemassa.%sValitse toinen nimi.%sValitse Ohita lisätäksesi sen joka tapauksessa."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrconversionoptions
|
|
msgid "Conversion Options"
|
|
msgstr "Muunnoksen optiot"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrcustomidentifier
|
|
msgid "Custom identifier"
|
|
msgstr "Mukautettu tunniste"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrdialogidentifier
|
|
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
|
|
msgid "Identifier"
|
|
msgstr "Tunniste"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierlength
|
|
msgid "Identifier length:"
|
|
msgstr "Tunnisteen pituus:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstridentifierprefix
|
|
msgid "Identifier prefix:"
|
|
msgstr "Tunnisteen etuliite:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
|
|
msgid "Insert alphabetically"
|
|
msgstr "Liitä aakkosjärjestyksessä"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
|
|
msgid "Insert context sensitive"
|
|
msgstr "Liitä tilannekohtainen"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
|
|
msgid "Invalid Resourcestring section"
|
|
msgstr "Kelvoton resurssitekstin osio"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
|
|
msgid "Please choose a resourcestring section from the list."
|
|
msgstr "Valitse resurssitekstin osio luettelosta."
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
|
|
msgid "Resourcestring already exists"
|
|
msgstr "Resurssiteksti on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrresourcestringsection
|
|
msgid "Resourcestring section:"
|
|
msgstr "Resurssitekstin osio:"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrsourcepreview
|
|
msgid "Source preview"
|
|
msgstr "Lähdekoodin esikatselu"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
|
|
msgid "String constant in source"
|
|
msgstr "Tekstivakio lähdekoodissa"
|
|
|
|
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
|
|
msgid "Strings with same value:"
|
|
msgstr "Tekstit missä sama arvo:"
|
|
|
|
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
|
|
msgid "Make sure all ppu files of a package are in its output directory."
|
|
msgstr "Varmista että paketin kaikki ppu tiedostot ovat käännöshakemistossa."
|
|
|
|
#: lazarusidestrconsts.lismanagesourceeditors
|
|
msgid "Manage Source Editors ..."
|
|
msgstr "Hallinnoi lähdekoodieditoria ..."
|
|
|
|
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
|
|
msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
|
|
msgstr "Rinnakkaiseen käännökseen käytettävien säikeiden maximimäärä. Oletus on 0, mikä arvaa prosessorin ytimien määrän."
|
|
|
|
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
|
|
msgid "Maximum parallel processes, 0 means default (%s)"
|
|
msgstr "Suurin rinnakkaisten prosessien määrä, 0 tarkoittaa oletusta (%s)"
|
|
|
|
#: lazarusidestrconsts.lismaxs
|
|
msgid "Max %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
|
|
msgid "%s Maybe you have to recompile the package."
|
|
msgstr "%s Paketti pitää ehkä kääntää uudelleen."
|
|
|
|
#: lazarusidestrconsts.lismb
|
|
msgid "%s MB"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismeaction
|
|
msgctxt "lazarusidestrconsts.lismeaction"
|
|
msgid "Action"
|
|
msgstr "Toiminta"
|
|
|
|
#: lazarusidestrconsts.lismemorydump
|
|
msgid "Memory Dump"
|
|
msgstr "Muistin sisältö"
|
|
|
|
#: lazarusidestrconsts.lismenuabortbuild
|
|
msgid "Abort Build"
|
|
msgstr "Keskeytä kokoaminen"
|
|
|
|
#: lazarusidestrconsts.lismenuaboutfpc
|
|
msgid "About FPC"
|
|
msgstr "Tietoja FPC:stä"
|
|
|
|
#: lazarusidestrconsts.lismenuaddbreakpoint
|
|
msgid "Add &Breakpoint"
|
|
msgstr "Lisää &keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.lismenuaddcurfiletopkg
|
|
msgid "Add Active File to Package ..."
|
|
msgstr "Lisää aktiivinen tiedosto pakettiin ..."
|
|
|
|
#: lazarusidestrconsts.lismenuaddjumppointtohistory
|
|
msgid "Add Jump Point to History"
|
|
msgstr "Lisää hyppypiste historiaan"
|
|
|
|
#: lazarusidestrconsts.lismenuaddtoproject
|
|
msgid "Add Editor File to Project"
|
|
msgstr "Lisää aktiivinen tiedosto projektiin"
|
|
|
|
#: lazarusidestrconsts.lismenuaddwatch
|
|
msgid "Add &Watch ..."
|
|
msgstr "Lisää &vahti ..."
|
|
|
|
#: lazarusidestrconsts.lismenubeaklinesinselection
|
|
msgid "Break Lines in Selection"
|
|
msgstr "Rivitä valinta uudelleen"
|
|
|
|
#: lazarusidestrconsts.lismenubreak
|
|
msgid "&Break"
|
|
msgstr "&Keskeytä"
|
|
|
|
#: lazarusidestrconsts.lismenubuildfile
|
|
msgid "Build File"
|
|
msgstr "Kokoa tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarus
|
|
msgid "Build Lazarus with Current Profile"
|
|
msgstr "Kokoa Lazarus käyttäen nykyistä profiilia"
|
|
|
|
#: lazarusidestrconsts.lismenubuildlazarusprof
|
|
msgid "Build Lazarus with Profile: %s"
|
|
msgstr "Kokoa Lazarus käyttäen profiilia: %s"
|
|
|
|
#: lazarusidestrconsts.lismenuchecklfm
|
|
msgid "Check LFM File in Editor"
|
|
msgstr "Tarkista editorissa oleva LFM-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenucleandirectory
|
|
msgid "Clean Directory ..."
|
|
msgstr "Siivoa hakemisto ..."
|
|
|
|
#: lazarusidestrconsts.lismenucleanupandbuild
|
|
msgid "Clean up and Build ..."
|
|
msgstr "Siivoa ja kokoa ..."
|
|
|
|
#: lazarusidestrconsts.lismenucloseall
|
|
msgid "Close A&ll"
|
|
msgstr "Sulje &kaikki"
|
|
|
|
#: lazarusidestrconsts.lismenucloseeditorfile
|
|
msgid "&Close Editor File"
|
|
msgstr "&Sulje editorin tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenucloseproject
|
|
msgid "Close Project"
|
|
msgstr "Sulje projekti"
|
|
|
|
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
|
|
msgid "CodeTools Defines Editor ..."
|
|
msgstr "CodeTools-määritysten muokkain ..."
|
|
|
|
#: lazarusidestrconsts.lismenucommentselection
|
|
msgid "Comment Selection"
|
|
msgstr "Kommentoi valinta"
|
|
|
|
#: lazarusidestrconsts.lismenucomparefiles
|
|
msgid "Compare files ..."
|
|
msgstr "Vertaa tiedostoja ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompilemanymodes
|
|
msgid "Compile many Modes ..."
|
|
msgstr "Käännä monta moodia ..."
|
|
|
|
#: lazarusidestrconsts.lismenucompletecode
|
|
msgctxt "lazarusidestrconsts.lismenucompletecode"
|
|
msgid "Complete Code"
|
|
msgstr "Täydennä koodi"
|
|
|
|
#: lazarusidestrconsts.lismenucompletecodeinteractive
|
|
msgid "Complete Code (with dialog)"
|
|
msgstr "Täydennä koodi (ikkunan kanssa)"
|
|
|
|
#: lazarusidestrconsts.lismenuconfigbuildfile
|
|
msgid "Configure Build+Run File ..."
|
|
msgstr "Konfiguroi Kokoa+Suorita tiedosto ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigcustomcomps
|
|
msgid "Configure Custom Components ..."
|
|
msgstr "Konfiguroi mukautetut komponentit ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigexternaltools
|
|
msgid "Configure External Tools ..."
|
|
msgstr "Muokkaa ulkoisia työkaluja ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
|
|
msgid "Configure \"Build Lazarus\" ..."
|
|
msgstr "Konfiguroi \"Lazaruksen kokoaminen\" ..."
|
|
|
|
#: lazarusidestrconsts.lismenucontexthelp
|
|
msgid "Context sensitive Help"
|
|
msgstr "Tilannekohtainen ohje"
|
|
|
|
#: lazarusidestrconsts.lismenucontinue
|
|
msgid "&Continue"
|
|
msgstr "&Jatka"
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphipackage
|
|
msgid "Convert Delphi Package to Lazarus Package ..."
|
|
msgstr "Muunna Delphi-paketti Lazarukselle ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiproject
|
|
msgid "Convert Delphi Project to Lazarus Project ..."
|
|
msgstr "Muunna Delphi-projekti Lazarukselle ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdelphiunit
|
|
msgid "Convert Delphi Unit to Lazarus Unit ..."
|
|
msgstr "Muunna Delphi-käännösyksikkö Lazarukselle ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertdfmtolfm
|
|
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
|
|
msgstr "Muunna binaarinen DFM-tiedosto teksti-LFM:ksi ja tarkista kielioppi ..."
|
|
|
|
#: lazarusidestrconsts.lismenuconvertencoding
|
|
msgid "Convert Encoding of Projects/Packages ..."
|
|
msgstr "Muunna projektin/paketin merkkikoodaus ..."
|
|
|
|
#: lazarusidestrconsts.lismenudebugwindows
|
|
msgid "Debug Windows"
|
|
msgstr "Virheenjäljitysikkunat"
|
|
|
|
#: lazarusidestrconsts.lismenudelphiconversion
|
|
msgid "Delphi Conversion"
|
|
msgstr "Delphi muunnos"
|
|
|
|
#: lazarusidestrconsts.lismenuedit
|
|
msgid "&Edit"
|
|
msgstr "&Muokkaa"
|
|
|
|
#: lazarusidestrconsts.lismenueditcodetemplates
|
|
msgid "Code Templates ..."
|
|
msgstr "Koodimallit ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditcontexthelp
|
|
msgid "Edit context sensitive Help"
|
|
msgstr "Muokkaa tilannekohtaista ohjetta"
|
|
|
|
#: lazarusidestrconsts.lismenueditinstallpkgs
|
|
msgid "Install/Uninstall Packages ..."
|
|
msgstr "Asenna/Poista paketteja ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
|
|
msgid "Accelerator(&&) key \"%s\" needs changing"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
|
|
msgid "Add a new item above selected item"
|
|
msgstr "Lisää uusi kohta valitun yläpuolelle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
|
|
msgid "Add a new item after selected item"
|
|
msgstr "Lisää uusi kohta valitun jälkeen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
|
|
msgid "Add a new item before selected item"
|
|
msgstr "Lisää uusi kohta ennen valittua"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
|
|
msgid "Add a new item below selected item"
|
|
msgstr "Lisää uusi kohta valitun alapuolelle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
|
|
msgid "Add a submenu at the right of selected item"
|
|
msgstr "Lisää alavalikko valitun kohdan oikealle puolelle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
|
|
msgid "Add a submenu below selected item"
|
|
msgstr "Lisää alavalikko valitun kohdan alle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddfromtemplate
|
|
msgid "&Add from template ..."
|
|
msgstr "&Lisää mallineesta ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddiconfroms
|
|
msgid "Add icon from %s"
|
|
msgstr "Lisää kuvake %s:sta"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddimagelisticon
|
|
msgid "Add imagelist &icon"
|
|
msgstr "Lisää kuvalistan &kuvake"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddmenuitem
|
|
msgid "Add menu item"
|
|
msgstr "Lisää valikon kohta"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemabove
|
|
msgid "&Add new item above"
|
|
msgstr "&Lisää uusi kohta yläpuolelle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitemafter
|
|
msgid "Add ne&w item after"
|
|
msgstr "Lisää &uusi kohta jälkeen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembefore
|
|
msgid "&Add new item before"
|
|
msgstr "&Lisää uusi kohta ennen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddnewitembelow
|
|
msgid "Add ne&w item below"
|
|
msgstr "Lisää &uusi kohta alle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddonclickhandler
|
|
msgid "Add &OnClick handler"
|
|
msgstr "Lisää &OnClick käsittelijä"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorafter
|
|
msgid "Add separator &after"
|
|
msgstr "Lisää erotin &jälkeen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
|
|
msgid "Add separator &before"
|
|
msgstr "Lisää erotin &ennen"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenu
|
|
msgid "Add submenu"
|
|
msgstr "Lisää alavalikko"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
|
|
msgid "Add &submenu below"
|
|
msgstr "Lisää &alavalikko alle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoraddsubmenuright
|
|
msgid "Add &submenu right"
|
|
msgstr "Lisää &alavalikko oikealle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
|
|
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
|
|
msgstr "Uusi valikkomalli \"%s\" on tallennettu %s:n mukaan, %d alikohdan kanssa"
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
|
|
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
|
|
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
|
|
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
|
|
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaption
|
|
msgid "Caption"
|
|
msgstr "Otsikko"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptioneditemss
|
|
msgid "Captioned items: %s"
|
|
msgstr "Otsikoidut kohdat: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
|
|
msgid "Caption should not be blank"
|
|
msgstr "Otsikko ei saa olla tyhjä"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
|
|
msgid "Change conflicting accelerator \"%s\""
|
|
msgstr "Muuta ristiriitainen pikanäppäin \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
|
|
msgid "Change imagelist &icon"
|
|
msgstr "Muuta kuvalistan &kuvake"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
|
|
msgid "Change %s for %s"
|
|
msgstr "Muuta %s %s:ksi"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
|
|
msgid "Change shortcut conflict \"%s\""
|
|
msgstr "Muuta pikanäppäimen ristiriita \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
|
|
msgid "Change the shortCut for %s"
|
|
msgstr "%s:n pikanäppäimen muuttaminen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
|
|
msgid "Change the shortCutKey2 for %s"
|
|
msgstr "Muuta %s:n pikanäppäin2"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
|
|
msgid "Choose template to delete"
|
|
msgstr "Valitse poistettava malline"
|
|
|
|
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
|
|
msgid "Choose template to insert"
|
|
msgstr "Valitse lisättävä malline"
|
|
|
|
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
|
|
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
|
|
msgstr "Klikkaa ei-tummennettua kohtaa muokataksesi pikanäppäintä tai klikkaa otsikkoa järjestääksesi rivit"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
|
|
msgid "Component is unexpected kind"
|
|
msgstr "Komponentin tyyppi on odottamaton"
|
|
|
|
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
|
|
msgid "Component is unnamed"
|
|
msgstr "Komponenttia ei ole nimetty"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
|
|
msgid "<conflict resolution complete>"
|
|
msgstr "<Ristiriidan käsittely valmis>"
|
|
|
|
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
|
|
msgid "Conflicts found initially: %d"
|
|
msgstr "Ristiriitoja löytyi aluksi: %d"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
|
|
msgid "Deepest nested menu level: %s"
|
|
msgstr "Sisäkkäisten kohtien syvin taso: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteitem
|
|
msgid "&Delete item"
|
|
msgstr "&Poista kohta"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletemenutemplate
|
|
msgid "&Delete menu template ..."
|
|
msgstr "&Poista valikon malline ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
|
|
msgid "Delete saved menu template"
|
|
msgstr "Poista talletettu valikon malline"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
|
|
msgid "Delete selected menu template"
|
|
msgstr "Poista valittu valikon malline"
|
|
|
|
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
|
|
msgid "Delete this item and its subitems?"
|
|
msgstr "Poista tämä kohta ja sen alikohdat?"
|
|
|
|
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
|
|
msgid "Display preview as &Popup menu"
|
|
msgstr "Esikatselu &Popup-valikkona"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditcaption
|
|
msgid "Edit &Caption"
|
|
msgstr "Muokkaa &otsikkoa"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
|
|
msgid "Editing Caption of %s"
|
|
msgstr "Muokataan otsikkoa %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsdots
|
|
msgid "To resolve conflict edit %s.%s"
|
|
msgstr "Selvittääksesi ristiriidat muokkaa %s.%s"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingsfors
|
|
msgid "Editing %s for %s"
|
|
msgstr "Muokataan %s %s:lle"
|
|
|
|
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
|
|
msgid "Editing %s.%s - no menuitem selected"
|
|
msgstr "Muokataan %s.%s - ei yhtään kohtaa valittuna"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteramenudescription
|
|
msgid "Enter a menu &Description:"
|
|
msgstr "Syötä valikon &Kuvaus:"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
|
|
msgid "Enter a new ShortCut for %s"
|
|
msgstr "Syötä uusi pikanäppäin %s:lle"
|
|
|
|
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
|
|
msgid "Enter a new ShortCutKey2 for %s"
|
|
msgstr "Syötä uusi pikanäppäin2 %s:lle"
|
|
|
|
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
|
|
msgid "Existing saved templates"
|
|
msgstr "Tallennetut mallineet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
|
|
msgid "Further shortcut conflict"
|
|
msgstr "Muita pikanäppäimen ristiriitoja"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
|
|
msgid "Get help to use this editor"
|
|
msgstr "Hae apua tämän editorin käyttöön"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgrabkey
|
|
msgid "&Grab key"
|
|
msgstr "Sieppaa näppäin"
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexd
|
|
msgid "GroupIndex: %d"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
|
|
msgid "Values in use: %s"
|
|
msgstr "Käytetyt arvot: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinadequatedescription
|
|
msgid "Inadequate Description"
|
|
msgstr "Puutteellinen kuvaus"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
|
|
msgid "Insert menu template into root of %s"
|
|
msgstr "Lisää valikkomalline %s:n juureen"
|
|
|
|
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
|
|
msgid "Insert selected menu template"
|
|
msgstr "Lisää valittu valikkomalline"
|
|
|
|
#: lazarusidestrconsts.lismenueditorisnotassigned
|
|
msgid "is not assigned"
|
|
msgstr "ei kytketty"
|
|
|
|
#: lazarusidestrconsts.lismenueditoritemswithicons
|
|
msgid "Items with icon: %s"
|
|
msgstr "Kuvakkeella varustettuja: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
|
|
msgid "List shortcuts and &accelerators for %s ..."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
|
|
msgid "List shortcuts for %s ..."
|
|
msgstr "%s:n pikanäppäinten luettelo ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditormenueditor
|
|
msgid "Menu Editor"
|
|
msgstr "Valikkomuokkain"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemactions
|
|
msgid "Menu Item actions"
|
|
msgstr "Valikon kohdan toiminnot"
|
|
|
|
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
|
|
msgid "Menuitem shortcut conflicts in %s"
|
|
msgstr "Valikon pikanäppäimen ristiriita %s:ssa"
|
|
|
|
#: lazarusidestrconsts.lismenueditormovedown
|
|
msgid "Move Down (or right)"
|
|
msgstr "Siirrä alaspäin (tai oikeallepäin)"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemdown
|
|
msgid "Mo&ve item down"
|
|
msgstr "Siirrä kohtaa alasäin"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemleft
|
|
msgid "&Move item left"
|
|
msgstr "Siirrä kohtaa vasemmalle"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemright
|
|
msgid "Mo&ve item right"
|
|
msgstr "Siirrä kohtaa oikealle"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveitemup
|
|
msgid "&Move item up"
|
|
msgstr "Siirrä kohtaa ylöspäin"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Siirrä valittua kohtaa alas"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
|
|
msgid "Move selected item to the left"
|
|
msgstr "Siirrä valittua kohtaa vasemmalle"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
|
|
msgid "Move selected item to the right"
|
|
msgstr "Siirrä valittua kohtaa oikealle"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Siirrä valittua kohtaa ylös"
|
|
|
|
#: lazarusidestrconsts.lismenueditormoveup
|
|
msgid "Move Up (or left)"
|
|
msgstr "Siirrä ylöspäin (tai vasemmallepäin)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorna
|
|
msgid "n/a"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornomenuselected
|
|
msgid "(no menu selected)"
|
|
msgstr "(ei valittua valikkoa)"
|
|
|
|
#: lazarusidestrconsts.lismenueditornone
|
|
msgid "<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornonenone
|
|
msgid "<none>,<none>"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
|
|
msgid "<no shortcut conflicts>"
|
|
msgstr "<ei ristiriitaisia pikanäppäimiä>"
|
|
|
|
#: lazarusidestrconsts.lismenueditornousersavedtemplates
|
|
msgid "No user-saved templates"
|
|
msgstr "Ei käyttäjän tallettamia mallineita"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpickaniconfroms
|
|
msgid "Pick an icon from %s"
|
|
msgstr "Valitse kuvake %s:sta"
|
|
|
|
#: lazarusidestrconsts.lismenueditorpopupassignmentss
|
|
msgid "Popup assignments: %s"
|
|
msgstr "Popup määrittelyt: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorradioitem
|
|
msgid "RadioItem"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorremainingconflictss
|
|
msgid "Remaining conflicts: %s"
|
|
msgstr "Ristiriitoja jäljellä: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorremoveallseparators
|
|
msgid "&Remove all separators"
|
|
msgstr "Poista kaikki erottimet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolvedconflictss
|
|
msgid "Resolved conflicts: %s"
|
|
msgstr "Ratkaistut ristiriidat: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
|
|
msgid "Resolve selected conflict"
|
|
msgstr "Ratkaise valitut ristiriidat"
|
|
|
|
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
|
|
msgid "&Resolve shortcut conflicts ..."
|
|
msgstr "&Ratkaise pikanäppäinten ristiriidat ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavedtemplates
|
|
msgid "Saved templates"
|
|
msgstr "Tallennetut mallineet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
|
|
msgid "&Save menu as a template ..."
|
|
msgstr "&Tallenna valikko malliksi ..."
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
|
|
msgid "Save menu as template"
|
|
msgstr "Tallenna valikko malliksi"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
|
|
msgid "Save menu as template for future use"
|
|
msgstr "Tallenna valikko mallina uusintakäyttöä varten"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
|
|
msgid "Save menu shown as a new template"
|
|
msgstr "Tallenna valikko uutena mallineena"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsconflictswiths
|
|
msgid "%s conflicts with %s"
|
|
msgstr "%s on ristiriidassa %s:n kanssa"
|
|
|
|
#: lazarusidestrconsts.lismenueditorseparators
|
|
msgid "Se¶tors"
|
|
msgstr "&Erottimet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutitemss
|
|
msgid "Shortcut items: %s"
|
|
msgstr "Valikon pikanäpäimiä: %s"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
|
|
msgid "Shortcut not yet changed"
|
|
msgstr "Pikanäppäintä ei ole vielä vaihdettu"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts
|
|
msgid "Shortcuts"
|
|
msgstr "Pikanäppäimet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcuts2
|
|
msgid "Shortc&uts"
|
|
msgstr "&Pikanäppäimet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
|
|
msgid "Shortcuts and Accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsd
|
|
msgid "Shortcuts (%d)"
|
|
msgstr "Pikanappäimet (%d)"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
|
|
msgid "Shortcuts (%d) and Accelerator keys (%d)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
|
|
msgid "Shortcut,Source Property"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedins
|
|
msgid "Shortcuts used in %s"
|
|
msgstr "%s:n pikanappäinten käyttö"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
|
|
msgid "Shortcuts used in %s (%d)"
|
|
msgstr "%:ssa käytetään %d kpl pikanäppäintä"
|
|
|
|
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
|
|
msgid "ShowMenuEditor: TMenu parameter is nil"
|
|
msgstr "ShowMenuEditor: TMenu parametri on nil"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsins
|
|
msgid "\"%s\" in %s"
|
|
msgstr "\"%s\" %s:ssa"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
|
|
msgid ""
|
|
"\"%s\" is already in use in %s as a shortcut.\n"
|
|
"Try a different shortcut.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
|
|
msgid "Please expand: \"%s\" is not a sufficient Description"
|
|
msgstr "Pidennä: \"%s\" ei riitä kuvaukseksi"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
|
|
msgid "Some widgetsets do not allow separators in the main menubar"
|
|
msgstr "Jotkut widgetsetit eivät salli erottimia päävalikossa"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcuts
|
|
msgid "%s: Shortcuts"
|
|
msgstr "%s: Pikanäppäimet"
|
|
|
|
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
|
|
msgid "%s: Shortcuts and accelerator keys"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorsssonclicks
|
|
msgid "%s.%s.%s - OnClick: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorssubmenu
|
|
msgid "%s submenu"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditorstandardtemplates
|
|
msgid "Standard templates"
|
|
msgstr "Vakiomallineet"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatedescription
|
|
msgid "Template description:"
|
|
msgstr "Mallineen kuvaus:"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplates
|
|
msgid "&Templates"
|
|
msgstr "Mallineet"
|
|
|
|
#: lazarusidestrconsts.lismenueditortemplatesaved
|
|
msgid "Template saved"
|
|
msgstr "Malline on tallennettu"
|
|
|
|
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
|
|
msgid ""
|
|
"There are no user-saved menu templates.\n"
|
|
"\n"
|
|
"Only standard default templates are available.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
|
|
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
|
|
msgid ""
|
|
"You have to change the shortcut from %s\n"
|
|
"to avoid a conflict\n"
|
|
msgstr ""
|
|
"Pikanäppäin pitää muuttaa %s:sta\n"
|
|
"ristiriidan välttämiseksi\n"
|
|
|
|
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
|
|
msgid "You must enter text for the Caption"
|
|
msgstr "Otsikko pitää antaa"
|
|
|
|
#: lazarusidestrconsts.lismenuencloseinifdef
|
|
msgid "Enclose in $IFDEF ..."
|
|
msgstr "Kapseloi $IFDEF:n sisään ..."
|
|
|
|
#: lazarusidestrconsts.lismenuencloseselection
|
|
msgid "Enclose Selection ..."
|
|
msgstr "Kapseloi valinta ..."
|
|
|
|
#: lazarusidestrconsts.lismenuevaluate
|
|
msgid "E&valuate/Modify ..."
|
|
msgstr "&Arvioi/Muuta ..."
|
|
|
|
#: lazarusidestrconsts.lismenuexampleprojects
|
|
msgid "Example Projects ..."
|
|
msgstr "Esimerkkiprojektit ..."
|
|
|
|
#: lazarusidestrconsts.lismenuextractproc
|
|
msgid "Extract Procedure ..."
|
|
msgstr "Erota aliohjelma ..."
|
|
|
|
#: lazarusidestrconsts.lismenufile
|
|
msgid "&File"
|
|
msgstr "&Tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenufind
|
|
msgctxt "lazarusidestrconsts.lismenufind"
|
|
msgid "Find"
|
|
msgstr "Etsi"
|
|
|
|
#: lazarusidestrconsts.lismenufind2
|
|
msgid "&Find ..."
|
|
msgstr "&Etsi ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
|
|
msgid "Find Other End of Code Block"
|
|
msgstr "Etsi koodilohkon toinen pää"
|
|
|
|
#: lazarusidestrconsts.lismenufindcodeblockstart
|
|
msgid "Find Start of Code Block"
|
|
msgstr "Etsi koodilohkon alku"
|
|
|
|
#: lazarusidestrconsts.lismenufinddeclarationatcursor
|
|
msgid "Find Declaration at Cursor"
|
|
msgstr "Etsi määrittely kursorin kohdalta"
|
|
|
|
#: lazarusidestrconsts.lismenufindidentifierrefs
|
|
msgid "Find Identifier References ..."
|
|
msgstr "Etsi viittauksia tunnisteisiin ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindinfiles
|
|
msgid "Find &in Files ..."
|
|
msgstr "Etsi &tiedostoista ..."
|
|
|
|
#: lazarusidestrconsts.lismenufindnext
|
|
msgid "Find &Next"
|
|
msgstr "Etsi &Seuraava"
|
|
|
|
#: lazarusidestrconsts.lismenufindprevious
|
|
msgid "Find &Previous"
|
|
msgstr "Etsi &Edellinen"
|
|
|
|
#: lazarusidestrconsts.lismenufindreferencesofusedunit
|
|
msgid "Find References Of Used Unit"
|
|
msgstr "Etsi viittaukset käytettyyn käännösyksikköön"
|
|
|
|
#: lazarusidestrconsts.lismenugeneraloptions
|
|
msgid "Options ..."
|
|
msgstr "Asetukset ..."
|
|
|
|
#: lazarusidestrconsts.lismenugotoincludedirective
|
|
msgid "Goto Include Directive"
|
|
msgstr "Siirry Include-määrittelyyn"
|
|
|
|
#: lazarusidestrconsts.lismenugotoline
|
|
msgid "Goto Line ..."
|
|
msgstr "Mene riville ..."
|
|
|
|
#: lazarusidestrconsts.lismenuguessmisplacedifdef
|
|
msgid "Guess Misplaced IFDEF/ENDIF"
|
|
msgstr "Arvaa väärin sijoitettu IFDEF/ENDIF"
|
|
|
|
#: lazarusidestrconsts.lismenuguessunclosedblock
|
|
msgid "Guess Unclosed Block"
|
|
msgstr "Arvaa sulkematta jäänyt lohko"
|
|
|
|
#: lazarusidestrconsts.lismenuhelp
|
|
msgid "&Help"
|
|
msgstr "&Ohje"
|
|
|
|
#: lazarusidestrconsts.lismenuideinternals
|
|
msgid "IDE Internals"
|
|
msgstr "Lazaruksen sisukset"
|
|
|
|
#: lazarusidestrconsts.lismenuincrementalfind
|
|
msgid "Incremental Find"
|
|
msgstr "Etsi kirjain kerrallaan"
|
|
|
|
#: lazarusidestrconsts.lismenuindentselection
|
|
msgid "Indent Selection"
|
|
msgstr "Sisennä valinta"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertchangelogentry
|
|
msgid "ChangeLog Entry"
|
|
msgstr "Muutoslogin kohta"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcharacter
|
|
msgid "Insert from Character Map ..."
|
|
msgstr "Lisää merkkitaulukosta ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertcvskeyword
|
|
msgid "Insert CVS Keyword"
|
|
msgstr "Liitä CVS-avainsana"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertdatetime
|
|
msgid "Current Date and Time"
|
|
msgstr "Päivämäärä ja aika"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertfilename
|
|
msgid "Insert Full Filename ..."
|
|
msgstr "Lisää tiedoston koko nimi ..."
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgeneral
|
|
msgid "Insert General"
|
|
msgstr "Liitä kenttiä"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnotice
|
|
msgid "GPL Notice"
|
|
msgstr "GPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
|
|
msgid "GPL Notice (translated)"
|
|
msgstr "GPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnotice
|
|
msgid "LGPL Notice"
|
|
msgstr "LGPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
|
|
msgid "LGPL Notice (translated)"
|
|
msgstr "LGPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnotice
|
|
msgid "MIT Notice"
|
|
msgstr "MIT-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
|
|
msgid "MIT Notice (translated)"
|
|
msgstr "MIT-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
|
|
msgid "Modified LGPL Notice"
|
|
msgstr "Muunnettu LGPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
|
|
msgid "Modified LGPL Notice (translated)"
|
|
msgstr "Muunnettu LGPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.lismenuinsertusername
|
|
msgid "Current Username"
|
|
msgstr "Käyttäjätunnus"
|
|
|
|
#: lazarusidestrconsts.lismenuinspect
|
|
msgctxt "lazarusidestrconsts.lismenuinspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "&Tutki ..."
|
|
|
|
#: lazarusidestrconsts.lismenujumpback
|
|
msgid "Jump Back"
|
|
msgstr "Hyppää takaisin"
|
|
|
|
#: lazarusidestrconsts.lismenujumpforward
|
|
msgid "Jump Forward"
|
|
msgstr "Hyppää eteenpäin"
|
|
|
|
#: lazarusidestrconsts.lismenujumpto
|
|
msgid "Jump to"
|
|
msgstr "Hyppää"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementation
|
|
msgid "Jump to Implementation"
|
|
msgstr "Hyppää toteutukseen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoimplementationuses
|
|
msgid "Jump to Implementation uses"
|
|
msgstr "Hyppää toteutuksen uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoinitialization
|
|
msgid "Jump to Initialization"
|
|
msgstr "Hyppää Initialization-osioon"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerface
|
|
msgid "Jump to Interface"
|
|
msgstr "Hyppää rajapintaan"
|
|
|
|
#: lazarusidestrconsts.lismenujumptointerfaceuses
|
|
msgid "Jump to Interface uses"
|
|
msgstr "Hyppää rajapinnan uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonextbookmark
|
|
msgid "Jump to Next Bookmark"
|
|
msgstr "Hyppää seuraavaan kirjanmerkkiin"
|
|
|
|
#: lazarusidestrconsts.lismenujumptonexterror
|
|
msgid "Jump to Next Error"
|
|
msgstr "Hyppää seuraavaan virheeseen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprevbookmark
|
|
msgid "Jump to Previous Bookmark"
|
|
msgstr "Hyppää edelliseen kirjanmerkkiin"
|
|
|
|
#: lazarusidestrconsts.lismenujumptopreverror
|
|
msgid "Jump to Previous Error"
|
|
msgstr "Hyppää edelliseen virheeseen"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedurebegin
|
|
msgid "Jump to Procedure begin"
|
|
msgstr "Hyppää aliohjelman begin-sanaan"
|
|
|
|
#: lazarusidestrconsts.lismenujumptoprocedureheader
|
|
msgid "Jump to Procedure header"
|
|
msgstr "Hyppää aliohjelman otsikkoon"
|
|
|
|
#: lazarusidestrconsts.lismenulowercaseselection
|
|
msgid "Lowercase Selection"
|
|
msgstr "Valinta pieniksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lismenumacrolistview
|
|
msgid "Editor Macros ..."
|
|
msgstr "Editorin makrot ..."
|
|
|
|
#: lazarusidestrconsts.lismenumakeresourcestring
|
|
msgid "Make Resource String ..."
|
|
msgstr "Tee resurssiteksti ..."
|
|
|
|
#: lazarusidestrconsts.lismenumultipaste
|
|
msgctxt "lazarusidestrconsts.lismenumultipaste"
|
|
msgid "MultiPaste ..."
|
|
msgstr "MoniLiitos ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewcomponent
|
|
msgctxt "lazarusidestrconsts.lismenunewcomponent"
|
|
msgid "New Component"
|
|
msgstr "Uusi komponentti"
|
|
|
|
#: lazarusidestrconsts.lismenunewcustom
|
|
msgid "New %s"
|
|
msgstr "Uusi %s"
|
|
|
|
#: lazarusidestrconsts.lismenunewform
|
|
msgid "New Form"
|
|
msgstr "Uusi Lomake"
|
|
|
|
#: lazarusidestrconsts.lismenunewother
|
|
msgid "New ..."
|
|
msgstr "Uusi ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewpackage
|
|
msgid "New Package ..."
|
|
msgstr "Uusi paketti ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewproject
|
|
msgid "New Project ..."
|
|
msgstr "Uusi projekti ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewprojectfromfile
|
|
msgid "New Project from File ..."
|
|
msgstr "Luo uusi projekti tiedostosta ..."
|
|
|
|
#: lazarusidestrconsts.lismenunewunit
|
|
msgctxt "lazarusidestrconsts.lismenunewunit"
|
|
msgid "New Unit"
|
|
msgstr "Uusi käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lismenuok
|
|
msgctxt "lazarusidestrconsts.lismenuok"
|
|
msgid "&OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuonlinehelp
|
|
msgid "Online Help"
|
|
msgstr "Mukana oleva avustus"
|
|
|
|
#: lazarusidestrconsts.lismenuopen
|
|
msgid "&Open ..."
|
|
msgstr "&Avaa ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenfilenameatcursor
|
|
msgid "Open Filename at Cursor"
|
|
msgstr "Avaa kursorin osoittama tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackage
|
|
msgid "Open Loaded Package ..."
|
|
msgstr "Avaa jo ladattu paketti ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackagefile
|
|
msgid "Open Package File (.lpk) ..."
|
|
msgstr "Avaa pakettitiedosto (.lpk) ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenpackageofcurunit
|
|
msgid "Open Package of Current Unit"
|
|
msgstr "Avaa aktiivisen käännösyksikön paketti"
|
|
|
|
#: lazarusidestrconsts.lismenuopenproject
|
|
msgid "Open Project ..."
|
|
msgstr "Avaa projekti ..."
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecent
|
|
msgid "Open &Recent"
|
|
msgstr "Avaa &esillä ollut"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentpkg
|
|
msgid "Open Recent Package"
|
|
msgstr "Avaa esillä ollut paketti"
|
|
|
|
#: lazarusidestrconsts.lismenuopenrecentproject
|
|
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
|
|
msgid "Open Recent Project"
|
|
msgstr "Avaa esillä ollut projekti"
|
|
|
|
#: lazarusidestrconsts.lismenuopenunit
|
|
msgid "Open Unit ..."
|
|
msgstr "Avaa käännösyksikkö ..."
|
|
|
|
#: lazarusidestrconsts.lismenupackage
|
|
msgid "Pa&ckage"
|
|
msgstr "Pa&ketti"
|
|
|
|
#: lazarusidestrconsts.lismenupackagegraph
|
|
msgid "Package Graph"
|
|
msgstr "Pakettikuvaaja"
|
|
|
|
#: lazarusidestrconsts.lismenupackagelinks
|
|
msgid "Package Links ..."
|
|
msgstr "Pakettilinkit ..."
|
|
|
|
#: lazarusidestrconsts.lismenupastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
|
|
msgid "Paste from clipboard"
|
|
msgstr "Liitä leikepöydältä"
|
|
|
|
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
|
|
msgid "New package component"
|
|
msgstr "Uusi paketin komponentti"
|
|
|
|
#: lazarusidestrconsts.lismenuprocedurelist
|
|
msgid "Procedure List ..."
|
|
msgstr "Aliohjelmien luettelo ..."
|
|
|
|
#: lazarusidestrconsts.lismenuproject
|
|
msgid "&Project"
|
|
msgstr "&Projekti"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectinspector
|
|
msgid "Project Inspector"
|
|
msgstr "Projektinhallinta"
|
|
|
|
#: lazarusidestrconsts.lismenuprojectoptions
|
|
msgid "Project Options ..."
|
|
msgstr "Projektikohtaiset asetukset ..."
|
|
|
|
#: lazarusidestrconsts.lismenuprojectrun
|
|
msgctxt "lazarusidestrconsts.lismenuprojectrun"
|
|
msgid "&Run"
|
|
msgstr "&Suorita"
|
|
|
|
#: lazarusidestrconsts.lismenupublishproject
|
|
msgid "Publish Project ..."
|
|
msgstr "Julkaise projekti ..."
|
|
|
|
#: lazarusidestrconsts.lismenuquickcompile
|
|
msgid "Quick Compile"
|
|
msgstr "Nopea käännös"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheck
|
|
msgid "Quick Syntax Check"
|
|
msgstr "Nopea kieliopin tarkistus"
|
|
|
|
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
|
|
msgid "Quick syntax check OK"
|
|
msgstr "Nopea kieliopin tarkistus OK"
|
|
|
|
#: lazarusidestrconsts.lismenuremovefromproject
|
|
msgid "Remove from Project ..."
|
|
msgstr "Poista projektista ..."
|
|
|
|
#: lazarusidestrconsts.lismenurenameidentifier
|
|
msgid "Rename Identifier ..."
|
|
msgstr "Vaihda tunnisteen nimeä ..."
|
|
|
|
#: lazarusidestrconsts.lismenureportingbug
|
|
msgid "Reporting a Bug"
|
|
msgstr "Virheen raportointi"
|
|
|
|
#: lazarusidestrconsts.lismenuresaveformswithi18n
|
|
msgid "Resave forms with enabled i18n"
|
|
msgstr "Tallenna lomakkeet uudestaan i18n sallittuna"
|
|
|
|
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
|
|
msgid "Rescan FPC Source Directory"
|
|
msgstr "Lue uudelleen FPC-lähdekoodit"
|
|
|
|
#: lazarusidestrconsts.lismenuresetdebugger
|
|
msgid "Reset Debugger"
|
|
msgstr "Nollaa virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.lismenurevert
|
|
msgid "Revert"
|
|
msgstr "Palauta"
|
|
|
|
#: lazarusidestrconsts.lismenurun
|
|
msgctxt "lazarusidestrconsts.lismenurun"
|
|
msgid "&Run"
|
|
msgstr "&Suorita"
|
|
|
|
#: lazarusidestrconsts.lismenurunfile
|
|
msgid "Run File"
|
|
msgstr "Suorita tiedosto"
|
|
|
|
#: lazarusidestrconsts.lismenurunparameters
|
|
msgid "Run &Parameters ..."
|
|
msgstr "Suoritus¶metrit ..."
|
|
|
|
#: lazarusidestrconsts.lismenuruntocursor
|
|
msgid "Step over to &Cursor"
|
|
msgstr "Jatka &kursorin kohtaan"
|
|
|
|
#: lazarusidestrconsts.lismenurunwithoutdebugging
|
|
msgid "Run without Debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenusave
|
|
msgid "&Save"
|
|
msgstr "&Tallenna"
|
|
|
|
#: lazarusidestrconsts.lismenusaveas
|
|
msgid "Save &As ..."
|
|
msgstr "Tallenna &nimellä ..."
|
|
|
|
#: lazarusidestrconsts.lismenusaveproject
|
|
msgid "Save Project"
|
|
msgstr "Tallenna projekti"
|
|
|
|
#: lazarusidestrconsts.lismenusaveprojectas
|
|
msgid "Save Project As ..."
|
|
msgstr "Tallenna projekti nimellä ..."
|
|
|
|
#: lazarusidestrconsts.lismenusearch
|
|
msgid "&Search"
|
|
msgstr "&Etsi"
|
|
|
|
#: lazarusidestrconsts.lismenuselect
|
|
msgid "Select"
|
|
msgstr "Valitse"
|
|
|
|
#: lazarusidestrconsts.lismenuselectall
|
|
msgctxt "lazarusidestrconsts.lismenuselectall"
|
|
msgid "Select All"
|
|
msgstr "Valitse kaikki"
|
|
|
|
#: lazarusidestrconsts.lismenuselectcodeblock
|
|
msgid "Select Code Block"
|
|
msgstr "Valitse koodilohko"
|
|
|
|
#: lazarusidestrconsts.lismenuselectline
|
|
msgid "Select Line"
|
|
msgstr "Valitse rivi"
|
|
|
|
#: lazarusidestrconsts.lismenuselectparagraph
|
|
msgid "Select Paragraph"
|
|
msgstr "Valitse kappale"
|
|
|
|
#: lazarusidestrconsts.lismenuselecttobrace
|
|
msgid "Select to Brace"
|
|
msgstr "Valitse sulkuun asti"
|
|
|
|
#: lazarusidestrconsts.lismenuselectword
|
|
msgid "Select Word"
|
|
msgstr "Valitse sana"
|
|
|
|
#: lazarusidestrconsts.lismenusetfreebookmark
|
|
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Aseta vapaa kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.lismenushowexecutionpoint
|
|
msgid "S&how Execution Point"
|
|
msgstr "Näytä &suorituspiste"
|
|
|
|
#: lazarusidestrconsts.lismenushowsmarthint
|
|
msgid "Context sensitive smart hint"
|
|
msgstr "Tilanteesta riippuva älykäs vihje"
|
|
|
|
#: lazarusidestrconsts.lismenusortselection
|
|
msgid "Sort Selection ..."
|
|
msgstr "Järjestä valinta ..."
|
|
|
|
#: lazarusidestrconsts.lismenusource
|
|
msgid "S&ource"
|
|
msgstr "&Lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.lismenustepinto
|
|
msgid "Step In&to"
|
|
msgstr "Askella &sisään"
|
|
|
|
#: lazarusidestrconsts.lismenustepintocontext
|
|
msgid "Step Into (Context)"
|
|
msgstr "Askella sisään (konteksti)"
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
|
|
msgid "Step Into Instruction"
|
|
msgstr "Askella sisään käskyyn"
|
|
|
|
#: lazarusidestrconsts.lismenustepintoinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
|
|
msgid "Step Into Instruction"
|
|
msgstr "Askella sisään käskyyn"
|
|
|
|
#: lazarusidestrconsts.lismenustepout
|
|
msgid "Step O&ut"
|
|
msgstr "Askella &ulos"
|
|
|
|
#: lazarusidestrconsts.lismenustepover
|
|
msgid "&Step Over"
|
|
msgstr "Askella yli"
|
|
|
|
#: lazarusidestrconsts.lismenustepovercontext
|
|
msgid "Step Over (Context)"
|
|
msgstr "Askella yli (konteksti)"
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstr
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
|
|
msgid "Step Over Instruction"
|
|
msgstr "Askella yli käskystä"
|
|
|
|
#: lazarusidestrconsts.lismenustepoverinstrhint
|
|
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
|
|
msgid "Step Over Instruction"
|
|
msgstr "Askella yli käskystä"
|
|
|
|
#: lazarusidestrconsts.lismenuswapcaseselection
|
|
msgid "Swap Case in Selection"
|
|
msgstr "Käännä kirjaimen koko valinnassa"
|
|
|
|
#: lazarusidestrconsts.lismenutabstospacesselection
|
|
msgid "Tabs to Spaces in Selection"
|
|
msgstr "Muuta tabit välilyönneiksi valinnassa"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateabout
|
|
msgctxt "lazarusidestrconsts.lismenutemplateabout"
|
|
msgid "About"
|
|
msgstr "Tietoja"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatecontents
|
|
msgid "Contents"
|
|
msgstr "Sisältö"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
|
|
msgid "Standard Edit Menu"
|
|
msgstr "Standardi Muokkaa-valikko"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
|
|
msgid "Standard File Menu"
|
|
msgstr "Standardi Tiedosto-valikko"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
|
|
msgid "Standard Help Menu"
|
|
msgstr "Standardi Ohje-valikko"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefind
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefind"
|
|
msgid "Find"
|
|
msgstr "Etsi"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatefindnext
|
|
msgctxt "lazarusidestrconsts.lismenutemplatefindnext"
|
|
msgid "Find Next"
|
|
msgstr "Etsi seuraava"
|
|
|
|
#: lazarusidestrconsts.lismenutemplateopenrecent
|
|
msgid "Open Recent"
|
|
msgstr "Avaa viimeksi esillä olleista"
|
|
|
|
#: lazarusidestrconsts.lismenutemplatetutorial
|
|
msgid "Tutorial"
|
|
msgstr "Käyttöopastus"
|
|
|
|
#: lazarusidestrconsts.lismenutogglecomment
|
|
msgid "Toggle Comment in Selection"
|
|
msgstr "Valinnan kommentti päälle/pois"
|
|
|
|
#: lazarusidestrconsts.lismenutools
|
|
msgid "&Tools"
|
|
msgstr "&Työkalut"
|
|
|
|
#: lazarusidestrconsts.lismenuuncommentselection
|
|
msgid "Uncomment Selection"
|
|
msgstr "Poista valinnan kommentti"
|
|
|
|
#: lazarusidestrconsts.lismenuunindentselection
|
|
msgid "Unindent Selection"
|
|
msgstr "Poista valinnan sisennys"
|
|
|
|
#: lazarusidestrconsts.lismenuuppercaseselection
|
|
msgid "Uppercase Selection"
|
|
msgstr "Valinta isoiksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lismenuuseunit
|
|
msgid "Add Unit to Uses Section ..."
|
|
msgstr "Lisää käännösyksikkö uses-lauseeseen ..."
|
|
|
|
#: lazarusidestrconsts.lismenuview
|
|
msgid "&View"
|
|
msgstr "&Näytä"
|
|
|
|
#: lazarusidestrconsts.lismenuviewanchoreditor
|
|
msgid "Anchor Editor"
|
|
msgstr "Ankkurointi"
|
|
|
|
#: lazarusidestrconsts.lismenuviewassembler
|
|
msgctxt "lazarusidestrconsts.lismenuviewassembler"
|
|
msgid "Assembler"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismenuviewbreakpoints
|
|
msgid "BreakPoints"
|
|
msgstr "Keskeytyskohdat"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcallstack
|
|
msgid "Call Stack"
|
|
msgstr "Kutsupino"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodebrowser
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
|
|
msgid "Code Browser"
|
|
msgstr "Koodin selain"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcodeexplorer
|
|
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
|
|
msgid "Code Explorer"
|
|
msgstr "Koodin tutkija"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponentpalette
|
|
msgid "Component Palette"
|
|
msgstr "Komponenttipaletti"
|
|
|
|
#: lazarusidestrconsts.lismenuviewcomponents
|
|
msgid "&Components"
|
|
msgstr "&Komponentit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugevents
|
|
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
|
|
msgid "Event Log"
|
|
msgstr "Tapahtumaloki"
|
|
|
|
#: lazarusidestrconsts.lismenuviewdebugoutput
|
|
msgid "Debug Output"
|
|
msgstr "Virheenjäljittimen tuloste"
|
|
|
|
#: lazarusidestrconsts.lismenuviewforms
|
|
msgid "Forms ..."
|
|
msgstr "Lomakkeet ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewhistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewhistory"
|
|
msgid "History"
|
|
msgstr "Historia"
|
|
|
|
#: lazarusidestrconsts.lismenuviewjumphistory
|
|
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
|
|
msgid "Jump History"
|
|
msgstr "Hyppyhistoria"
|
|
|
|
#: lazarusidestrconsts.lismenuviewlocalvariables
|
|
msgid "Local Variables"
|
|
msgstr "Paikalliset muuttujat"
|
|
|
|
#: lazarusidestrconsts.lismenuviewmessages
|
|
msgctxt "lazarusidestrconsts.lismenuviewmessages"
|
|
msgid "Messages"
|
|
msgstr "Kääntäjän viestit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewobjectinspector
|
|
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
|
|
msgid "Object Inspector"
|
|
msgstr "Komponenttimuokkain"
|
|
|
|
#: lazarusidestrconsts.lismenuviewprojectsource
|
|
msgid "&View Project Source"
|
|
msgstr "&Näytä projektin lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.lismenuviewpseudoterminal
|
|
msgid "Terminal Output"
|
|
msgstr "Komentorivin tuloste"
|
|
|
|
#: lazarusidestrconsts.lismenuviewregisters
|
|
msgctxt "lazarusidestrconsts.lismenuviewregisters"
|
|
msgid "Registers"
|
|
msgstr "Rekisterit"
|
|
|
|
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
|
|
msgid "Restriction Browser"
|
|
msgstr "Rajoituksien selain"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsearchresults
|
|
msgid "Search Results"
|
|
msgstr "Hakutulokset"
|
|
|
|
#: lazarusidestrconsts.lismenuviewsourceeditor
|
|
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
|
|
msgid "Source Editor"
|
|
msgstr "Lähdekoodieditori"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtaborder
|
|
msgid "Tab Order"
|
|
msgstr "Tabulointijärjestys"
|
|
|
|
#: lazarusidestrconsts.lismenuviewthreads
|
|
msgctxt "lazarusidestrconsts.lismenuviewthreads"
|
|
msgid "Threads"
|
|
msgstr "Säikeet"
|
|
|
|
#: lazarusidestrconsts.lismenuviewtoggleformunit
|
|
msgid "Toggle Form/Unit View"
|
|
msgstr "Siirry lomakkeen ja käännösyksikön välillä"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitdependencies
|
|
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
|
|
msgid "Unit Dependencies"
|
|
msgstr "Käännösyksikön riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.lismenuviewunitinfo
|
|
msgid "Unit Information ..."
|
|
msgstr "Käännösyksikön tietoja ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewunits
|
|
msgid "Units ..."
|
|
msgstr "Käännösyksiköt ..."
|
|
|
|
#: lazarusidestrconsts.lismenuviewwatches
|
|
msgid "Watches"
|
|
msgstr "Vahdit"
|
|
|
|
#: lazarusidestrconsts.lismenuwhatneedsbuilding
|
|
msgid "What Needs Building"
|
|
msgstr "Mitä tarvitsee koota"
|
|
|
|
#: lazarusidestrconsts.lismenuwindow
|
|
msgid "&Window"
|
|
msgstr "&Ikkunat"
|
|
|
|
#: lazarusidestrconsts.lismeother
|
|
msgctxt "lazarusidestrconsts.lismeother"
|
|
msgid "Other tabs"
|
|
msgstr "Muut välilehdet"
|
|
|
|
#: lazarusidestrconsts.lismeprojects
|
|
msgid "Projects"
|
|
msgstr "Projektit"
|
|
|
|
#: lazarusidestrconsts.lismessageseditor
|
|
msgid "Messages Editor"
|
|
msgstr "Viestien editori"
|
|
|
|
#: lazarusidestrconsts.lismessageswindow
|
|
msgid "Messages Window"
|
|
msgstr "Viesti-ikkuna"
|
|
|
|
#: lazarusidestrconsts.lismethodclassnotfound
|
|
msgid "Method class not found"
|
|
msgstr "Metodin luokkaa ei löydy"
|
|
|
|
#: lazarusidestrconsts.lismissingdirectory
|
|
msgid "missing directory \"%s\""
|
|
msgstr "puuttuva hakemisto \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingevents
|
|
msgid "Missing Events"
|
|
msgstr "Puuttuvia tapahtumia"
|
|
|
|
#: lazarusidestrconsts.lismissingexecutable
|
|
msgid "missing executable \"%s\""
|
|
msgstr "puuttuva ohjelma \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismissingidentifiers
|
|
msgid "Missing identifiers"
|
|
msgstr "Puuttuvia tunnisteita"
|
|
|
|
#: lazarusidestrconsts.lismissingpackages
|
|
msgid "Missing Packages"
|
|
msgstr "Paketteja puuttuu"
|
|
|
|
#: lazarusidestrconsts.lismissingunitschoices
|
|
msgid "Your choices are:"
|
|
msgstr "Vaihtoehdot ovat:"
|
|
|
|
#: lazarusidestrconsts.lismissingunitscomment
|
|
msgid "Comment Out"
|
|
msgstr "Kommentoi pois"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsfordelphi
|
|
msgid "For Delphi only"
|
|
msgstr "Vain Delphille"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1
|
|
msgid "1) Comment out the selected units."
|
|
msgstr "1) Kommentoi pois valitut käännösyksiköt."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo1b
|
|
msgid "1) Use the units only for Delphi."
|
|
msgstr "1) Käytä käännösyksikköjä vain Delphille."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo2
|
|
msgid "2) Search for units. Found paths are added to project settings."
|
|
msgstr "2) Etsi käännösyksiköitä. Löydetyt polut lisätään projektin asetuksiin."
|
|
|
|
#: lazarusidestrconsts.lismissingunitsinfo3
|
|
msgid "3) Abort now, install packages or fix paths and try again."
|
|
msgstr "3) Keskeytä nyt, asenna paketteja tai korjaa polut ja yritä uudelleen."
|
|
|
|
#: lazarusidestrconsts.lismissingunitssearch
|
|
msgid "Search Unit Path"
|
|
msgstr "Etsi käännösyksikön polku"
|
|
|
|
#: lazarusidestrconsts.lismissingunitsskip
|
|
msgid "Skip this Unit"
|
|
msgstr "Jätä tämä käännösyksikkö väliin"
|
|
|
|
#: lazarusidestrconsts.lismitnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (c) <year> <copyright holders>\n"
|
|
"\n"
|
|
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
|
|
"\n"
|
|
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
|
|
"\n"
|
|
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismmadditionsandoverrides
|
|
msgid "Additions and Overrides"
|
|
msgstr "Lisämääritykset"
|
|
|
|
#: lazarusidestrconsts.lismmaddscustomoptions
|
|
msgid "Adds custom options:"
|
|
msgstr "Lisää mukautetut asetukset:"
|
|
|
|
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
|
|
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
|
|
msgstr "Lisää joku fpc asetus, esim. -O1 -ghtl -dFlag"
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackages
|
|
msgid "Apply to all packages."
|
|
msgstr "Käytä kaikkiin paketteihin."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
|
|
msgid "Apply to all packages and projects."
|
|
msgstr "Käytä kaikkiin paketteihin ja projekteihin."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
|
|
msgid "Apply to all packages matching name \"%s\""
|
|
msgstr "Käytä kaikkiin \"%s\" nimisiin paketteihin."
|
|
|
|
#: lazarusidestrconsts.lismmapplytoproject
|
|
msgid "Apply to project."
|
|
msgstr "Käytä projektiin."
|
|
|
|
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
|
|
msgid "Create a new group of options"
|
|
msgstr "Luo uusi asetusryhmä."
|
|
|
|
#: lazarusidestrconsts.lismmcustomoption
|
|
msgid "Custom Option"
|
|
msgstr "Mukautetut asetukset"
|
|
|
|
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
|
|
msgid "Delete the selected target or option"
|
|
msgstr "Poista valittu kohde tai asetus"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
|
|
msgid "Does not add custom options:"
|
|
msgstr "Ei lisää mukautettuja asetuksia:"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnothaveidemacro
|
|
msgid "Does not have IDE Macro %s:=%s"
|
|
msgstr "Ei ole IDE Makroa %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
|
|
msgid "Does not override OutDir (-FU)"
|
|
msgstr "Ei syrjäytä OutDir:a (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
|
|
msgid "Exclude all packages matching name \"%s\""
|
|
msgstr "Jätä pois kaikki \"%s\" nimiset paketit"
|
|
|
|
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
|
|
msgid "expected \":=\" after macro name, but found \"%s\""
|
|
msgstr "odotettiin \":=\" makron nimen jälkeen, mutta löydettiin \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
|
|
msgid "expected macro name, but found \"%s\""
|
|
msgstr "odotettiin makron nimeä, mutta löydettiin \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmfromto
|
|
msgid "From %s to %s"
|
|
msgstr "%s:sta to %s:een"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro
|
|
msgid "IDE Macro"
|
|
msgstr "IDE-makro"
|
|
|
|
#: lazarusidestrconsts.lismmidemacro2
|
|
msgid "IDE Macro %s:=%s"
|
|
msgstr "IDE-makro %s:=%s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterat
|
|
msgid "invalid character \"%s\" at %s"
|
|
msgstr "kelvoton merkki \"%s\" at %s"
|
|
|
|
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
|
|
msgid "invalid character in macro value \"%s\""
|
|
msgstr "kelvoton merkki makron arvossa \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmmissingmacroname
|
|
msgid "missing macro name"
|
|
msgstr "puuttuva makron nimi"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemdown
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
|
|
msgid "Move selected item down"
|
|
msgstr "Siirrä valittua kohtaa alas"
|
|
|
|
#: lazarusidestrconsts.lismmmoveselecteditemup
|
|
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
|
|
msgid "Move selected item up"
|
|
msgstr "Siirrä valittua kohtaa ylös"
|
|
|
|
#: lazarusidestrconsts.lismmnewtarget
|
|
msgid "New Target"
|
|
msgstr "Uusi kohde"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutdirfu
|
|
msgid "Override OutDir (-FU): %s"
|
|
msgstr "Syrjäytä OutDir (-FU): %s"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectory
|
|
msgid "Override output directory (-FU)"
|
|
msgstr "Syrjäytä käännöshakemisto (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
|
|
msgid "Override output directory -FU of target"
|
|
msgstr "Syrjäytä kohteen käännöshakemisto (-FU)"
|
|
|
|
#: lazarusidestrconsts.lismmredolastundotothisgrid
|
|
msgid "Redo last undo to this grid"
|
|
msgstr "Tee uudestaan viimeinen Kumoa tässä taulukossa"
|
|
|
|
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
|
|
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
|
|
msgstr "Aseta IDE makro, esim.: LCLWidgetType:=win32"
|
|
|
|
#: lazarusidestrconsts.lismmsets
|
|
msgid "Set \"%s\""
|
|
msgstr "Aseta \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
|
|
msgid "Stored in IDE (environmentoptions.xml)"
|
|
msgstr "Tallentuu ympäristöön (environmentoptions.xml)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinprojectlpi
|
|
msgid "Stored in project (.lpi)"
|
|
msgstr "Tallentuu projektiin (.lpi)"
|
|
|
|
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
|
|
msgid "Stored in session of project (.lps)"
|
|
msgstr "Tallentuu projektin istuntoon (.lps)"
|
|
|
|
#: lazarusidestrconsts.lismmtargets
|
|
msgid "Targets: "
|
|
msgstr "Kohteet: "
|
|
|
|
#: lazarusidestrconsts.lismmundolastchangetothisgrid
|
|
msgid "Undo last change to this grid"
|
|
msgstr "Kumoa viimeinen muutos tässä taulukossa"
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencoding
|
|
msgid "Use system encoding"
|
|
msgstr "Käytä järjestelmän merkkikoodausta"
|
|
|
|
#: lazarusidestrconsts.lismmusesystemencodinghint
|
|
msgid "Disable support for UTF-8 default string encoding."
|
|
msgstr "Poista UTF-8 oletusmerkkikoodauksen tuki."
|
|
|
|
#: lazarusidestrconsts.lismmvalues
|
|
msgid "Value \"%s\""
|
|
msgstr "Arvo \"%s\""
|
|
|
|
#: lazarusidestrconsts.lismmwas
|
|
msgid "(was \"%s\")"
|
|
msgstr "(oli \"%s\")"
|
|
|
|
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
|
|
msgid "WidgetSet change is available only for LCL projects"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismode
|
|
msgid ", Mode: %s"
|
|
msgstr ", Moodi: %s"
|
|
|
|
#: lazarusidestrconsts.lismodifiedlgplnotice
|
|
msgid ""
|
|
"<description>\n"
|
|
"\n"
|
|
"Copyright (C) <year> <name of author> <contact>\n"
|
|
"\n"
|
|
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
|
|
"\n"
|
|
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
|
|
"\n"
|
|
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
|
|
"\n"
|
|
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismodify
|
|
msgid "&Modify"
|
|
msgstr "&Muuta"
|
|
|
|
#: lazarusidestrconsts.lismore
|
|
msgctxt "lazarusidestrconsts.lismore"
|
|
msgid "More"
|
|
msgstr "Lisää"
|
|
|
|
#: lazarusidestrconsts.lismoresub
|
|
msgctxt "lazarusidestrconsts.lismoresub"
|
|
msgid "More"
|
|
msgstr "Lisää"
|
|
|
|
#: lazarusidestrconsts.lismove
|
|
msgid "Move"
|
|
msgstr "Siirrä"
|
|
|
|
#: lazarusidestrconsts.lismovefiles
|
|
msgid "Move Files"
|
|
msgstr "Siirrä tiedostot"
|
|
|
|
#: lazarusidestrconsts.lismovefiles2
|
|
msgid "Move files?"
|
|
msgstr "Siirrä tiedostot?"
|
|
|
|
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
|
|
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "Siirrä %s tiedosto(a) %s:sta hakemistoon%s%s%s %s:ssa?"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositiondown
|
|
msgid "Move \"%s\" one position down"
|
|
msgstr "Siirrä \"%s\" yksi pykälä alaspäin"
|
|
|
|
#: lazarusidestrconsts.lismoveonepositionup
|
|
msgid "Move \"%s\" one position up"
|
|
msgstr "Siirrä \"%s\" yksi pykälä ylöspäin"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfiles
|
|
msgid "Move or Copy files?"
|
|
msgstr "Siirrä tai kopioi tiedostot?"
|
|
|
|
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
|
|
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
|
|
msgstr "Siirrä tai kopioi %s tiedosto(a) %s:sta hakemistoon%s%s%s %s:ssa?"
|
|
|
|
#: lazarusidestrconsts.lismovepage
|
|
msgid "Move Page"
|
|
msgstr "Siirrä välilehti"
|
|
|
|
#: lazarusidestrconsts.lismoveselecteddown
|
|
msgid "Move selected item down (Ctrl+Down)"
|
|
msgstr "Siirrä valittu kohta alas (Ctrl+Up)"
|
|
|
|
#: lazarusidestrconsts.lismoveselectedup
|
|
msgid "Move selected item up (Ctrl+Up)"
|
|
msgstr "Siirrä valittu kohta ylös (Ctrl+Up)"
|
|
|
|
#: lazarusidestrconsts.lismoveto
|
|
msgid "Move to: "
|
|
msgstr "Siirrä:"
|
|
|
|
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
|
|
msgid "Moving these units will break their uses sections. See Messages window for details."
|
|
msgstr "Näiden käännösyksikköjen siirtäminen rikkoo niiden uses-lauseen. Katso yksityiskohdat viesti-ikkunasta."
|
|
|
|
#: lazarusidestrconsts.lismpcstyle
|
|
msgid "C style: \" => \\\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpescapequotes
|
|
msgid "Escape "es"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismpmultipaste
|
|
msgctxt "lazarusidestrconsts.lismpmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "MoniLiitos"
|
|
|
|
#: lazarusidestrconsts.lismppascalstyle
|
|
msgid "Pascal style: ' => ''"
|
|
msgstr "Pascal tyyli: ' => ''"
|
|
|
|
#: lazarusidestrconsts.lismppasteoptions
|
|
msgid "Paste &options"
|
|
msgstr "Liitos-&asetukset"
|
|
|
|
#: lazarusidestrconsts.lismppreview
|
|
msgid "&Preview"
|
|
msgstr "&Esikatselu"
|
|
|
|
#: lazarusidestrconsts.lismptextaftereachline
|
|
msgid "Text &after each line"
|
|
msgstr "Teksti jokaisen rivin &jälkeen"
|
|
|
|
#: lazarusidestrconsts.lismptextbeforeeachline
|
|
msgid "Text &before each line"
|
|
msgstr "Teksti &ennen jokaista riviä"
|
|
|
|
#: lazarusidestrconsts.lismptrimclipboardcontents
|
|
msgid "&Trim clipboard contents"
|
|
msgstr "&Siisti leikepöydän sisältö"
|
|
|
|
#: lazarusidestrconsts.lisms
|
|
msgid "(ms)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lismsgcolors
|
|
msgid "Message colors"
|
|
msgstr "Viestin värit"
|
|
|
|
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
|
|
msgid "Multiple directories are separated with semicolons"
|
|
msgstr "Hakemistot erotetaan puolipisteellä"
|
|
|
|
#: lazarusidestrconsts.lismultiplepack
|
|
msgid ", multiple packages: "
|
|
msgstr ", monta pakettia: "
|
|
|
|
#: lazarusidestrconsts.lismvsavemessagestofiletxt
|
|
msgid "Save messages to file (*.txt)"
|
|
msgstr "Tallenna viestit tiedostoon (*.txt)"
|
|
|
|
#: lazarusidestrconsts.lisname
|
|
msgctxt "lazarusidestrconsts.lisname"
|
|
msgid "Name"
|
|
msgstr "Nimi"
|
|
|
|
#: lazarusidestrconsts.lisnameconflict
|
|
msgid "Name conflict"
|
|
msgstr "Ristiriita nimessä"
|
|
|
|
#: lazarusidestrconsts.lisnameofactivebuildmode
|
|
msgid "Name of active build mode"
|
|
msgstr "Aktiivisen koontamoodin nimi"
|
|
|
|
#: lazarusidestrconsts.lisnameofnewprocedure
|
|
msgid "Name of new procedure"
|
|
msgstr "Uuden aliohjelman nimi"
|
|
|
|
#: lazarusidestrconsts.lisnever
|
|
msgctxt "lazarusidestrconsts.lisnever"
|
|
msgid "Never"
|
|
msgstr "Ei koskaan"
|
|
|
|
#: lazarusidestrconsts.lisnew
|
|
msgctxt "lazarusidestrconsts.lisnew"
|
|
msgid "New"
|
|
msgstr "Uusi"
|
|
|
|
#: lazarusidestrconsts.lisnewclass
|
|
msgid "New Class"
|
|
msgstr "Uusi luokka"
|
|
|
|
#: lazarusidestrconsts.lisnewconsoleapplication
|
|
msgid "New console application"
|
|
msgstr "Uusi komentorivisovellus"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
|
|
msgid "Create a new editor file.%sChoose a type."
|
|
msgstr "Luo uusi lähdetiedosto.%sValitse tyyppi."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
|
|
msgid "Create a new empty text file."
|
|
msgstr "Luo uusi tyhjä tekstitiedosto."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
|
|
msgid "Create a new project.%sChoose a type."
|
|
msgstr "Luo uusi projekti.%sValitse tyyppi."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
|
|
msgid "Create a new standard package.%sA package is a collection of units and components."
|
|
msgstr "Tee uusi standardi paketti.%sPaketti on kokoelma käännösyksiköitä ja komponentteja. Soveltuu pitkälle ehtineille käyttäjille."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
|
|
msgid "Create a new unit with a datamodule."
|
|
msgstr "Luo uusi käännösyksikkö datamodulen kanssa."
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
|
|
msgid "Create a new unit with a frame."
|
|
msgstr "Luo uusi käännösyksikkö kehyksen kanssa"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
|
|
msgid "Create a new unit with a LCL form."
|
|
msgstr "Tee uusi käännösyksikkö ja lomake (LCL form)"
|
|
|
|
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
|
|
msgid "Inherit from a project form or component"
|
|
msgstr "Periytä projektin lomakkeesta tai komponentista"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgnoitemselected
|
|
msgid "No item selected"
|
|
msgstr "Valintoja ei ole"
|
|
|
|
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
|
|
msgid "Please select an item first."
|
|
msgstr "Valitse jotain ensin."
|
|
|
|
#: lazarusidestrconsts.lisnewencoding
|
|
msgid "New encoding:"
|
|
msgstr "Uusi merkkikoodaus:"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname
|
|
msgid "Macro %d"
|
|
msgstr "Makro %d"
|
|
|
|
#: lazarusidestrconsts.lisnewmacroname2
|
|
msgid "New Macroname"
|
|
msgstr "Uusi makron nimi"
|
|
|
|
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
|
|
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
|
|
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnewpage
|
|
msgid "New page"
|
|
msgstr "Uusi sivu"
|
|
|
|
#: lazarusidestrconsts.lisnewproject
|
|
msgid "(new project)"
|
|
msgstr "(uusi projekti)"
|
|
|
|
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
|
|
msgid "New recorded macros. Not to be saved"
|
|
msgstr "Uudet nauhoitetut makrot. Ei talleteta."
|
|
|
|
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
|
|
msgid "New units are added to uses sections"
|
|
msgstr "Uudet käännösyksiköt lisätään uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.lisno
|
|
msgid "No"
|
|
msgstr "Ei"
|
|
|
|
#: lazarusidestrconsts.lisnobackupfiles
|
|
msgid "No backup files"
|
|
msgstr "Ei varmuuskopioita"
|
|
|
|
#: lazarusidestrconsts.lisnobuildprofilesselected
|
|
msgid "No profiles are selected to be built."
|
|
msgstr "Yhtään profiilia ei ole valittu käännettäväksi."
|
|
|
|
#: lazarusidestrconsts.lisnochange
|
|
msgid "No change"
|
|
msgstr "Ei muutoksia"
|
|
|
|
#: lazarusidestrconsts.lisnocodeselected
|
|
msgid "No code selected"
|
|
msgstr "Ei valittua koodia"
|
|
|
|
#: lazarusidestrconsts.lisnocompileroptionsinherited
|
|
msgid "No compiler options inherited."
|
|
msgstr "Kääntäjän asetuksia ei ole periytetty"
|
|
|
|
#: lazarusidestrconsts.lisnohints
|
|
msgid "no hints"
|
|
msgstr "ei vihjeitä"
|
|
|
|
#: lazarusidestrconsts.lisnoidewindowselected
|
|
msgid "No IDE window selected"
|
|
msgstr "Ei IDEn ikkunoita valittuna"
|
|
|
|
#: lazarusidestrconsts.lisnolfmfile
|
|
msgid "No LFM file"
|
|
msgstr "Ei LFM-tiedostoa"
|
|
|
|
#: lazarusidestrconsts.lisnomacroselected
|
|
msgid "No macro selected"
|
|
msgstr "Makroja ei ole valittuna"
|
|
|
|
#: lazarusidestrconsts.lisnomessageselected
|
|
msgid "(no message selected)"
|
|
msgstr "(ei valittuja viestejä)"
|
|
|
|
#: lazarusidestrconsts.lisnoname
|
|
msgid "noname"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisnone
|
|
msgid "%snone"
|
|
msgstr "%sei mikään"
|
|
|
|
#: lazarusidestrconsts.lisnoneclicktochooseone
|
|
msgid "none, click to choose one"
|
|
msgstr "ei mikään, klikkaa valitaksesi joku"
|
|
|
|
#: lazarusidestrconsts.lisnoneselected
|
|
msgid "(None selected)"
|
|
msgstr "(ei mitään valittuna)"
|
|
|
|
#: lazarusidestrconsts.lisnonodeselected
|
|
msgid "no node selected"
|
|
msgstr "ei solmua valittuna"
|
|
|
|
#: lazarusidestrconsts.lisnopascalfile
|
|
msgid "No Pascal file"
|
|
msgstr "Ei Pascal-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisnoprogramfilesfound
|
|
msgid "No program file \"%s\" found."
|
|
msgstr "Ei löydy ohjelmatiedostoa \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisnoresourcestringsectionfound
|
|
msgid "No ResourceString Section found"
|
|
msgstr "Resurssitekstin osiota ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
|
|
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
|
|
msgstr "Yleensä suodatin on säännöllinen lauseke. Yksinkertaisessa suotimessa . on normaali merkki, * tarkoittaa mitä vaan, ? on joku 1 merkki, pilkku ja puolipiste erottavat vaihtoehdot. Esim.: Yksinkertainen *.pas;*.pp vastaa ^(.*\\.pas|.*\\.pp)$"
|
|
|
|
#: lazarusidestrconsts.lisnostringconstantfound
|
|
msgid "No string constant found"
|
|
msgstr "Merkkijonovakiota ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisnotadesigntimepackage
|
|
msgid "Not a designtime package"
|
|
msgstr "Ei ole suunnitteluaikainen paketti"
|
|
|
|
#: lazarusidestrconsts.lisnotaninstallpackage
|
|
msgid "Not an install package"
|
|
msgstr "Ei ole asennettava paketti"
|
|
|
|
#: lazarusidestrconsts.lisnotavalidpascalidentifier
|
|
msgid "Not a valid Pascal identifier"
|
|
msgstr "Ei ole kelvollinen Pascal-tunniste"
|
|
|
|
#: lazarusidestrconsts.lisnote
|
|
msgctxt "lazarusidestrconsts.lisnote"
|
|
msgid "Note"
|
|
msgstr "Huom."
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposbottom
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
|
|
msgid "Bottom"
|
|
msgstr "Alhaalla"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposleft
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
|
|
msgid "Left"
|
|
msgstr "Vasen"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabposright
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
|
|
msgid "Right"
|
|
msgstr "Oikea"
|
|
|
|
#: lazarusidestrconsts.lisnotebooktabpostop
|
|
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
|
|
msgid "Top"
|
|
msgstr "Ylhäällä"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
|
|
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
|
|
msgstr "Huom.: Ei voi luoda määritemallinetta Free Pascal -koodille"
|
|
|
|
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
|
|
msgid "NOTE: Could not create Define Template for Lazarus Sources"
|
|
msgstr "Huom.: Ei voi luoda määritemallinetta Lazarus-koodille"
|
|
|
|
#: lazarusidestrconsts.lisnotemplateselected
|
|
msgid "no template selected"
|
|
msgstr "Mallinetta ei ole valittu"
|
|
|
|
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
|
|
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
|
|
msgstr "%s ei löydy %s:ssa riviltä %s sarakkeesta %s.%sEhkä viesti on vanhentunut."
|
|
|
|
#: lazarusidestrconsts.lisnotimplemented
|
|
msgid "Not implemented"
|
|
msgstr "Ei toteutettu"
|
|
|
|
#: lazarusidestrconsts.lisnotimplementedyet
|
|
msgid "Not implemented yet:%s%s"
|
|
msgstr "Ei toteutettu vielä:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisnotinstalled
|
|
msgid "not installed"
|
|
msgstr "ei asennettu"
|
|
|
|
#: lazarusidestrconsts.lisnotnow
|
|
msgid "Not now"
|
|
msgstr "Ei nyt"
|
|
|
|
#: lazarusidestrconsts.lisnowloadedscheme
|
|
msgid "Now loaded: "
|
|
msgstr "Nyt ladattuna: "
|
|
|
|
#: lazarusidestrconsts.lisnpcreate
|
|
msgid "Create"
|
|
msgstr "Luo"
|
|
|
|
#: lazarusidestrconsts.lisnpcreateanewproject
|
|
msgid "Create a new project"
|
|
msgstr "Luo uusi projekti"
|
|
|
|
#: lazarusidestrconsts.lisnumberoffilestoconvert
|
|
msgid "Number of files to convert: %s"
|
|
msgstr "Muunnettavien tiedostojen määrä: %s"
|
|
|
|
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
|
|
msgid "Object Inspector becomes visible when components are selected in designer."
|
|
msgstr "Komponenttimuokkain tulee näkyviin kun komponentteja valitaan lomake-editorissa."
|
|
|
|
#: lazarusidestrconsts.lisobjectpascaldefault
|
|
msgid "Object Pascal - default"
|
|
msgstr "Object Pascal - oletus"
|
|
|
|
#: lazarusidestrconsts.lisobjectpath
|
|
msgid "object path"
|
|
msgstr "objektipolut"
|
|
|
|
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
|
|
msgid "Switch to Object Inspector Favorites tab"
|
|
msgstr "Siirry muokkaimen suosikit-lehdelle"
|
|
|
|
#: lazarusidestrconsts.lisoff
|
|
msgid "? (Off)"
|
|
msgstr "? (Pois)"
|
|
|
|
#: lazarusidestrconsts.lisofpackage
|
|
msgid " of package %s"
|
|
msgstr " paketin %s"
|
|
|
|
#: lazarusidestrconsts.lisoftheprojectinspector
|
|
msgid " of the Project Inspector"
|
|
msgstr "Projektinhallinnan"
|
|
|
|
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
|
|
msgid "Add to favorite properties"
|
|
msgstr "Lisää suosikkiominaisuuksiin"
|
|
|
|
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
|
|
msgid "Choose a base class for the favorite property \"%s\"."
|
|
msgstr "Valitse kantaluokka suosikkiominaisuudelle \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisoifclassnotfound
|
|
msgid "Class \"%s\" not found."
|
|
msgstr "Luokkaa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
|
|
msgid "Remove from favorite properties"
|
|
msgstr "Poista suosikkiominaisuuksista"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstalldynamic
|
|
msgid "auto install dynamic"
|
|
msgstr "asenna dynaamisesti"
|
|
|
|
#: lazarusidestrconsts.lisoipautoinstallstatic
|
|
msgid "auto install static"
|
|
msgstr "asenna staattisesti"
|
|
|
|
#: lazarusidestrconsts.lisoipdescription
|
|
msgid "Description: "
|
|
msgstr "Selitys: "
|
|
|
|
#: lazarusidestrconsts.lisoipdescriptiondescription
|
|
msgid "%sDescription: %s"
|
|
msgstr "%sSelitys: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipfilename
|
|
msgid "Filename: %s"
|
|
msgstr "Tiedostonimi: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalleddynamic
|
|
msgid "installed dynamic"
|
|
msgstr "asennettu dynaaminen"
|
|
|
|
#: lazarusidestrconsts.lisoipinstalledstatic
|
|
msgid "installed static"
|
|
msgstr "asennettu staattinen"
|
|
|
|
#: lazarusidestrconsts.lisoiplicenselicense
|
|
msgid "%sLicense: %s"
|
|
msgstr "%sLisenssi: %s"
|
|
|
|
#: lazarusidestrconsts.lisoipmissing
|
|
msgid "missing"
|
|
msgstr "puuttuu"
|
|
|
|
#: lazarusidestrconsts.lisoipmodified
|
|
msgid "modified"
|
|
msgstr "muutettu"
|
|
|
|
#: lazarusidestrconsts.lisoipopenloadedpackage
|
|
msgid "Open Loaded Package"
|
|
msgstr "Avaa jo ladattu paketti"
|
|
|
|
#: lazarusidestrconsts.lisoippackagename
|
|
msgid "Package Name"
|
|
msgstr "Paketin nimi"
|
|
|
|
#: lazarusidestrconsts.lisoippleaseselectapackage
|
|
msgid "Please select a package"
|
|
msgstr "Valitse paketti"
|
|
|
|
#: lazarusidestrconsts.lisoipreadonly
|
|
msgid "readonly"
|
|
msgstr "vain luku"
|
|
|
|
#: lazarusidestrconsts.lisoipstate
|
|
msgctxt "lazarusidestrconsts.lisoipstate"
|
|
msgid "State"
|
|
msgstr "Tila"
|
|
|
|
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "%sThis package is installed, but the lpk file was not found"
|
|
msgstr "%sPaketti on asennettu, mutta lpk-tiedosto puuttuu"
|
|
|
|
#: lazarusidestrconsts.lisok
|
|
msgid "OK"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoldclass
|
|
msgid "Old Class"
|
|
msgstr "Vanha luokka"
|
|
|
|
#: lazarusidestrconsts.lison
|
|
msgid "? (On)"
|
|
msgstr "? (Päällä)"
|
|
|
|
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
|
|
msgid "On break line (i.e. return or enter key)"
|
|
msgstr "Riviä vaihdettaessa (Enter näppäin)"
|
|
|
|
#: lazarusidestrconsts.lisonly32bit
|
|
msgid "only 32bit"
|
|
msgstr "vain 32bit"
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
|
|
msgid "Only available on Windows. Run the tool hidden."
|
|
msgstr "Vain Windowsissa. Aja työkalu piilotettuna."
|
|
|
|
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
|
|
msgid "Only available on Windows. Run tool in a new console."
|
|
msgstr "Vain Windowsissa. Aja työkalu uudessa konsolissa."
|
|
|
|
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
|
|
msgid "Only messages fitting this regular expression:"
|
|
msgstr "Vain säännöllisen lausekkeen kanssa täsmäävät viestit:"
|
|
|
|
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
|
|
msgid "Only messages with these FPC IDs (comma separated):"
|
|
msgstr "Vain viestit näiden FPC ID:n kanssa (pilkulla erotettu):"
|
|
|
|
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
|
|
msgid "Only register the Lazarus package files (.lpk). Do not build."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisonlysearchforwholewords
|
|
msgid "Only search for whole words"
|
|
msgstr "Esittävä sana ei voi olla osa toista sanaa"
|
|
|
|
#: lazarusidestrconsts.lisonpastefromclipboard
|
|
msgid "On paste from clipboard"
|
|
msgstr "Liitettäessä leikepöydältä"
|
|
|
|
#: lazarusidestrconsts.lisopen
|
|
msgctxt "lazarusidestrconsts.lisopen"
|
|
msgid "Open"
|
|
msgstr "Avaa"
|
|
|
|
#: lazarusidestrconsts.lisopenasxmlfile
|
|
msgid "Open as XML file"
|
|
msgstr "Avaa XML-tiedostona"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunit
|
|
msgid "Open designer on open unit"
|
|
msgstr "Avaa lomake-editori tiedostoa avattaessa"
|
|
|
|
#: lazarusidestrconsts.lisopendesigneronopenunithint
|
|
msgid "Form is loaded in designer always when source unit is opened."
|
|
msgstr "Lomake ladataan lomake-editoriin aina kun lähdekoodi avataan."
|
|
|
|
#: lazarusidestrconsts.lisopenexistingfile
|
|
msgid "Open existing file"
|
|
msgstr "Avaa tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisopenfile
|
|
msgid "Open File"
|
|
msgstr "Avaa tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisopenfile2
|
|
msgid "Open file"
|
|
msgstr "Avaa tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisopenfileatcursor
|
|
msgid "Open file at cursor"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisopenlfm
|
|
msgid "Open %s"
|
|
msgstr "Avaa %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage
|
|
msgid "Open Package?"
|
|
msgstr "Avaa paketti?"
|
|
|
|
#: lazarusidestrconsts.lisopenpackage2
|
|
msgid "Open package %s"
|
|
msgstr "Avaa paketti %s"
|
|
|
|
#: lazarusidestrconsts.lisopenpackagefile
|
|
msgid "Open Package File"
|
|
msgstr "Avaa pakettitiedosto"
|
|
|
|
#: lazarusidestrconsts.lisopenproject
|
|
msgid "Open Project?"
|
|
msgstr "Avataanko projekti?"
|
|
|
|
#: lazarusidestrconsts.lisopenproject2
|
|
msgid "Open project"
|
|
msgstr "Avaa projekti"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectagain
|
|
msgid "Open project again"
|
|
msgstr "Avaa projekti uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisopenprojectfile
|
|
msgid "Open Project File"
|
|
msgstr "Avaa projektitiedosto"
|
|
|
|
#: lazarusidestrconsts.lisopensymlink
|
|
msgid "Open symlink"
|
|
msgstr "Avaa symlink"
|
|
|
|
#: lazarusidestrconsts.lisopentarget
|
|
msgid "Open target"
|
|
msgstr "Avaa kohde"
|
|
|
|
#: lazarusidestrconsts.lisopenthefileasnormalsource
|
|
msgid "Open the file as normal source"
|
|
msgstr "Avaa tiedosto normaalina lähdekoodina"
|
|
|
|
#: lazarusidestrconsts.lisopenthepackage
|
|
msgid "Open the package %s?"
|
|
msgstr "Avaa paketti %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentheproject
|
|
msgid "Open the project %s?"
|
|
msgstr "Avataanko projekti %s?"
|
|
|
|
#: lazarusidestrconsts.lisopentooloptions
|
|
msgid "Open Tool Options"
|
|
msgstr "Avaa työkaluasetukset"
|
|
|
|
#: lazarusidestrconsts.lisopenunit
|
|
msgid "Open Unit"
|
|
msgstr "Avaa käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisopenurl
|
|
msgid "Open URL"
|
|
msgstr "Avaa URL"
|
|
|
|
#: lazarusidestrconsts.lisopenxml
|
|
msgid "Open XML"
|
|
msgstr "Avaa XML"
|
|
|
|
#: lazarusidestrconsts.lisoptions
|
|
msgctxt "lazarusidestrconsts.lisoptions"
|
|
msgid "Options"
|
|
msgstr "Asetukset"
|
|
|
|
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
|
|
msgid "Options changed, recompiling clean with -B"
|
|
msgstr "Asetukset muuttuivat, käännetään kaikki option -B kanssa"
|
|
|
|
#: lazarusidestrconsts.lisoptionvalueignored
|
|
msgid "ignored"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisor
|
|
msgid "or"
|
|
msgstr "tai"
|
|
|
|
#: lazarusidestrconsts.lisos
|
|
msgid ", OS: %s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
|
|
msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
|
|
msgstr "paketin \"%s\" muut lähdekoodit polku sisältää hakemiston \"%s\", mikä on jo käännösyksikköjen hakupolussa."
|
|
|
|
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
|
|
msgid "output directory of %s contains Pascal unit source \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisoverridelanguage
|
|
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
|
|
msgstr "Syrjäytä kieli. Esim. --language=fi. Mahdolliset arvot selviävät katsomalla languages hakemiston tiedostoja."
|
|
|
|
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
|
|
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
|
|
msgstr "%ssyrjäytä oletuskääntäjä. Esim. ppc386 ppcx64 ppcppc jne. Oletus on tallennettu: environmentoptions.xml"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
|
|
msgid "%soverride the project or IDE build mode."
|
|
msgstr "%ssyrjäytä projektin tai IDE:n koontamoodi."
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
|
|
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
|
|
msgstr "%ssyrjäytä projektin cpu. Esim. i386 x86_64 powerpc powerpc_64 etc. Oletus: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
|
|
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
|
|
msgstr "%ssyrjäytä projektin käyttöjärjestelmä. Esim. win32 linux. Oletus: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
|
|
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
|
|
msgstr "%ssyrjäytä projektin widgetset. Esim. gtk2 qt win32 carbon. Oletus: %s"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefile
|
|
msgid "Overwrite file?"
|
|
msgstr "Korvataanko tiedosto?"
|
|
|
|
#: lazarusidestrconsts.lisoverwritefileondisk
|
|
msgid "Overwrite file on disk"
|
|
msgstr "Korvaa tällä tiedostolla"
|
|
|
|
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
|
|
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
|
|
msgstr "TReader/TWriter käyttää jo nimeä 'Owner'. Valitse toinen nimi."
|
|
|
|
#: lazarusidestrconsts.lispackage
|
|
msgid "Package"
|
|
msgstr "Paketti"
|
|
|
|
#: lazarusidestrconsts.lispackage2
|
|
msgid "package %s"
|
|
msgstr "Paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispackage3
|
|
msgid ", package %s"
|
|
msgstr ", paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispackageinfo
|
|
msgid "Package info"
|
|
msgstr "Paketin tietoja"
|
|
|
|
#: lazarusidestrconsts.lispackagenamebeginswith
|
|
msgid "Package name begins with ..."
|
|
msgstr "Paketin nimi alkaa ..."
|
|
|
|
#: lazarusidestrconsts.lispackagenamecontains
|
|
msgid "Package name contains ..."
|
|
msgstr "Paketin nimi sisältää ..."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
|
|
msgid "Package needs an output directory."
|
|
msgstr "Paketti tarvitsee käännöshakemiston."
|
|
|
|
#: lazarusidestrconsts.lispackageneedsinstallation
|
|
msgid "Package needs installation"
|
|
msgstr "Paketti pitää asentaa"
|
|
|
|
#: lazarusidestrconsts.lispackageoption
|
|
msgid "Package \"%s\" Option"
|
|
msgstr "Paketin \"%s\" valinnat"
|
|
|
|
#: lazarusidestrconsts.lispackageoutputdirectories
|
|
msgid "Package output directories"
|
|
msgstr "Paketin käännöshakemistot"
|
|
|
|
#: lazarusidestrconsts.lispackagesourcedirectories
|
|
msgid "Package source directories"
|
|
msgstr "Paketin lähdehakemistot"
|
|
|
|
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
|
|
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
|
|
msgstr "paketteja=%s/%s käännösyksikköjä=%s/%s tunnisteita=%s/%s rivejä=%s tavuja=%s"
|
|
|
|
#: lazarusidestrconsts.lispackageunit
|
|
msgid "package unit"
|
|
msgstr "paketin käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lispage
|
|
msgid "Page"
|
|
msgstr "Sivu"
|
|
|
|
#: lazarusidestrconsts.lispagename
|
|
msgid "Page name"
|
|
msgstr "Sivun nimi"
|
|
|
|
#: lazarusidestrconsts.lispagenamealreadyexists
|
|
msgid "Page name \"%s\" already exists. Not added."
|
|
msgstr "Sivun nimi \"%s\" on jo olemassa. Ei lisätä."
|
|
|
|
#: lazarusidestrconsts.lispanic
|
|
msgctxt "lazarusidestrconsts.lispanic"
|
|
msgid "Panic"
|
|
msgstr "Paniikki"
|
|
|
|
#: lazarusidestrconsts.lisparsed
|
|
msgid ", parsed "
|
|
msgstr ", jäsennetty "
|
|
|
|
#: lazarusidestrconsts.lisparser
|
|
msgid "parser \"%s\": %s"
|
|
msgstr "jäsentäjä \"%s\": %s"
|
|
|
|
#: lazarusidestrconsts.lispasscount
|
|
msgid "Pass Count"
|
|
msgstr "Suoritusmäärä"
|
|
|
|
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
|
|
msgid "passing compiler define \"%s\" twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
|
|
msgid "passing compiler option -%s twice with different values"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispaste
|
|
msgctxt "lazarusidestrconsts.lispaste"
|
|
msgid "Paste"
|
|
msgstr "Liitä"
|
|
|
|
#: lazarusidestrconsts.lispasteclipboard
|
|
msgid "paste clipboard"
|
|
msgstr "liitä leikepöytä"
|
|
|
|
#: lazarusidestrconsts.lispastefromclipboard
|
|
msgctxt "lazarusidestrconsts.lispastefromclipboard"
|
|
msgid "Paste from clipboard."
|
|
msgstr "Liitä leikepöydältä."
|
|
|
|
#: lazarusidestrconsts.lispastelcolors
|
|
msgid "Pastel Colors"
|
|
msgstr "Pastelli värit"
|
|
|
|
#: lazarusidestrconsts.lispath
|
|
msgid "Path"
|
|
msgstr "Polku"
|
|
|
|
#: lazarusidestrconsts.lispatheditbrowse
|
|
msgctxt "lazarusidestrconsts.lispatheditbrowse"
|
|
msgid "Browse"
|
|
msgstr "Selaa"
|
|
|
|
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
|
|
msgid "Delete Invalid Paths"
|
|
msgstr "Poista kelvottomat polut"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathdown
|
|
msgid "Move path down (Ctrl+Down)"
|
|
msgstr "Siirrä polku alas (Ctrl+Down)"
|
|
|
|
#: lazarusidestrconsts.lispatheditmovepathup
|
|
msgid "Move path up (Ctrl+Up)"
|
|
msgstr "Siirrä polku ylös (Ctrl+Up)"
|
|
|
|
#: lazarusidestrconsts.lispatheditoraddhint
|
|
msgid "Add new path to the list"
|
|
msgstr "Lisää uusi polku listaan"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeletehint
|
|
msgid "Delete the selected path"
|
|
msgstr "Poista valittu polku"
|
|
|
|
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
|
|
msgid "Remove non-existent (gray) paths from the list"
|
|
msgstr "Poista olemattomat (harmaat) polut listasta"
|
|
|
|
#: lazarusidestrconsts.lispatheditorreplacehint
|
|
msgid "Replace the selected path with a new path"
|
|
msgstr "Korvaa valittu polku uudella polulla"
|
|
|
|
#: lazarusidestrconsts.lispatheditortempladdhint
|
|
msgid "Add template to the list"
|
|
msgstr "Lisää malline listaan"
|
|
|
|
#: lazarusidestrconsts.lispatheditpathtemplates
|
|
msgid "Path templates"
|
|
msgstr "Polkujen mallit"
|
|
|
|
#: lazarusidestrconsts.lispatheditsearchpaths
|
|
msgid "Search paths:"
|
|
msgstr "Hakupolut:"
|
|
|
|
#: lazarusidestrconsts.lispathoftheinstantfpccache
|
|
msgid "path of the instantfpc cache"
|
|
msgstr "polku instantfpc:n välimuistiin"
|
|
|
|
#: lazarusidestrconsts.lispathofthemakeutility
|
|
msgid "Path of the make utility"
|
|
msgstr "Polku make-työkaluun"
|
|
|
|
#: lazarusidestrconsts.lispathtoinstance
|
|
msgid "Path to failed Instance:"
|
|
msgstr "Polku epäonnistuneeseen tapaukseen:"
|
|
|
|
#: lazarusidestrconsts.lispause
|
|
msgctxt "lazarusidestrconsts.lispause"
|
|
msgid "Pause"
|
|
msgstr "Keskeytä"
|
|
|
|
#: lazarusidestrconsts.lispckcleartousethepackagename
|
|
msgid "Clear to use the package name"
|
|
msgstr "Tyhjennä käyttääksesi paketin nimeä"
|
|
|
|
#: lazarusidestrconsts.lispckdisablei18noflfm
|
|
msgid "Disable I18N of lfm"
|
|
msgstr "Estä lfm:n I18N"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
|
|
msgid "Add Files from File System"
|
|
msgstr "Lisää tiedostoja tiedostojärjestelmästä"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddotheritems
|
|
msgid "Add other items"
|
|
msgstr "Lisää muita"
|
|
|
|
#: lazarusidestrconsts.lispckeditaddtoproject
|
|
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Lisää projektiin"
|
|
|
|
#: lazarusidestrconsts.lispckeditapplychanges
|
|
msgid "Apply changes"
|
|
msgstr "Toteuta muutokset"
|
|
|
|
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
|
|
msgid "Call %sRegister%s procedure of selected unit"
|
|
msgstr "Kutsu valitun käännösyksikön %sRegisteröintiä%s"
|
|
|
|
#: lazarusidestrconsts.lispckeditcleanupdependencies
|
|
msgid "Clean up dependencies ..."
|
|
msgstr "Siivoa riippuvuudet ..."
|
|
|
|
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
|
|
msgid "Clear default/preferred filename of dependency"
|
|
msgstr "Tyhjennä riippuvuuden oletus/suositeltu tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileeverything
|
|
msgid "Compile everything?"
|
|
msgstr "Käännä kaikki?"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompilepackage
|
|
msgid "Compile package"
|
|
msgstr "Käännä paketti"
|
|
|
|
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
|
|
msgid "Compiler Options for Package %s"
|
|
msgstr "Paketin %s käännösasetukset"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatefpmakefile
|
|
msgid "Create fpmake.pp"
|
|
msgstr "Luo fpmake.pp"
|
|
|
|
#: lazarusidestrconsts.lispckeditcreatemakefile
|
|
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
|
|
msgid "Create Makefile"
|
|
msgstr "Luo Make-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispckeditdefault
|
|
msgid "%s, default: %s"
|
|
msgstr "%s, oletus: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditdependencyproperties
|
|
msgid "Dependency Properties"
|
|
msgstr "Riippuvuuden ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lispckediteditgeneraloptions
|
|
msgid "Edit general options"
|
|
msgstr "Muokkaa yleisiä asetuksia"
|
|
|
|
#: lazarusidestrconsts.lispckeditfileproperties
|
|
msgid "File Properties"
|
|
msgstr "Tiedoston ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lispckeditinstall
|
|
msgid "Install"
|
|
msgstr "Asenna"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
|
|
msgid "Invalid maximum version"
|
|
msgstr "Kelvoton maximiversio"
|
|
|
|
#: lazarusidestrconsts.lispckeditinvalidminimumversion
|
|
msgid "Invalid minimum version"
|
|
msgstr "Kelvoton minimiversio"
|
|
|
|
#: lazarusidestrconsts.lispckeditmaximumversion
|
|
msgid "Maximum Version:"
|
|
msgstr "Maximiversio:"
|
|
|
|
#: lazarusidestrconsts.lispckeditminimumversion
|
|
msgid "Minimum Version:"
|
|
msgstr "Minimiversio:"
|
|
|
|
#: lazarusidestrconsts.lispckeditmodified
|
|
msgid "Modified: %s"
|
|
msgstr "Muunnettu: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencydown
|
|
msgid "Move dependency down"
|
|
msgstr "Siirrä riippuvuutta alaspäin"
|
|
|
|
#: lazarusidestrconsts.lispckeditmovedependencyup
|
|
msgid "Move dependency up"
|
|
msgstr "Siirrä riippuvuutta ylöspäin"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackage
|
|
msgid "Package %s"
|
|
msgstr "Paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
|
|
msgid "Package \"%s\" has changed.%sSave package?"
|
|
msgstr "Paketti \"%s\" on muuttunut.%sTallennetaanko?"
|
|
|
|
#: lazarusidestrconsts.lispckeditpackagenotsaved
|
|
msgid "package %s not saved"
|
|
msgstr "pakettia %s ei ole tallennettu"
|
|
|
|
#: lazarusidestrconsts.lispckeditpage
|
|
msgid "%s, Page: %s"
|
|
msgstr "%s, Komponenttipaletin välilehti: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadddependency
|
|
msgid "Re-Add dependency"
|
|
msgstr "Palauta riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lispckeditreaddfile
|
|
msgid "Re-Add file"
|
|
msgstr "Lisää tiedosto uudelleen"
|
|
|
|
#: lazarusidestrconsts.lispckeditreadonly
|
|
msgid "Read Only: %s"
|
|
msgstr "Vain luettavissa: %s"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileallrequired
|
|
msgid "Recompile All Required"
|
|
msgstr "Käännä uudelleen kaikki tarvittava"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompileclean
|
|
msgid "Recompile Clean"
|
|
msgstr "Puhdas uudelleenkäännös"
|
|
|
|
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
|
|
msgid "Re-Compile this and all required packages?"
|
|
msgstr "Käännä uudestaan tämä ja muut tarvittavat paketit?"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisteredplugins
|
|
msgid "Registered plugins"
|
|
msgstr "Rekisteröidyt liitännäiset"
|
|
|
|
#: lazarusidestrconsts.lispckeditregisterunit
|
|
msgid "Register unit"
|
|
msgstr "Rekisteröi käännösyksikkö "
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency
|
|
msgid "Remove dependency"
|
|
msgstr "Poista riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependency2
|
|
msgid "Remove Dependency?"
|
|
msgstr "Poista riippuvuus?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
|
|
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Poista riippuvuus \"%s\"%spaketista \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedfiles
|
|
msgid "Removed Files"
|
|
msgstr "Poistetut tiedostot"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Poistettuja tarvittavia paketteja"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile
|
|
msgid "Remove file"
|
|
msgstr "Poista tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefile2
|
|
msgid "Remove file?"
|
|
msgstr "Poistetaanko tiedosto?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremovefilefrompackage
|
|
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
|
|
msgstr "Poistetaanko tiedosto \"%s\"%spaketista \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispckeditremoveselecteditem
|
|
msgid "Remove selected item"
|
|
msgstr "Poista valittu kohta"
|
|
|
|
#: lazarusidestrconsts.lispckeditrequiredpackages
|
|
msgid "Required Packages"
|
|
msgstr "Tarvittavat paketit"
|
|
|
|
#: lazarusidestrconsts.lispckeditsavepackage
|
|
msgid "Save Package"
|
|
msgstr "Tallenna paketti"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
|
|
msgid "Store file name as default for this dependency"
|
|
msgstr "Pidä tiedosto oletuksena tälle riippuvuudelle"
|
|
|
|
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
|
|
msgid "Store file name as preferred for this dependency"
|
|
msgstr "Pidä tiedosto suosituksena tälle riippuvuudelle"
|
|
|
|
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
|
|
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Maximiversio \"%s\" on kelvoton paketin versioksi.%s(hyvä esimerkki 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
|
|
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
|
|
msgstr "Pienin versio \"%s\" on kelvoton paketin versioksi.%s(hyvä esimerkki 1.2.3.4)"
|
|
|
|
#: lazarusidestrconsts.lispckedituninstall
|
|
msgid "Uninstall"
|
|
msgstr "Poista asennus"
|
|
|
|
#: lazarusidestrconsts.lispckeditviewpackagesource
|
|
msgid "View Package Source"
|
|
msgstr "Näytä paketin lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.lispckexplbase
|
|
msgid "Base, cannot be uninstalled"
|
|
msgstr "Kanta, ei voi poistaa asennusta"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstalled
|
|
msgctxt "lazarusidestrconsts.lispckexplinstalled"
|
|
msgid "Installed"
|
|
msgstr "Asennettu"
|
|
|
|
#: lazarusidestrconsts.lispckexplinstallonnextstart
|
|
msgid "Install on next start"
|
|
msgstr "Asennetaan seuraavan käynnistyksen yhteydessä"
|
|
|
|
#: lazarusidestrconsts.lispckexplstate
|
|
msgid "%sState: "
|
|
msgstr "%sTila:"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallonnextstart
|
|
msgid "Uninstall on next start (unless needed by an installed package)"
|
|
msgstr "Poista asennus seuraavassa käynnistyksessä (paitsi jos asennettava paketti tarvitsee)"
|
|
|
|
#: lazarusidestrconsts.lispckexpluninstallpackage
|
|
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
|
|
msgid "Uninstall package %s"
|
|
msgstr "Poista paketin %s asennus"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
|
|
msgid "Add options to dependent packages and projects"
|
|
msgstr "Lisää asetukset riippuviin paketteihin ja projekteihin"
|
|
|
|
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
|
|
msgid "Add paths to dependent packages/projects"
|
|
msgstr "Lisää polut riippuviin paketteihin ja projekteihin"
|
|
|
|
#: lazarusidestrconsts.lispckoptsauthor
|
|
msgid "Author"
|
|
msgstr "Tekijä"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
|
|
msgid "Automatically rebuild as needed"
|
|
msgstr "Kokoa uudestaan automaattisesti tarvittaessa"
|
|
|
|
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
|
|
msgid "Auto rebuild when rebuilding all"
|
|
msgstr "Kokoa uudestaan automaattisesti, kun kootaan kaikki"
|
|
|
|
#: lazarusidestrconsts.lispckoptscustom
|
|
msgid "Custom"
|
|
msgstr "Mukautettu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdescriptionabstract
|
|
msgid "Description / Abstract"
|
|
msgstr "Selite / yhteenveto"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntime
|
|
msgid "Designtime"
|
|
msgstr "Suunnitteluaikainen"
|
|
|
|
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
|
|
msgid "Designtime and runtime"
|
|
msgstr "Suunnittelu- ja ajoaika"
|
|
|
|
#: lazarusidestrconsts.lispckoptsideintegration
|
|
msgid "IDE Integration"
|
|
msgstr "IDE yhdistäminen"
|
|
|
|
#: lazarusidestrconsts.lispckoptsinclude
|
|
msgid "Include"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
|
|
msgid "Invalid package type"
|
|
msgstr "Kelvoton pakettityyppi"
|
|
|
|
#: lazarusidestrconsts.lispckoptslibrary
|
|
msgid "Library"
|
|
msgstr "Aliohjelmakirjasto"
|
|
|
|
#: lazarusidestrconsts.lispckoptslicense
|
|
msgid "License"
|
|
msgstr "Lisenssi"
|
|
|
|
#: lazarusidestrconsts.lispckoptslinker
|
|
msgid "Linker"
|
|
msgstr "Linkittäjä"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmajor
|
|
msgid "Major"
|
|
msgstr "Suuri"
|
|
|
|
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
|
|
msgid "Manual compilation (never automatically)"
|
|
msgstr "Manuaalinen käännös (ei automaattista)"
|
|
|
|
#: lazarusidestrconsts.lispckoptsminor
|
|
msgid "Minor"
|
|
msgstr "Pieni"
|
|
|
|
#: lazarusidestrconsts.lispckoptsobject
|
|
msgid "Object"
|
|
msgstr "Objekti"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackageoptions
|
|
msgid "Package Options"
|
|
msgstr "Paketin asetukset"
|
|
|
|
#: lazarusidestrconsts.lispckoptspackagetype
|
|
msgid "Package type"
|
|
msgstr "Paketin tyyppi"
|
|
|
|
#: lazarusidestrconsts.lispckoptsprovides
|
|
msgid "Provides"
|
|
msgstr "Tarjoaa"
|
|
|
|
#: lazarusidestrconsts.lispckoptsrelease
|
|
msgid "Release"
|
|
msgstr "Julkaisu"
|
|
|
|
#: lazarusidestrconsts.lispckoptsruntime
|
|
msgid "Runtime"
|
|
msgstr "Ajonaikainen"
|
|
|
|
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
|
|
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
|
|
msgstr "Paketilla \"%s\" on automaatti-asennuksen lippu.%sSe tarkoittaa että se asennetaan IDE:en%sja sen pitää olla suunnitteluaikainen paketti."
|
|
|
|
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
|
|
msgid "This package provides the same as the following packages:"
|
|
msgstr "Tämä paketti tarjoaa saman kuin seuraavat paketit:"
|
|
|
|
#: lazarusidestrconsts.lispckoptsupdaterebuild
|
|
msgid "Update / Rebuild"
|
|
msgstr "Päivitä / uudelleenkokoa"
|
|
|
|
#: lazarusidestrconsts.lispckoptsusage
|
|
msgid "Usage"
|
|
msgstr "Käyttö"
|
|
|
|
#: lazarusidestrconsts.lispckpackage
|
|
msgid "Package:"
|
|
msgstr "Paketti:"
|
|
|
|
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
|
|
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
|
|
msgstr "Hakupolut fpdoc:in xml-tiedostoille. Useampi polku pitää erottaa puolipisteellä."
|
|
|
|
#: lazarusidestrconsts.lispckshowunneededdependencies
|
|
msgid "Show unneeded dependencies"
|
|
msgstr "Näytä tarpeettomat riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
|
|
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
|
|
msgstr "Kun lomake on talletettu, IDE voi tallentaa kaikki TTranslateString ominaisuudet paketin po-tiedostoon. Siksi I18N pitää sallia tälle paketille, antaa po-hakemisto ja jättää tämä asetus ruksaamatta."
|
|
|
|
#: lazarusidestrconsts.lispdabort
|
|
msgctxt "lazarusidestrconsts.lispdabort"
|
|
msgid "Abort"
|
|
msgstr "Keskeytä"
|
|
|
|
#: lazarusidestrconsts.lispdprogress
|
|
msgid "Progress"
|
|
msgstr "Edistys"
|
|
|
|
#: lazarusidestrconsts.lispecollapsedirectory
|
|
msgid "Collapse directory"
|
|
msgstr "Supista hakemisto"
|
|
|
|
#: lazarusidestrconsts.lispeconflictfound
|
|
msgid "Conflict found"
|
|
msgstr "Ristiriita löytyi"
|
|
|
|
#: lazarusidestrconsts.lispeeditvirtualunit
|
|
msgid "Edit Virtual Unit"
|
|
msgstr "Muokkaa virtuaalista käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lispeexpanddirectory
|
|
msgid "Expand directory"
|
|
msgstr "Laajenna hakemisto"
|
|
|
|
#: lazarusidestrconsts.lispefilename
|
|
msgid "Filename:"
|
|
msgstr "Tiedostonimi:"
|
|
|
|
#: lazarusidestrconsts.lispefixfilescase
|
|
msgid "Fix Files Case"
|
|
msgstr "Korjaa tiedostojen kirjainkoko"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitfilename
|
|
msgid "Invalid unit filename"
|
|
msgstr "Kelvoton käännösyksikön tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lispeinvalidunitname
|
|
msgid "Invalid unitname"
|
|
msgstr "Kelvoton käännösyksikön nimi"
|
|
|
|
#: lazarusidestrconsts.lispemissingfilesofpackage
|
|
msgid "Missing files of package %s"
|
|
msgstr "Paketin %s puuttuvat tiedostot"
|
|
|
|
#: lazarusidestrconsts.lispenewfilenotinincludepath
|
|
msgid "New file not in include path"
|
|
msgstr "Uusi tiedosto ei ole include-polussa"
|
|
|
|
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
|
|
msgid "No files missing. All files exist."
|
|
msgstr "Ei puuttuvia tiedostoja. Kaikki löytyvät."
|
|
|
|
#: lazarusidestrconsts.lisperemovefiles
|
|
msgid "Remove files"
|
|
msgstr "Poista tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisperevertpackage
|
|
msgid "Revert Package"
|
|
msgstr "Palauta paketti"
|
|
|
|
#: lazarusidestrconsts.lispesavepackageas
|
|
msgid "Save Package As ..."
|
|
msgstr "Tallenna paketti nimellä ..."
|
|
|
|
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
|
|
msgid "Show directory hierarchy"
|
|
msgstr "Näytä hakemistorakenne"
|
|
|
|
#: lazarusidestrconsts.lispeshowmissingfiles
|
|
msgid "Show Missing Files"
|
|
msgstr "Näytä puuttuvat tiedostot"
|
|
|
|
#: lazarusidestrconsts.lispesortfiles
|
|
msgid "Sort Files Permanently"
|
|
msgstr "Järjestä tiedostot pysyvästi"
|
|
|
|
#: lazarusidestrconsts.lispesortfilesalphabetically
|
|
msgid "Sort files alphabetically"
|
|
msgstr "Järjestä tiedostot aakkosjärjestykseen"
|
|
|
|
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
|
|
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
|
|
msgstr "Tiedosto \"%s\" ei ole nyt paketin include polussa.%sLisää \"%s\" include polkuun?"
|
|
|
|
#: lazarusidestrconsts.lispeunitname
|
|
msgid "Unitname:"
|
|
msgstr "Käännösyksikön nimi:"
|
|
|
|
#: lazarusidestrconsts.lispeuseallunitsindirectory
|
|
msgid "Use all units in directory"
|
|
msgstr "Käytä kaikkia käännösyksiköitä hakemistossa"
|
|
|
|
#: lazarusidestrconsts.lispeusenounitsindirectory
|
|
msgid "Use no units in directory"
|
|
msgstr "Älä käytä käännösyksiköitä hakemistossa"
|
|
|
|
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
|
|
msgid "Clean up package dependencies"
|
|
msgstr "Siivoa pakettien riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.lispkgclearselection
|
|
msgid "Clear Selection"
|
|
msgstr "Tyhjennä valinta"
|
|
|
|
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
|
|
msgid "CompiledSrcPath addition"
|
|
msgstr "CompiledSrcPath lisäys"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsoutputdirectory
|
|
msgid "Output directory"
|
|
msgstr "Käännöshakemisto"
|
|
|
|
#: lazarusidestrconsts.lispkgdefssrcdirmark
|
|
msgid "Package Source Directory Mark"
|
|
msgstr "Paketin lähdehakemiston merkki"
|
|
|
|
#: lazarusidestrconsts.lispkgdefsunitpath
|
|
msgid "Unit Path"
|
|
msgstr "Käännösyksiköiden polku"
|
|
|
|
#: lazarusidestrconsts.lispkgdeletedependencies
|
|
msgid "Delete dependencies"
|
|
msgstr "Poista riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
|
|
msgid "Do you really want to forget all changes to package %s and reload it from file?"
|
|
msgstr "Tahdotko todella unohtaa kaikki paketin %s muutokset ja ladata sen uudelleen?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
|
|
msgid "New unit not in unitpath"
|
|
msgstr "Uusi käännösyksikkö ei ole hakupolussa"
|
|
|
|
#: lazarusidestrconsts.lispkgeditpublishpackage
|
|
msgid "Publish Package"
|
|
msgstr "Julkaise paketti"
|
|
|
|
#: lazarusidestrconsts.lispkgeditrevertpackage
|
|
msgid "Revert package?"
|
|
msgstr "Palauta paketti?"
|
|
|
|
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
|
|
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
|
|
msgstr "Tiedosto \"%s\"%sei ole paketin hakupolussa.%sLisätäänkö \"%s\" polkuun?"
|
|
|
|
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
|
|
msgid "More functions for the package"
|
|
msgstr "Lisää toimintoja paketille"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypebinary
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
|
|
msgid "Binary"
|
|
msgstr "Binaari"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeinclude
|
|
msgid "Include file"
|
|
msgstr "Include-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypeissues
|
|
msgid "Issues xml file"
|
|
msgstr "Ongelmien xml-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelfm
|
|
msgid "LFM - Lazarus form text"
|
|
msgstr "LFM - Lazarus-lomake tekstinä"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypelrs
|
|
msgid "LRS - Lazarus resource"
|
|
msgstr "LRS - Lazarus-resurssi"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypemainunit
|
|
msgid "Main Unit"
|
|
msgstr "Pääkäännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypetext
|
|
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
|
|
msgid "Text"
|
|
msgstr "Teksti"
|
|
|
|
#: lazarusidestrconsts.lispkgfiletypevirtualunit
|
|
msgid "Virtual Unit"
|
|
msgstr "Virtuaalinen käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
|
|
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Pakettihakemisto. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
|
|
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Paketin include-tiedostojen hakupolku. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
|
|
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Paketin nimi. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
|
|
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Paketin käännöshakemisto. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
|
|
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Paketin lähdetiedostojen hakupolku. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
|
|
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
|
|
msgstr "Paketin käännösyksikköjen hakupolku. Parametri on paketin ID, e.g. \"Nimi\" or \"Nimi 1.0\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
|
|
msgid "%sAdding new Dependency for package %s: package %s"
|
|
msgstr "%sLisätään uusi riippuvuus paketille %s: paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
|
|
msgid "%sAdding new Dependency for project %s: package %s"
|
|
msgstr "%sLisätään uusi riippuvuus projektille %s: paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
|
|
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
|
|
msgstr "Lisää käännösyksikkö uses-lausekkeeseen. Estä se vain yksiköiltä, joita ei saa koskaan kääntää."
|
|
|
|
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
|
|
msgid "Ambiguous units found"
|
|
msgstr "Löytyi ristiriitaisia käännösyksiköitä"
|
|
|
|
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
|
|
msgid "Automatically installed packages"
|
|
msgstr "Automaattisesti asennettavat paketit"
|
|
|
|
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
|
|
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
|
|
msgstr "%sPaketit on yhdistetty. Joko ne käyttävät toisiaan tai molempia käyttää joku kolmas paketti."
|
|
|
|
#: lazarusidestrconsts.lispkgmangbrokendependency
|
|
msgid "Broken dependency"
|
|
msgstr "Rikkinäinen riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcirculardependencies
|
|
msgid "Circular dependencies found"
|
|
msgstr "Kehäriippuvuus löydetty"
|
|
|
|
#: lazarusidestrconsts.lispkgmangcompilepackage
|
|
msgid "Compile package %s"
|
|
msgstr "Käännä paketti %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeletefailed
|
|
msgid "Delete failed"
|
|
msgstr "Poistaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
|
|
msgid "Delete Old Package File?"
|
|
msgstr "Poistetaanko vanha pakettitiedosto?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
|
|
msgid "Delete old package file \"%s\"?"
|
|
msgstr "Poistetaanko vanha pakettitiedosto \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
|
|
msgid "Dependency without Owner: %s"
|
|
msgstr "Riippuvuus ilman omistajaa: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingfile
|
|
msgid "Error reading file"
|
|
msgstr "Virhe luettaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
|
|
msgid "Error Reading Package"
|
|
msgstr "Virhe luettaessa pakettia"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
|
|
msgid "Error: updating po files failed for package %s"
|
|
msgstr "Virhe päivitettäessä po-tiedostoja paketille %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingfile
|
|
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
|
|
msgid "Error writing file"
|
|
msgstr "Virhe kirjoitettaessa tiedostoa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
|
|
msgid "Error Writing Package"
|
|
msgstr "Virhe kirjoitettaessa pakettia"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
|
|
msgid "File is already in package"
|
|
msgstr "Tiedosto on jo projektissa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfileisinproject
|
|
msgid "File is in Project"
|
|
msgstr "Tiedosto on projektissa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
|
|
msgid "Filename differs from Packagename"
|
|
msgstr "Tiedostonimi eroaa paketin nimestä"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
|
|
msgid "Filename is used by other package"
|
|
msgstr "Tiedostonimi on toisen paketin käytössä"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
|
|
msgid "Filename is used by project"
|
|
msgstr "Tiedostonimi on projektin käytössä"
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotfound
|
|
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Tiedostoa \"%s\" ei löytynyt."
|
|
|
|
#: lazarusidestrconsts.lispkgmangfilenotsaved
|
|
msgid "File not saved"
|
|
msgstr "Tiedostoa ei ole tallennettu"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
|
|
msgid "Installing the package %s will automatically install the package:"
|
|
msgstr "Asennettaessa komponettipaketti %s asennataan automaattisesti paketti:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
|
|
msgid "Installing the package %s will automatically install the packages:"
|
|
msgstr "Asennettaessa komponettipaketti %s asennataan automaattisesti paketit:"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
|
|
msgid "invalid Compiler filename"
|
|
msgstr "Kelvoton kääntäjän tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidfileextension
|
|
msgid "Invalid file extension"
|
|
msgstr "Kelvoton tiedoston tarkennin"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
|
|
msgid "Invalid package file extension"
|
|
msgstr "Kelvoton pakettitiedoston tarkennin"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
|
|
msgid "Invalid package filename"
|
|
msgstr "Kelvoton paketin tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename
|
|
msgid "Invalid package name"
|
|
msgstr "Kelvoton paketin nimi"
|
|
|
|
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
|
|
msgid "Invalid Package Name"
|
|
msgstr "Kelvoton paketin nimi"
|
|
|
|
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
|
|
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
|
|
msgstr "Paketin %s lataaminen korvaa paketin %s%stiedostossa %s.%sVanha paketti on muuttunut.%sTallennetaanko se %s?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangnewpackage
|
|
msgid "NewPackage"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackage
|
|
msgid "Package: %s"
|
|
msgstr "Paketti: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageconflicts
|
|
msgid "Package conflicts"
|
|
msgstr "Pakettien ristiriidat"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
|
|
msgid "Package is not a designtime package"
|
|
msgstr "Ei ole suunnitteluaikainen paketti"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackageisrequired
|
|
msgid "Package is required"
|
|
msgstr "Paketti tarvitaan"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
|
|
msgid "package main source file"
|
|
msgstr "paketin päälähdekooditiedosto"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
|
|
msgid "Package name already exists"
|
|
msgstr "Paketti samalla nimellä on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
|
|
msgid "Packages must have the extension .lpk"
|
|
msgstr "Paketilla pitää olla pääte .lpk"
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
|
|
msgid "Please compile the package first."
|
|
msgstr "Käännä paketti ensin."
|
|
|
|
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
|
|
msgid "Please save the file before adding it to a package."
|
|
msgstr "Tallenna tiedosto ennen sen lisäämistä pakettiin."
|
|
|
|
#: lazarusidestrconsts.lispkgmangproject
|
|
msgid "Project: %s"
|
|
msgstr "Projekti: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrebuildlazarus
|
|
msgid "Rebuild Lazarus?"
|
|
msgstr "Kootaanko Lazarus uudelleen?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
|
|
msgid "Rename File lowercase?"
|
|
msgstr "Muuta tiedoston nimi pieniksi?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
|
|
msgid "Replace existing file \"%s\"?"
|
|
msgstr "Korvaa nykyinen tiedosto \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangreplacefile
|
|
msgid "Replace File"
|
|
msgstr "Korvaa tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
|
|
msgid "One or more required packages were not found. See package graph for details."
|
|
msgstr "Joitain vaadittuja paketteja ei löytynyt. Katso tarkemmin pakettikuvaajasta."
|
|
|
|
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
|
|
msgid ""
|
|
"The package %s is already open in the IDE.\n"
|
|
"You cannot save a package with the same name.\n"
|
|
msgstr ""
|
|
"Paketti %s on jo avoinna IDE:ssä.\n"
|
|
"Pakettia ei voi tallentaa samalla nimellä.\n"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackage
|
|
msgid "Save package?"
|
|
msgstr "Tallenna paketti?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangsavepackagelpk
|
|
msgid "Save Package %s (*.lpk)"
|
|
msgstr "Tallenna paketti %s (*.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
|
|
msgid "Should the file be renamed lowercase to%s\"%s\"?"
|
|
msgstr "Pitäisikö tiedoston nimi olla pienillä kirjaimilla:%s\"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangskipthispackage
|
|
msgid "Skip this package"
|
|
msgstr "Ohita tämä paketti"
|
|
|
|
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
|
|
msgid "static packages config file"
|
|
msgstr "staattisten pakettien config-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
|
|
msgid "The compiler file for package %s is not a valid executable:%s%s"
|
|
msgstr "Kääntäjä paketille %s ei ole suoritettava ohjelma:%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
|
|
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
|
|
msgid "The file \"%s\"%sis already in the package %s."
|
|
msgstr "Tiedosto \"%s\"%son jo paketissa %s."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
|
|
msgid "The file \"%s\" is not a Lazarus package."
|
|
msgstr "Tiedosto \"%s\" ei ole Lazarus-paketti."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
|
|
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
|
|
msgstr "Tiedoston nimi \"%s\" ei vastaa paketin nimeä \"%s\" tiedostossa.%sVaihda paketin nimeksi \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
|
|
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
|
|
msgstr "Tiedosto \"%s\" on osa nykyistä projektia.%sProjektin ja paketin ei tulisi jakaa tiedostoja."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
|
|
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
|
|
msgstr "Tiedosto \"%s\" on käytössä%spaketissa \"%s\"%stiedostossa \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
|
|
msgid "The file \"%s\" of package %s was not found."
|
|
msgstr "Paketin %s tiedostoa \"%s\" ei löydy."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
|
|
msgid "The following package failed to load:"
|
|
msgstr "Seuraavan paketin lataaminen epäonnistui:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
|
|
msgid "The following packages failed to load:"
|
|
msgstr "Seuraavien pakettien lataaminen epäonnistui:"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
|
|
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
|
|
msgstr "%sSeuraavat käännösyksiköt lisätään tiedoston %s%s uses-lauseeseen :%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
|
|
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
|
|
msgstr "Paketin \"%s\" kääntäminen epäonnistui.%sPoistetaanko se asennuksesta?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
|
|
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
|
|
msgstr "Pakettitiedoston nimi \"%s\" %s\"%s\":ssa ei ole kelvollinen Lazarus-paketin nimi."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
|
|
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
|
|
msgstr "Paketti %s on vain ajonaikainen.%sAjonaikaisia paketteja ei asenneta IDE:en."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
|
|
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
|
|
msgstr "Paketti \"%s\" on käännetty automaattisesti ja sen käännöshakemisto on \"%s\", mikä on kääntäjän oletus. Paketti käyttää muita paketteja, mitkä myös käyttävät kääntäjän oletusta käännösyksiköiden hakuun. Se synnyttää ikuisen luupin.%sOngelma pitää ratkaista poistamalla polku kääntäjän konfiguroinnista (esim. fpc.cfg)%stai kieltämällä paketin automaattinen päivitys tai poistamalla riippuvuudet."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
|
|
msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
|
|
msgstr "Paketti \"%s\" on merkitty asennettavaksi mutta sitä ei löydy.%sPoistetaanko riippuvuus pakettien asennusluettelosta?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
|
|
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
|
|
msgstr "Pakettia %s tarvitaan komponettipaketissa %s, mikä on merkitty asennukseen.%sKatso pakettien kuvauksista"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
|
|
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
|
|
msgstr "\"%s\" ei ole kelvollinen paketin nimi%sValitse toinen nimi (esim. package1.lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
|
|
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
|
|
msgstr "Paketin nimi \"%s\"%stiedostossa \"%s\" on kelvoton."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
|
|
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paketti \"%s\" oli merkitty poistettavaksi.%sNykyinen Lazarus tukee ainoastaan staattisesti linkattuja paketteja. Poistaminen vaatii Lazaruksen uudelleenkokoamisen ja käynnistämisen.%sTehdäänkö se nyt?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
|
|
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
|
|
msgstr "Paketti \"%s\" oli merkitty asennettavaksi.%sNykyinen Lazarus tukee ainoastaan staattisesti linkattuja paketteja. Asennus vaatii Lazaruksen uudelleenkokoamisen ja käynnistämisen.%sTehdäänkö se nyt?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
|
|
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
|
|
msgstr "Sovellus tarvitsee paketin \"%s\".%sMutta sitä ei löydy (tai ei ole asennettu). Katso Projekti -> Projektinhallinta."
|
|
|
|
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
|
|
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
|
|
msgstr "On kaksi käännösyksikköä samalla nimellä:%s1. \"%s\" %s:ssa%s2. \"%s\" from \"%s\":ssa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
|
|
msgid "There is a circular dependency in the packages. See package graph."
|
|
msgstr "Paketissa on kehäriippuvuus. Katso pakettikuvaajaa."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
|
|
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
|
|
msgstr "FPC:llä on saman niminen käännösyksikkö kuin paketilla:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
|
|
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
|
|
msgstr "FPC:llä on saman niminen käännösyksikkö kuin:%s\"%s\" \"%s\":ssa"
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
|
|
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
|
|
msgstr "\"%s\" niminen paketti on jo olemassa.%sRistiriitainen paketti: \"%s\"%sTiedosto: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
|
|
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
|
|
msgstr "Paketti \"%s\" on jo ladattu%stiedostosta \"%s\".%sKatso tarkemmin pakettikuvaajasta.%sKorvaaminen on mahdotonta."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
|
|
msgid "There is an unsaved package in the required packages. See package graph."
|
|
msgstr "Joku vaadituista paketeista on tallentamatta. Katso pakettikuvaajasta."
|
|
|
|
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
|
|
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
|
|
msgstr "Käännösuksikkö on saman niminen kuin paketti:%s1. \"%s\" %s:sta%s2. \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
|
|
msgid "This is a virtual package. It has no source yet. Please save the package first."
|
|
msgstr "Tämä on virtuaalinen paketti eikä sillä ole vielä lähdekoodia. Tallenna se ensin."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
|
|
msgid "Unable to create directory"
|
|
msgstr "Kansion luonti epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
|
|
msgid "Unable to create output directory \"%s\"%sfor package %s."
|
|
msgstr "Käännöshakemiston \"%s\"%sluominen paketille %s ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
|
|
msgid "Unable to create package source directory \"%s\"%sfor package %s."
|
|
msgstr "Lähdehakemiston \"%s\"%sluominen paketille %s ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
|
|
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
|
|
msgstr "Kohdehakemiston luominen Lazarusta varten ei onnistu:%s\"%s\".%sHakemisto tarvitaan."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefile
|
|
msgid "Unable to delete file \"%s\"."
|
|
msgstr "Tiedoston \"%s\" poistaminen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
|
|
msgid "Unable to delete file"
|
|
msgstr "Tiedoston poistaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
|
|
msgid "Unable to delete old state file \"%s\"%sfor package %s."
|
|
msgstr "Vanhan tilatiedoston \"%s\"%spoistaminen paketille %s ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
|
|
msgid "Unable to load package"
|
|
msgstr "Paketin lataaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
|
|
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
|
|
msgstr "Ei pystytä avaamaan pakettia \"%s\".%sPaketti oli merkitty asennettavaksi."
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
|
|
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Tilatiedoston \"%s\"%slukeminen paketille %s ei onnistu.%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
|
|
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
|
|
msgstr "Paketin \"%s\"%skirjoittaminen tiedostoon \"%s\" ei onnistu.%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
|
|
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
|
|
msgstr "Tilatiedoston \"%s\"%skirjoittaminen paketille %s ei onnistu.%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage
|
|
msgid "Uninstall package?"
|
|
msgstr "Poistetaanko paketin asennus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguninstallpackage2
|
|
msgid "Uninstall package %s?"
|
|
msgstr "Poistetaanko paketin %s asennus?"
|
|
|
|
#: lazarusidestrconsts.lispkgmangunsavedpackage
|
|
msgid "Unsaved package"
|
|
msgstr "Tallentamaton paketti"
|
|
|
|
#: lazarusidestrconsts.lispkgmanguseunit
|
|
msgid "Use unit"
|
|
msgstr "Käytä käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
|
|
msgid "Warning: The file \"%s\"%sbelongs to the current project."
|
|
msgstr "Varoitus: Tiedosto \"%s\"%skuuluu jo projektiin."
|
|
|
|
#: lazarusidestrconsts.lispkgmgrkeep
|
|
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
|
|
msgid "keep"
|
|
msgstr "säilytä"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrnew
|
|
msgctxt "lazarusidestrconsts.lispkgmgrnew"
|
|
msgid "new"
|
|
msgstr "uusi"
|
|
|
|
#: lazarusidestrconsts.lispkgmgrremove
|
|
msgctxt "lazarusidestrconsts.lispkgmgrremove"
|
|
msgid "remove"
|
|
msgstr "poista"
|
|
|
|
#: lazarusidestrconsts.lispkgselectapackage
|
|
msgid "Select a package"
|
|
msgstr "Valitse paketti"
|
|
|
|
#: lazarusidestrconsts.lispkgsinstalled
|
|
msgctxt "lazarusidestrconsts.lispkgsinstalled"
|
|
msgid "Installed"
|
|
msgstr "Asennettu"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
|
|
msgid "Cannot register components without unit"
|
|
msgstr "Ei voi rekisteröidä komponenttia ilman käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
|
|
msgid "Component Class \"%s\" already defined"
|
|
msgstr "Komponenttiluokka \"%s\" on jo määritelty"
|
|
|
|
#: lazarusidestrconsts.lispkgsysfilename
|
|
msgid "%s%sFile Name: \"%s\""
|
|
msgstr "%s%sTiedoston nimi: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
|
|
msgid "Invalid component class"
|
|
msgstr "Kelvoton komponenttiluokka"
|
|
|
|
#: lazarusidestrconsts.lispkgsysinvalidunitname
|
|
msgid "Invalid Unitname: %s"
|
|
msgstr "Kelvoton käännösyksikön nimi: %s"
|
|
|
|
#: lazarusidestrconsts.lispkgsyslpkfilename
|
|
msgid "%s%slpk file: \"%s\""
|
|
msgstr "%s%slpk tiedosto: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
|
|
msgid "Package file not found"
|
|
msgstr "Pakettitiedostoa ei löydy"
|
|
|
|
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
|
|
msgid "Package registration error"
|
|
msgstr "Paketin rekisteröintivirhe"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
|
|
msgid "Register procedure is nil"
|
|
msgstr "'Register' aliohjelma on Nil"
|
|
|
|
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
|
|
msgid "RegisterUnit was called, but no package is registering."
|
|
msgstr "RegisterUnit kutsuttiin, mutta paketteja ei ole rekisteröity."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
|
|
msgid "%s%sThe lpk file was not found."
|
|
msgstr "%s%slpk tiedostoa ei löydy."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
|
|
msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
|
|
msgstr "Paketti \"%s\" on asennettu, mutta kelvollista pakettitiedostoa (.lpk) ei löydy.%sTyhjä rikkinäinen paketti luotiin."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
|
|
msgid "This is the default package. Used only for components without a package. These components are outdated."
|
|
msgstr "Tämä on oletuspaketti. Käytetään vain komponenteille, millä ei ole pakettia. Komponentit ovat vanhentuneet."
|
|
|
|
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
|
|
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
|
|
msgstr "Tämä paketti on asennettu, mutta pakettitiedostoa (.lpk) ei löydy. Komponentit eivät ole käytössä. Korjaa vika."
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitname
|
|
msgid "%s%sUnit Name: \"%s\""
|
|
msgstr "%s%sKäännösyksikön nimi: \"%s\""
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
|
|
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
|
|
msgstr "Käännösyksikköä \"%s\" ei löydy .lpk tiedostosta.%sEhkä tätä lpk:ta ei käytetty IDEn käännöksessä, tai paketti käyttää väärin RegisterUnit:a."
|
|
|
|
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
|
|
msgid "Unit \"%s\" was removed from package (lpk)"
|
|
msgstr "Käännösyksikkö \"%s\" poistettiin paketista (lpk)"
|
|
|
|
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
|
|
msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
|
|
msgstr "Seuraavia riippuvuuksia ei tarvita, koska riippuvuudet siirtyvät automaattisesti paketista toiseen."
|
|
|
|
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
|
|
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
|
|
msgstr "Projekti ajaa yli seuraavien pakettien käännöshakemiston.%sKatso Projekti / Kääntäjän asetukset / Lisämääritykset%s%s"
|
|
|
|
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
|
|
msgid "This file is not in any loaded package."
|
|
msgstr "Tämä tiedosto ei ole missään ladatussa paketissa."
|
|
|
|
#: lazarusidestrconsts.lispkgtransitivity
|
|
msgid "Transitivity"
|
|
msgstr "Siirtyvyys"
|
|
|
|
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
|
|
msgid "Unable to read package file \"%s\".%sError: %s"
|
|
msgstr "Paketin \"%s\" lukeminen ei onnistu.%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisplay
|
|
msgid "Play"
|
|
msgstr "Aja"
|
|
|
|
#: lazarusidestrconsts.lispldglobal
|
|
msgctxt "lazarusidestrconsts.lispldglobal"
|
|
msgid "Global"
|
|
msgstr "Julkinen"
|
|
|
|
#: lazarusidestrconsts.lispldonline
|
|
msgid "Online"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldpackagelinks
|
|
msgid "Package Links"
|
|
msgstr "Pakettilinkit"
|
|
|
|
#: lazarusidestrconsts.lispldshowgloballinksin
|
|
msgid "Show global links in "
|
|
msgstr "Näytä globaalit linkit: "
|
|
|
|
#: lazarusidestrconsts.lispldshowonlinelinks
|
|
msgid "Show online links"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lispldshowuserlinksin
|
|
msgid "Show user links in "
|
|
msgstr "Näytä käyttäjän linkit: "
|
|
|
|
#: lazarusidestrconsts.lisplduser
|
|
msgid "User"
|
|
msgstr "Käyttäjä"
|
|
|
|
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
|
|
msgid "Please fix the error shown in the message window, which is normally below the source editor."
|
|
msgstr "Korjaa viesti-ikkunassa näkyvä virhe."
|
|
|
|
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
|
|
msgid "Please open a unit before run."
|
|
msgstr "Avaa käänösyksikkö ennen suoritusta."
|
|
|
|
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
|
|
msgid "Please select some code to extract a new procedure/method."
|
|
msgstr "Valitse ensin jokin koodin osa josta tehdään uusi aliohjelma tai metodi"
|
|
|
|
#: lazarusidestrconsts.lisplistall
|
|
msgctxt "lazarusidestrconsts.lisplistall"
|
|
msgid "<All>"
|
|
msgstr "<Kaikki>"
|
|
|
|
#: lazarusidestrconsts.lisplistchangefont
|
|
msgid "Change Font"
|
|
msgstr "Muuta kirjasinta"
|
|
|
|
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
|
|
msgid "Copy method name to the clipboard"
|
|
msgstr "Kopioi metodin nimi leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterany
|
|
msgid "Filter by matching any part of method"
|
|
msgstr "Suodata koko metodin tekstin mukaan"
|
|
|
|
#: lazarusidestrconsts.lisplistfilterstart
|
|
msgid "Filter by matching with start of method"
|
|
msgstr "Suodata metodin alun mukaan"
|
|
|
|
#: lazarusidestrconsts.lisplistjumptoselection
|
|
msgid "Jump To Selection"
|
|
msgstr "Hyppää valintaan"
|
|
|
|
#: lazarusidestrconsts.lisplistnone
|
|
msgid "<None>"
|
|
msgstr "<Ei mikään>"
|
|
|
|
#: lazarusidestrconsts.lisplistobjects
|
|
msgid "&Objects"
|
|
msgstr "&Objektit"
|
|
|
|
#: lazarusidestrconsts.lisplistprocedurelist
|
|
msgid "Procedure List"
|
|
msgstr "Aliohjelmaluettelo"
|
|
|
|
#: lazarusidestrconsts.lisplisttype
|
|
msgctxt "lazarusidestrconsts.lisplisttype"
|
|
msgid "Type"
|
|
msgstr "Tyyppi"
|
|
|
|
#: lazarusidestrconsts.lispochoosepofiledirectory
|
|
msgid "Choose .po file directory"
|
|
msgstr "Valitse .po-tiedoston hakemisto"
|
|
|
|
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
|
|
msgid "Do not save any session info"
|
|
msgstr "Älä tallenna istunnon tietoja"
|
|
|
|
#: lazarusidestrconsts.lispointer
|
|
msgid "Pointer"
|
|
msgstr "Osoitin"
|
|
|
|
#: lazarusidestrconsts.lisposaveinideconfigdirectory
|
|
msgid "Save in .lps file in IDE config directory"
|
|
msgstr "Tallenna .lps-tiedostoon config-hakemistossa"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpifil
|
|
msgid "Save in .lpi file"
|
|
msgstr "Tallenna .lpi-tiedostoon"
|
|
|
|
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
|
|
msgid "Save in .lps file in project directory"
|
|
msgstr "Tallenna .lps-tiedostoon projektihakemistossa"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationin
|
|
msgid "Save session information in"
|
|
msgstr "Tallenna istunnon tiedot"
|
|
|
|
#: lazarusidestrconsts.lisposavesessioninformationinhint
|
|
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
|
|
msgstr ".lpi on projektin määrittelytiedosto, .lps on erillinen tiedosto vain istunnon tietoja varten."
|
|
|
|
#: lazarusidestrconsts.lisposition
|
|
msgid "Position"
|
|
msgstr "Sijainti"
|
|
|
|
#: lazarusidestrconsts.lispositionoutsideofsource
|
|
msgid "%s (position outside of source)"
|
|
msgstr "%s (sijainti lähdekoodin ulkopuolella)"
|
|
|
|
#: lazarusidestrconsts.lisppuinwrongdirectory
|
|
msgid "ppu in wrong directory=%s."
|
|
msgstr "ppu väärässä hakemistossa=%s."
|
|
|
|
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
|
|
msgid "%s.ppu not found. Check your fpc.cfg."
|
|
msgstr "%s.ppu ei löydy. Tarkista fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.lisprecedingword
|
|
msgid "Preceding word"
|
|
msgstr "Edeltävä sana"
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
|
|
msgid "primary config directory, where Lazarus stores its config files. Default is "
|
|
msgstr "ensisijainen hakemisto, minne Lazarus tallentaa config-tiedostot. Oletus on "
|
|
|
|
#: lazarusidestrconsts.lisprimaryconfigpath
|
|
msgid "Primary config path"
|
|
msgstr "Ensisijainen config-hakemisto"
|
|
|
|
#: lazarusidestrconsts.lisprior
|
|
msgid "prior %s"
|
|
msgstr "ennen %s"
|
|
|
|
#: lazarusidestrconsts.lispriority
|
|
msgctxt "lazarusidestrconsts.lispriority"
|
|
msgid "Priority"
|
|
msgstr "Ensisijaisuus"
|
|
|
|
#: lazarusidestrconsts.lisprivate
|
|
msgid "Private"
|
|
msgstr "Yksityinen"
|
|
|
|
#: lazarusidestrconsts.lisprivatemethod
|
|
msgid "Private Method"
|
|
msgstr "Yksityinen metodi"
|
|
|
|
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
|
|
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
|
|
msgstr "Joitain paketteja pitää ehkä asentaa ennen jatkamista.%sVaroitus:%sProjekti käyttää seuraavia design-paketteja, joita ehkä tarvitaan avaamaan suunniteltava lomake. Jatkettaessa voi tulla virheitä puuttuvista komponenteista ja lomakkeen lataus epäonnistuu.%sOn suositeltavaa peruuttaa ja asentaa nuo paketit ensin."
|
|
|
|
#: lazarusidestrconsts.lisprocedure
|
|
msgctxt "lazarusidestrconsts.lisprocedure"
|
|
msgid "Procedure"
|
|
msgstr "Aliohjelma"
|
|
|
|
#: lazarusidestrconsts.lisprocedurewithinterface
|
|
msgid "Procedure with interface"
|
|
msgstr "Aliohjelma ja sen rajapinta"
|
|
|
|
#: lazarusidestrconsts.lisprogram
|
|
msgctxt "lazarusidestrconsts.lisprogram"
|
|
msgid "Program"
|
|
msgstr "Ohjelma"
|
|
|
|
#: lazarusidestrconsts.lisprogramdetected
|
|
msgid "Program detected"
|
|
msgstr "Tunnistettiin ohjelmaksi"
|
|
|
|
#: lazarusidestrconsts.lisprogramprogramdescriptor
|
|
msgid "A Free Pascal command line program with some useful settings added."
|
|
msgstr "Free Pascal komentoriviohjelma, mukana joitain hyödyllisia asetuksia."
|
|
|
|
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
|
|
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
|
|
msgstr "Ohjelman lähdekoodin tiedostotarkennin pitää olla .pas, .pp tai .lpr"
|
|
|
|
#: lazarusidestrconsts.lisprojaddaddfilestoproject
|
|
msgid "Add Files to Project"
|
|
msgstr "Lisää tiedostoja projektiin"
|
|
|
|
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
|
|
msgid "Dependency already exists"
|
|
msgstr "Riippuvuus on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisprojaddeditorfile
|
|
msgid "Add Editor Files"
|
|
msgstr "Lisää editorissa avoinna olevia tiedostoja"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
|
|
msgid "Invalid Min-Max version"
|
|
msgstr "Kelvoton Min-Max versio"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
|
|
msgid "Invalid Pascal unit name"
|
|
msgstr "Kelvoton Pascal -käännösyksikön nimi"
|
|
|
|
#: lazarusidestrconsts.lisprojaddinvalidversion
|
|
msgid "Invalid version"
|
|
msgstr "Kelvoton versio"
|
|
|
|
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
|
|
msgid "Maximum Version (optional):"
|
|
msgstr "Maximiversio (valinnainen):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddminimumversionoptional
|
|
msgid "Minimum Version (optional):"
|
|
msgstr "Pienin versio (valinnainen):"
|
|
|
|
#: lazarusidestrconsts.lisprojaddnewrequirement
|
|
msgid "New Requirement"
|
|
msgstr "Uusi riippuvuus"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagename
|
|
msgid "Package Name:"
|
|
msgstr "Paketin nimi:"
|
|
|
|
#: lazarusidestrconsts.lisprojaddpackagenotfound
|
|
msgid "Package not found"
|
|
msgstr "Pakettia ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
|
|
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
|
|
msgstr "Riippuvuutta \"%s\" ei löytynyt.%sValitse jokin toinen paketti."
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
|
|
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Maximiversio \"%s\" on kelvoton.%sKäytä muotoa iso.pieni.julkaisu.käännös%sEsim.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
|
|
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
|
|
msgid "The Maximum Version is lower than the Minimim Version."
|
|
msgstr "Maximiversio on pienempi kuin Minimiversio."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
|
|
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
|
|
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
|
|
msgstr "Minimiversio \"%s\" on kelvoton.%sKäytä muotoa iso.pieni.julkaisu.käännös%sEsim.: 1.0.20.10"
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
|
|
msgid "The project has already a dependency for the package \"%s\"."
|
|
msgstr "Projektilla on jo riippuvuus pakettiin \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
|
|
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
|
|
msgstr "Käännösyksikkö \"%s\" on jo projektissa%stiedostona: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
|
|
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
|
|
msgstr "Käännösyksikkö \"%s\" on jo valinnassa%stiedostossa: \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
|
|
msgid "The unit name \"%s\" is not a valid Pascal identifier."
|
|
msgstr "Käännösyksikön nimi \"%s\" ei ole kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lisprojaddtoproject
|
|
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
|
|
msgid "Add to Project"
|
|
msgstr "Lisää projektiin"
|
|
|
|
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
|
|
msgid "Unit name already exists"
|
|
msgstr "Käännösyksikön nimi on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.lisproject
|
|
msgid "Project %s"
|
|
msgstr "Projekti %s"
|
|
|
|
#: lazarusidestrconsts.lisproject2
|
|
msgid "Project: "
|
|
msgstr "Projekti: "
|
|
|
|
#: lazarusidestrconsts.lisproject3
|
|
msgid "project"
|
|
msgstr "projekti"
|
|
|
|
#: lazarusidestrconsts.lisprojectchanged
|
|
msgid "Project changed"
|
|
msgstr "Projekti on muuttunut"
|
|
|
|
#: lazarusidestrconsts.lisprojectchangedondisk
|
|
msgid "Project changed on disk"
|
|
msgstr "Projektin tallennus on muuttunut"
|
|
|
|
#: lazarusidestrconsts.lisprojectcount
|
|
msgid "%d projects"
|
|
msgstr "%d projektia"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectory
|
|
msgctxt "lazarusidestrconsts.lisprojectdirectory"
|
|
msgid "Project directory"
|
|
msgstr "Projektihakemisto"
|
|
|
|
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
|
|
msgid "Title in taskbar shows also directory path of the project"
|
|
msgstr "Tehtäväpalkin otsikko näyttää myös projektin polun"
|
|
|
|
#: lazarusidestrconsts.lisprojectfilename
|
|
msgid "Project filename"
|
|
msgstr "Projektin tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.lisprojectincpath
|
|
msgid "Project Include Path"
|
|
msgstr "Projekti Include polku"
|
|
|
|
#: lazarusidestrconsts.lisprojectinfofiledetected
|
|
msgid "Project info file detected"
|
|
msgstr "Tunnistettiin 'Project Info'-tiedostoksi"
|
|
|
|
#: lazarusidestrconsts.lisprojectinformation
|
|
msgid "Project information"
|
|
msgstr "Projektin tiedot"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnable
|
|
msgid "Project is runnable"
|
|
msgstr "Projekti on ajettavissa"
|
|
|
|
#: lazarusidestrconsts.lisprojectisrunnablehint
|
|
msgid "Generates a binary executable which can be run."
|
|
msgstr "Generoi suoritettavan binaaritiedoston."
|
|
|
|
#: lazarusidestrconsts.lisprojectmacro
|
|
msgctxt "lazarusidestrconsts.lisprojectmacro"
|
|
msgid "Project"
|
|
msgstr "Projekti"
|
|
|
|
#: lazarusidestrconsts.lisprojectmacroproperties
|
|
msgid "Project macro properties"
|
|
msgstr "Projektin makron ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lisprojectoption
|
|
msgid "Project Option"
|
|
msgstr "Projektin valinnat"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutdir
|
|
msgid "Project Output directory (e.g. the ppu directory)"
|
|
msgstr "Projektin käännöshakemisto (esim. ppu hakemisto)"
|
|
|
|
#: lazarusidestrconsts.lisprojectoutputdirectory
|
|
msgid "Project output directory"
|
|
msgstr "Projektin käännöshakemisto"
|
|
|
|
#: lazarusidestrconsts.lisprojectpathhint
|
|
msgid "Directory where project's main file must be"
|
|
msgstr "Hekemisto missä projektin päätiedoston pitää olla"
|
|
|
|
#: lazarusidestrconsts.lisprojectsession
|
|
msgid "Project Session"
|
|
msgstr "Projektin istunto"
|
|
|
|
#: lazarusidestrconsts.lisprojectsessionchanged
|
|
msgid "Project session changed"
|
|
msgstr "Projektin istunto vaihtui"
|
|
|
|
#: lazarusidestrconsts.lisprojectsourcedirectories
|
|
msgid "Project source directories"
|
|
msgstr "Projektin lähdehakemistot"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
|
|
msgid "%0:s%0:s At address %1:x"
|
|
msgstr "%0:s%0:s osoitteessa %1:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
|
|
msgid "Project %s raised exception class '%s'."
|
|
msgstr "Projekti %s nosti poikkeuksen luokalla '%s'."
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
|
|
msgid "Project %s raised exception class '%s' with message:%s%s"
|
|
msgstr "Projekti %s nosti poikkeuksen luokalla '%s', viestinä:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
|
|
msgid "%0:s%0:s In file '%1:s' at address %2:x"
|
|
msgstr "%0:s%0:s Tiedostossa '%1:s' osoitteessa %2:x"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d"
|
|
msgstr "%0:s%0:s Tiedostossa '%1:s' rivillä %2:d"
|
|
|
|
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
|
|
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
|
|
msgstr "%0:s%0:s Tiedostossa '%1:s' rivillä %2:d:%0:s%3:s"
|
|
|
|
#: lazarusidestrconsts.lisprojectsrcpath
|
|
msgid "Project Src Path"
|
|
msgstr "Projektin Src hakemisto"
|
|
|
|
#: lazarusidestrconsts.lisprojectunit
|
|
msgid "project unit"
|
|
msgstr "projektin käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisprojectunitpath
|
|
msgid "Project Unit Path"
|
|
msgstr "Projektin käännösyksikköjen polku"
|
|
|
|
#: lazarusidestrconsts.lisprojectwizard
|
|
msgid "Project Wizard"
|
|
msgstr "Projektin valinta"
|
|
|
|
#: lazarusidestrconsts.lisprojfiles
|
|
msgid "Files:"
|
|
msgstr "Tiedostot:"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
|
|
msgid "Confirm deleting dependency"
|
|
msgstr "Vahvista riippuvuuden poistaminen"
|
|
|
|
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
|
|
msgid "Confirm removing file"
|
|
msgstr "Vahvista tiedoston poistaminen"
|
|
|
|
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
|
|
msgid "Delete dependency for %s?"
|
|
msgstr "Poistetaanko riippuvuus %s :n ?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspprojectinspector
|
|
msgid "Project Inspector - %s"
|
|
msgstr "Projektinhallinta - %s"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
|
|
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
|
|
msgid "Removed required packages"
|
|
msgstr "Poistettuja tarvittavia paketteja"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremovefilefromproject
|
|
msgid "Remove file %s from project?"
|
|
msgstr "Poistetaanko tiedosto %s projektista?"
|
|
|
|
#: lazarusidestrconsts.lisprojinspremoveitemsf
|
|
msgid "Remove %s items from project?"
|
|
msgstr "Poista %s kohdat projektista?"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
|
|
msgid "Unable to read state file %s of project %s%sError: %s"
|
|
msgstr "Tilatiedon %s lukeminen projektille %s epäonnistui%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
|
|
msgid "Unable to write state file for project %s%sError: %s"
|
|
msgstr "Tilatiedon kirjoittaminen projektilta %s epäonnistui%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
|
|
msgid "Always build (even if nothing changed)"
|
|
msgstr "Kokoa aina kaikki (vaikka mikään ei muuttuisi)"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
|
|
msgid "May be needed if there is a bug in dependency check, normally not needed."
|
|
msgstr "Voidaan tarvita, jos riippuvuuksien tarkistuksessa on bugi, tavallisesti ei tarvita."
|
|
|
|
#: lazarusidestrconsts.lisprojoptserror
|
|
msgctxt "lazarusidestrconsts.lisprojoptserror"
|
|
msgid "Error"
|
|
msgstr "Virhe"
|
|
|
|
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
|
|
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
|
|
msgstr "Automaattisesti luotua lomakelistaa ohjelman lähdekoodissa ei voi muuttaa.%sKorjaa ensin virheet."
|
|
|
|
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
|
|
msgid "Project Source Directory Mark"
|
|
msgstr "Projektin lähdehakemiston merkki"
|
|
|
|
#: lazarusidestrconsts.lispromptforvalue
|
|
msgid "Prompt for value"
|
|
msgstr "Kysy arvoa"
|
|
|
|
#: lazarusidestrconsts.lisproperties
|
|
msgid "Properties (replace or remove)"
|
|
msgstr "Ominaisuudet (korvaa tai poista)"
|
|
|
|
#: lazarusidestrconsts.lisprotected
|
|
msgid "Protected"
|
|
msgstr "Suojattu"
|
|
|
|
#: lazarusidestrconsts.lisprotectedmethod
|
|
msgid "Protected Method"
|
|
msgstr "Protected-metodi"
|
|
|
|
#: lazarusidestrconsts.lispublicmethod
|
|
msgid "Public Method"
|
|
msgstr "Public-metodi"
|
|
|
|
#: lazarusidestrconsts.lispublishedmethod
|
|
msgid "Published Method"
|
|
msgstr "Published-metodi"
|
|
|
|
#: lazarusidestrconsts.lispublishprojdir
|
|
msgid "Publish project directory"
|
|
msgstr "Julkaistavan projektin hakemisto"
|
|
|
|
#: lazarusidestrconsts.lispublishproject
|
|
msgid "Publish Project"
|
|
msgstr "Julkaise projekti"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
|
|
msgid "Invalid exclude filter"
|
|
msgstr "Kelvoton poistosuodatin"
|
|
|
|
#: lazarusidestrconsts.lispublprojinvalidincludefilter
|
|
msgid "Invalid include filter"
|
|
msgstr "Kelvoton lisäyssuodatin"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
|
|
msgid "Save .lrs files in the output directory"
|
|
msgstr "Tallenna .lrs tiedostot käännöshakemistoon"
|
|
|
|
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
|
|
msgid "The resource will be available for FPC."
|
|
msgstr "Resurssi on FPC:n käytössä."
|
|
|
|
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
|
|
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
|
|
msgid "A Pascal unit must have the extension .pp or .pas"
|
|
msgstr "Pascal-käännösyksiköllä pitää olla liite .pp tai .pas"
|
|
|
|
#: lazarusidestrconsts.lispvueditvirtualunit
|
|
msgid "Edit virtual unit"
|
|
msgstr "Muokkaa virtuaalista käännösyksikköä"
|
|
|
|
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
|
|
msgid "There is already an unit with this name.%sFile: %s"
|
|
msgstr "Tämän niminen käännösyksikkö on jo olemassa.%sTiedosto: %s"
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
|
|
msgid "The unitname is not a valid Pascal identifier."
|
|
msgstr "Käännösyksikön nimi ei ole kelvollinen Pascal-tunniste."
|
|
|
|
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
|
|
msgid "The unitname is used when the IDE extends uses clauses"
|
|
msgstr "Käännösyksikön nimeä käytetään, kun Lazarus laajentaa uses-lauseketta."
|
|
|
|
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
|
|
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
|
|
msgstr "Käännösyksikön nimi ja tiedoston nimi eivät täsmää.%sEsim.: unit1.pas ja Unit1"
|
|
|
|
#: lazarusidestrconsts.lispwconvertproject
|
|
msgid "Convert &Delphi Project"
|
|
msgstr "Muunna &Delphi-projektista"
|
|
|
|
#: lazarusidestrconsts.lispwnewproject
|
|
msgid "&New Project"
|
|
msgstr "&Uusi projekti"
|
|
|
|
#: lazarusidestrconsts.lispwopenproject
|
|
msgid "&Open Project"
|
|
msgstr "&Avaa projekti"
|
|
|
|
#: lazarusidestrconsts.lispwopenrecentproject
|
|
msgid "Open &Recent Project"
|
|
msgstr "Avaa &edellinen projekti"
|
|
|
|
#: lazarusidestrconsts.lispwviewexampleprojects
|
|
msgid "View &Example Projects"
|
|
msgstr "Selaa &esimerkkiprojekteja"
|
|
|
|
#: lazarusidestrconsts.lisquickfixerror
|
|
msgid "QuickFix error"
|
|
msgstr "Nopean korjauksen virhe"
|
|
|
|
#: lazarusidestrconsts.lisquickfixes
|
|
msgid "Quick fixes"
|
|
msgstr "Nopeat korjaukset"
|
|
|
|
#: lazarusidestrconsts.lisquickfixremoveunit
|
|
msgid "Quick fix: Remove unit"
|
|
msgstr "Nopea korjaus: poista käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisquickfixsearchidentifier
|
|
msgid "Search identifier"
|
|
msgstr "Etsi tunnistetta"
|
|
|
|
#: lazarusidestrconsts.lisquit
|
|
msgctxt "lazarusidestrconsts.lisquit"
|
|
msgid "Quit"
|
|
msgstr "Poistu"
|
|
|
|
#: lazarusidestrconsts.lisquitlazarus
|
|
msgid "&Quit Lazarus"
|
|
msgstr "&Poistu Lazaruksesta"
|
|
|
|
#: lazarusidestrconsts.lisrange
|
|
msgctxt "lazarusidestrconsts.lisrange"
|
|
msgid "Range"
|
|
msgstr "Alue"
|
|
|
|
#: lazarusidestrconsts.lisreaderror
|
|
msgid "Read Error"
|
|
msgstr "Lukuvirhe"
|
|
|
|
#: lazarusidestrconsts.lisreallydelete
|
|
msgid "Really delete?"
|
|
msgstr "Poistetaanko todella?"
|
|
|
|
#: lazarusidestrconsts.lisrecenttabs
|
|
msgid "Recent tabs"
|
|
msgstr "Edelliset välilehdet"
|
|
|
|
#: lazarusidestrconsts.lisrecord
|
|
msgctxt "lazarusidestrconsts.lisrecord"
|
|
msgid "Record"
|
|
msgstr "Nauhoita"
|
|
|
|
#: lazarusidestrconsts.lisrecordedmacros
|
|
msgid "Recorded"
|
|
msgstr "Nauhoitettu"
|
|
|
|
#: lazarusidestrconsts.lisrecordstruct
|
|
msgid "Record/Structure"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisredo
|
|
msgid "Redo"
|
|
msgstr "Tee uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisregisters
|
|
msgctxt "lazarusidestrconsts.lisregisters"
|
|
msgid "Registers"
|
|
msgstr "Rekisterit"
|
|
|
|
#: lazarusidestrconsts.lisregularexpression
|
|
msgid "Regular expression"
|
|
msgstr "Säännöllinen lauseke"
|
|
|
|
#: lazarusidestrconsts.lisrelative
|
|
msgid "Relative"
|
|
msgstr "Suhteellinen"
|
|
|
|
#: lazarusidestrconsts.lisrelativepaths
|
|
msgid "Relative paths"
|
|
msgstr "Suhteelliset hakupolut"
|
|
|
|
#: lazarusidestrconsts.lisremove
|
|
msgctxt "lazarusidestrconsts.lisremove"
|
|
msgid "Remove"
|
|
msgstr "Poista"
|
|
|
|
#: lazarusidestrconsts.lisremove2
|
|
msgid "Remove?"
|
|
msgstr "Poista?"
|
|
|
|
#: lazarusidestrconsts.lisremoveallinvalidproperties
|
|
msgid "Remove all invalid properties"
|
|
msgstr "Poista kaikki kelvottomat ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.lisremoveallmessagetypefilters
|
|
msgid "Remove all message type filters"
|
|
msgstr "Poista kaikki viestityyppien suodattimet"
|
|
|
|
#: lazarusidestrconsts.lisremoveallunits
|
|
msgid "Remove all units"
|
|
msgstr "Poista kaikki käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
|
|
msgid "Remove Compiler Option Hide Message"
|
|
msgstr "Poista kääntäjän valinta piilota viesti"
|
|
|
|
#: lazarusidestrconsts.lisremovedependenciesfrompackage
|
|
msgid "Remove %s dependencies from package \"%s\"?"
|
|
msgstr "Poista %s riippuvuutta paketista \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovedpropertys
|
|
msgid "Removed property \"%s\"."
|
|
msgstr "Poistettiin ominaisuus \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisremovefilesfrompackage
|
|
msgid "Remove %s files from package \"%s\"?"
|
|
msgstr "Poista %s tiedostoa paketista \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisremovefrominstalllist
|
|
msgid "Remove from install list"
|
|
msgstr "Poistetaan asennuksesta"
|
|
|
|
#: lazarusidestrconsts.lisremovefromproject
|
|
msgid "Remove from Project"
|
|
msgstr "Poista projektista"
|
|
|
|
#: lazarusidestrconsts.lisremovefromsearchpath
|
|
msgid "Remove from search path"
|
|
msgstr "Poista hakupolusta"
|
|
|
|
#: lazarusidestrconsts.lisremoveincludepath
|
|
msgid "Remove include path?"
|
|
msgstr "Poistetaanko include polku?"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable
|
|
msgid "Remove local variable %s"
|
|
msgstr "Poista paikallinen muuttuja %s"
|
|
|
|
#: lazarusidestrconsts.lisremovelocalvariable3
|
|
msgid "Remove local variable \"%s\""
|
|
msgstr "Poista paikallinen muuttuja \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisremovemessagetypefilter
|
|
msgid "Remove Message Type Filter"
|
|
msgstr "Poista viestityyppien suodatin"
|
|
|
|
#: lazarusidestrconsts.lisremovenonexistingfiles
|
|
msgid "Remove nonexistent files"
|
|
msgstr "Poista olemattomat tiedostot"
|
|
|
|
#: lazarusidestrconsts.lisremoveselectedunits
|
|
msgid "Remove selected units"
|
|
msgstr "Poista valitut käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisremovethem
|
|
msgid "Remove them"
|
|
msgstr "Poista ne"
|
|
|
|
#: lazarusidestrconsts.lisremovethepathsfromothersources
|
|
msgid "Remove the paths from \"Other sources\""
|
|
msgstr "Poista polut kohdasta \"Muut lähdekoodit\""
|
|
|
|
#: lazarusidestrconsts.lisremoveunitpath
|
|
msgid "Remove unit path?"
|
|
msgstr "Poista käännösyksikön polku?"
|
|
|
|
#: lazarusidestrconsts.lisremoveuses
|
|
msgid "Remove uses \"%s\""
|
|
msgstr "Poista uses \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisrename
|
|
msgid "Rename"
|
|
msgstr "Nimeä uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisrename2
|
|
msgid "Rename ..."
|
|
msgstr "Nimeä uudelleen ..."
|
|
|
|
#: lazarusidestrconsts.lisrenamefile
|
|
msgid "Rename file?"
|
|
msgstr "Muutetaanko tiedoston nimi?"
|
|
|
|
#: lazarusidestrconsts.lisrenamefilefailed
|
|
msgid "Rename file failed"
|
|
msgstr "Tiedoston uudelleennimeäminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisrenameshowresult
|
|
msgid "Show list of renamed Identifiers"
|
|
msgstr "Näytä uudelleen nimetyt tunnisteet"
|
|
|
|
#: lazarusidestrconsts.lisrenameto
|
|
msgid "Rename to %s"
|
|
msgstr "Nimeä %s:ksi"
|
|
|
|
#: lazarusidestrconsts.lisrenametolowercase
|
|
msgid "Rename to lowercase"
|
|
msgstr "Vaihda nimi pieniksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lisreopenproject
|
|
msgid "Reopen project"
|
|
msgstr "Avaa projekti uudestaan"
|
|
|
|
#: lazarusidestrconsts.lisreopenwithanotherencoding
|
|
msgid "Reopen with another encoding"
|
|
msgstr "Avaa uudestaan toisella merkkikoodauksella"
|
|
|
|
#: lazarusidestrconsts.lisrepeat
|
|
msgctxt "lazarusidestrconsts.lisrepeat"
|
|
msgid "Repeat"
|
|
msgstr "Toistoja"
|
|
|
|
#: lazarusidestrconsts.lisrepeatcount
|
|
msgid "Repeat Count:"
|
|
msgstr "Toistojen määrä:"
|
|
|
|
#: lazarusidestrconsts.lisreplace
|
|
msgid "Replace"
|
|
msgstr "Korvaa"
|
|
|
|
#: lazarusidestrconsts.lisreplacedpropertyswiths
|
|
msgid "Replaced property \"%s\" with \"%s\"."
|
|
msgstr "Korvattiin ominaisuus \"%s\" \"%s\":lla."
|
|
|
|
#: lazarusidestrconsts.lisreplacedtypeswiths
|
|
msgid "Replaced type \"%s\" with \"%s\"."
|
|
msgstr "Korvattiin tyyppi \"%s\" \"%s\":lla."
|
|
|
|
#: lazarusidestrconsts.lisreplacement
|
|
msgid "Replacement"
|
|
msgstr "Korvaus"
|
|
|
|
#: lazarusidestrconsts.lisreplacementfuncs
|
|
msgid "Replacement functions"
|
|
msgstr "Korvaavat funktiot"
|
|
|
|
#: lazarusidestrconsts.lisreplacements
|
|
msgid "Replacements"
|
|
msgstr "Korvaukset"
|
|
|
|
#: lazarusidestrconsts.lisreplaceremoveunknown
|
|
msgid "Fix unknown properties and types"
|
|
msgstr "Korjaa tuntemattomat ominaisuudet ja tyypit"
|
|
|
|
#: lazarusidestrconsts.lisreplacewholeidentifier
|
|
msgid "Replace whole identifier"
|
|
msgstr "Korvaa koko tunniste"
|
|
|
|
#: lazarusidestrconsts.lisreplacingselectionfailed
|
|
msgid "Replacing selection failed."
|
|
msgstr "Valinnan korvaaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisreportingbugurl
|
|
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisrescan
|
|
msgid "Rescan"
|
|
msgstr "Lue uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisreset
|
|
msgid "Reset"
|
|
msgstr "Nollaa"
|
|
|
|
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
|
|
msgid "Reset all file filters to defaults?"
|
|
msgstr "Asetetaanko kaikki tiedostosuotimet oletusarvoonsa?"
|
|
|
|
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
|
|
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
|
|
msgstr "Asetetaanko valittujen komponenttien Left, Top, Width, Height periytyviin arvoihin?"
|
|
|
|
#: lazarusidestrconsts.lisresourcenamemustbeunique
|
|
msgid "Resource name must be unique."
|
|
msgstr "Resurssin nimen pitää olla yksilöllinen."
|
|
|
|
#: lazarusidestrconsts.lisresourcesaveerror
|
|
msgid "Resource save error"
|
|
msgstr "Resurssin talletusvirhe"
|
|
|
|
#: lazarusidestrconsts.lisresourcetypeofnewfiles
|
|
msgid "Resource type of project"
|
|
msgstr "Projektin resurssin tyyppi"
|
|
|
|
#: lazarusidestrconsts.lisrestart
|
|
msgctxt "lazarusidestrconsts.lisrestart"
|
|
msgid "Restart"
|
|
msgstr "Käynnistä Lazarus uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisresult2
|
|
msgid "Result:"
|
|
msgstr "Paluuarvo:"
|
|
|
|
#: lazarusidestrconsts.lisreturnparameterindexedword
|
|
msgid ""
|
|
"Return parameter-indexed word from the current line preceding cursor position.\n"
|
|
"\n"
|
|
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
|
|
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
|
|
"is always the current macro.\n"
|
|
"\n"
|
|
"Example line:\n"
|
|
"i 0 count-1 forb|\n"
|
|
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
|
|
"\n"
|
|
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
|
|
msgid ""
|
|
"Return the list of all values of case variable in front of variable.\n"
|
|
"\n"
|
|
"Optional Parameters (comma separated):\n"
|
|
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
|
|
msgstr ""
|
|
"Palauta kaikki case-muuttujan arvot muuttujan edessä.\n"
|
|
"\n"
|
|
"Vaihtoehtoiset Parametrit (pilkku erottaa):\n"
|
|
"WithoutExtraIndent // case-lista luodaan ilman sisennystä\n"
|
|
|
|
#: lazarusidestrconsts.lisrevertfailed
|
|
msgid "Revert failed"
|
|
msgstr "Palauttaminen epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lisright
|
|
msgctxt "lazarusidestrconsts.lisright"
|
|
msgid "Right"
|
|
msgstr "Oikea"
|
|
|
|
#: lazarusidestrconsts.lisrightanchoring
|
|
msgid "Right anchoring"
|
|
msgstr "Oikean reunan ankkurointi"
|
|
|
|
#: lazarusidestrconsts.lisrightborderspacespinedithint
|
|
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
|
|
msgstr "Oikea reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen."
|
|
|
|
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Tämä on naapurikontrolli, mihin oikea reuna on ankkuroitu. Tyhjä tarkoittaa ankkurointia Delphi-tyyliin (BorderSpacing and ReferenceSide eivät vaikuta)."
|
|
|
|
#: lazarusidestrconsts.lisrightsides
|
|
msgid "Right sides"
|
|
msgstr "Oikeat reunat"
|
|
|
|
#: lazarusidestrconsts.lisrightspaceequally
|
|
msgid "Right space equally"
|
|
msgstr "Tasaa välit oikealla"
|
|
|
|
#: lazarusidestrconsts.lisroot
|
|
msgid "Root"
|
|
msgstr "Juuri"
|
|
|
|
#: lazarusidestrconsts.lisrootdirectory
|
|
msgid "Root Directory"
|
|
msgstr "Juurihakemisto"
|
|
|
|
#: lazarusidestrconsts.lisrun
|
|
msgctxt "lazarusidestrconsts.lisrun"
|
|
msgid "Run"
|
|
msgstr "Suorita"
|
|
|
|
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
|
|
msgid "\"Run and Design time\" packages have no limitations."
|
|
msgstr "\"Ajo- ja suunnittelu-\" paketilla ei ole rajoituksia."
|
|
|
|
#: lazarusidestrconsts.lisrunbuttonhint
|
|
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
|
|
msgid "Run"
|
|
msgstr "Suorita"
|
|
|
|
#: lazarusidestrconsts.lisrunning
|
|
msgid "%s (running ...)"
|
|
msgstr "%s (suorittaa ...)"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
|
|
msgid "File not executable"
|
|
msgstr "Tiedosto ei ole suoritettava"
|
|
|
|
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
|
|
msgid "The host application \"%s\" is not executable."
|
|
msgstr "Isäntäohjelma \"%s\" ei ole suoritettava."
|
|
|
|
#: lazarusidestrconsts.lisrunstage
|
|
msgctxt "lazarusidestrconsts.lisrunstage"
|
|
msgid "Run"
|
|
msgstr "Suorita"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
|
|
msgid "Runtime only, cannot be installed in IDE"
|
|
msgstr "Vain ajonaikainen, ei voida asentaa IDE:en"
|
|
|
|
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
|
|
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
|
|
msgstr "\"Vain Ajo-\" paketit ovat vain projekteille. Niitä ei voi asentaa IDE:en, ei edes epäsuorasti."
|
|
|
|
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
|
|
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
|
|
msgstr "\"Ajo-\" paketit ovat projekteille. Niitä ei voi asentaa IDE:en, paitsi jos joku suunnittelu-paketti riippuu niistä."
|
|
|
|
#: lazarusidestrconsts.lisruntofailed
|
|
msgid "Run-to failed"
|
|
msgstr "Run-to epäonnistui"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
|
|
msgid "Abstract Methods - not yet overridden"
|
|
msgstr "Abstraktit methodit - ei vielä syrjäytetty"
|
|
|
|
#: lazarusidestrconsts.lissamabstractmethodsof
|
|
msgid "Abstract methods of %s"
|
|
msgstr "%s:n abstraktit methodit"
|
|
|
|
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
|
|
msgid "Cursor is not in a class declaration"
|
|
msgstr "Kursori ei ole luokan määrittelyssä"
|
|
|
|
#: lazarusidestrconsts.lissamideisbusy
|
|
msgid "IDE is busy"
|
|
msgstr "IDE:llä on kiire"
|
|
|
|
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
|
|
msgid "%s is an abstract class, it has %s abstract methods."
|
|
msgstr "%s on abstrakti luokka, sillä on %s abstraktia methodia."
|
|
|
|
#: lazarusidestrconsts.lissamnoabstractmethodsfound
|
|
msgid "No abstract methods found"
|
|
msgstr "Abstrakteja metodeja ei löydy"
|
|
|
|
#: lazarusidestrconsts.lissamoverrideallselected
|
|
msgid "Override all selected"
|
|
msgstr "Syrjäytä kaikki valitut"
|
|
|
|
#: lazarusidestrconsts.lissamoverridefirstselected
|
|
msgid "Override first selected"
|
|
msgstr "Syrjäytä ensimmäinen valittu"
|
|
|
|
#: lazarusidestrconsts.lissamselectnone
|
|
msgid "Select none"
|
|
msgstr "Valinta pois"
|
|
|
|
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
|
|
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
|
|
msgstr "Löytyi %s abstraktia metodia syrjäytettäväksi.%sValitse ne, joihin tahdot luoda koodirungon:"
|
|
|
|
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
|
|
msgid "There are no abstract methods left to override."
|
|
msgstr "Ei löydy enempää abstrakteja metodeja syrjäytettäväksi."
|
|
|
|
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
|
|
msgid "This method can not be overridden because it is defined in the current class"
|
|
msgstr "Tätä metodia ei voi syrjäyttää, koska se on määritelty nykyisessä luokassa"
|
|
|
|
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
|
|
msgid "Unable to show abstract methods of the current class, because"
|
|
msgstr "Tämän luokan abstrakteja metodeja ei voi näyttää, koska"
|
|
|
|
#: lazarusidestrconsts.lissave
|
|
msgctxt "lazarusidestrconsts.lissave"
|
|
msgid "Save"
|
|
msgstr "Tallenna"
|
|
|
|
#: lazarusidestrconsts.lissaveall
|
|
msgctxt "lazarusidestrconsts.lissaveall"
|
|
msgid "Save All"
|
|
msgstr "Tallenna kaikki"
|
|
|
|
#: lazarusidestrconsts.lissaveallchecked
|
|
msgid "Save All Checked"
|
|
msgstr "Tallenna kaikki ruksatut"
|
|
|
|
#: lazarusidestrconsts.lissaveallmodified
|
|
msgid "Save all modified files"
|
|
msgstr "Tallenna kaikki muuttuneet tiedostot"
|
|
|
|
#: lazarusidestrconsts.lissavealloriginalmessagestofile
|
|
msgid "Save All/Original Messages to File ..."
|
|
msgstr "Tallenna kaikki/alkuperäiset viestit tiedostoon ..."
|
|
|
|
#: lazarusidestrconsts.lissaveandexitdialog
|
|
msgid "Save and exit dialog"
|
|
msgstr "Tallenna ja poistu"
|
|
|
|
#: lazarusidestrconsts.lissaveandrebuildide
|
|
msgid "Save and rebuild IDE"
|
|
msgstr "Tallenna ja kokoa uudelleen"
|
|
|
|
#: lazarusidestrconsts.lissaveas
|
|
msgctxt "lazarusidestrconsts.lissaveas"
|
|
msgid "Save As"
|
|
msgstr "Tallenna nimellä"
|
|
|
|
#: lazarusidestrconsts.lissavechangedfiles
|
|
msgid "Save changed files?"
|
|
msgstr "Tallenna muuttuneet tiedostot?"
|
|
|
|
#: lazarusidestrconsts.lissavechanges
|
|
msgid "Save changes?"
|
|
msgstr "Tallennetaanko muutokset?"
|
|
|
|
#: lazarusidestrconsts.lissavechangestoproject
|
|
msgid "Save changes to project %s?"
|
|
msgstr "Tallennetaanko %s -projektiin tehdyt muutokset?"
|
|
|
|
#: lazarusidestrconsts.lissavecurrenteditorfile
|
|
msgid "Save current editor file"
|
|
msgstr "Tallenna nykyinen editorin tiedosto"
|
|
|
|
#: lazarusidestrconsts.lissavedwithidesettings
|
|
msgid "Saved with IDE settings"
|
|
msgstr "Tallennettu IDE:n asetusten kanssa"
|
|
|
|
#: lazarusidestrconsts.lissavedwithprojectsession
|
|
msgid "Saved with project session"
|
|
msgstr "Tallennettu projektin istunnon kanssa"
|
|
|
|
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
|
|
msgid "Save editor info of non project files"
|
|
msgstr "Tallenna editorin tiedot projektiin kuulumattomista tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lissavefileas
|
|
msgid "Save file as"
|
|
msgstr "Tallenna tiedosto nimellä"
|
|
|
|
#: lazarusidestrconsts.lissavefilebeforeclosingform
|
|
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
|
|
msgstr "Tallennetaanko tiedosto \"%s\"%sennenkuin suljetaan lomake \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
|
|
msgid "Save info of closed editor files"
|
|
msgstr "Tallenna editorin tiedot suljetuista tiedostoista"
|
|
|
|
#: lazarusidestrconsts.lissavemacroas
|
|
msgid "Save macro as"
|
|
msgstr "Tallenna makro nimellä"
|
|
|
|
#: lazarusidestrconsts.lissavemessages
|
|
msgid "Save messages"
|
|
msgstr "Tallenna viestit"
|
|
|
|
#: lazarusidestrconsts.lissaveproject
|
|
msgid "Save project %s (*%s)"
|
|
msgstr "Tallenna projekti %s (*%s)"
|
|
|
|
#: lazarusidestrconsts.lissavesessionchangestoproject
|
|
msgid "Save session changes to project %s?"
|
|
msgstr "Tallenna istunnon muutokset projektiin %s?"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstate
|
|
msgid "Save fold info"
|
|
msgstr "Tallenna laskostustieto"
|
|
|
|
#: lazarusidestrconsts.lissavesessionfoldstatehint
|
|
msgid "Code editor supports folding (temporarily hiding) blocks of code."
|
|
msgstr "Koodieditori tukee koodin lohkojen laskostusta (tilapäistä piilottamista)."
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistory
|
|
msgid "Save jump history"
|
|
msgstr "Tallenna hyppyhistoria"
|
|
|
|
#: lazarusidestrconsts.lissavesessionjumphistoryhint
|
|
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
|
|
msgstr "Ctrl-Click tunnisteen päällä koodieditorissa tallentuu hyppyhistoriaan."
|
|
|
|
#: lazarusidestrconsts.lissavesettings
|
|
msgid "Save Settings"
|
|
msgstr "Tallenna asetukset"
|
|
|
|
#: lazarusidestrconsts.lissaveshownmessagestofile
|
|
msgid "Save Shown Messages to File ..."
|
|
msgstr "Tallenna näkyvät viestit tiedostoon ..."
|
|
|
|
#: lazarusidestrconsts.lissavespace
|
|
msgid "Save "
|
|
msgstr "Tallenna "
|
|
|
|
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
|
|
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
|
|
msgstr "Tiedoston \"%s\" tallennus nimellä \"%s\" hävittää merkkejä rivillä %s, sarakkeessa %s."
|
|
|
|
#: lazarusidestrconsts.lisscalingfactor
|
|
msgid "Scaling factor:"
|
|
msgstr "Skaalauskerroin:"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdir
|
|
msgid "Scan files in parent directory"
|
|
msgstr "Tutki tiedostot emohakemistossa"
|
|
|
|
#: lazarusidestrconsts.lisscanfilesinparentdirhint
|
|
msgid "Search for source files in sibling directories (parent directory and its children)"
|
|
msgstr "Etsi lähdekoodit sisarus-hakemistoissa (emohakemisto ja sen lapset)"
|
|
|
|
#: lazarusidestrconsts.lisscanning
|
|
msgid "Scanning"
|
|
msgstr "Tutkii"
|
|
|
|
#: lazarusidestrconsts.lisscanning2
|
|
msgid "%s. Scanning ..."
|
|
msgstr "%s. Tutkii ..."
|
|
|
|
#: lazarusidestrconsts.lisscanparentdir
|
|
msgid "Scanning parent directory"
|
|
msgstr "Tutkii emohakemistoa"
|
|
|
|
#: lazarusidestrconsts.lissearchpaths2
|
|
msgid "Search paths"
|
|
msgstr "Etsi polkuja"
|
|
|
|
#: lazarusidestrconsts.lissearchunit
|
|
msgid "Search Unit \"%s\""
|
|
msgstr "Etsi käännösyksikköä \"%s\""
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
|
|
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
|
|
msgstr "Toinen asetushakemisto, mistä Lazarus etsii asetusten malleja. Oletus on "
|
|
|
|
#: lazarusidestrconsts.lissecondaryconfigpath
|
|
msgid "Secondary config path"
|
|
msgstr "Toinen asetuspolku"
|
|
|
|
#: lazarusidestrconsts.lissecondtest
|
|
msgid "&Second test"
|
|
msgstr "Toinen polku"
|
|
|
|
#: lazarusidestrconsts.lisseemessages
|
|
msgid "See messages."
|
|
msgstr "Katso \"Kääntäjän viestit \" -ikkunaa"
|
|
|
|
#: lazarusidestrconsts.lisseeprojectprojectinspector
|
|
msgid "%sSee Project -> Project Inspector"
|
|
msgstr "%sKatso Projekti -> Projektinhallinta"
|
|
|
|
#: lazarusidestrconsts.lisselectahelpitem
|
|
msgid "Select a help item:"
|
|
msgstr "Valitse jokin kohta seuraavista:"
|
|
|
|
#: lazarusidestrconsts.lisselectanode
|
|
msgid "Select a node"
|
|
msgstr "Valitse solmu"
|
|
|
|
#: lazarusidestrconsts.lisselectanotherlclwidgetset
|
|
msgid "Select another LCL widgetset (macro LCLWidgetType)"
|
|
msgstr "Valitse toinen LCL widgetset (makro LCLWidgetType)"
|
|
|
|
#: lazarusidestrconsts.lisselectdfmfiles
|
|
msgid "Select Delphi form files (*.dfm)"
|
|
msgstr "Valitse Delphi form (lomake) tiedosto (*.dfm)"
|
|
|
|
#: lazarusidestrconsts.lisselected
|
|
msgid "Selected"
|
|
msgstr "Valittu"
|
|
|
|
#: lazarusidestrconsts.lisselectedaddition
|
|
msgid "Selected addition:"
|
|
msgstr "Valittu lisäys:"
|
|
|
|
#: lazarusidestrconsts.lisselectedandchildcontrols
|
|
msgid "Selected and child controls"
|
|
msgstr "Valitut ja lapsikontrollit"
|
|
|
|
#: lazarusidestrconsts.lisselectedbottomneighbour
|
|
msgid "(selected bottom neighbour)"
|
|
msgstr "(valittu alapuolen naapuri)"
|
|
|
|
#: lazarusidestrconsts.lisselectedcommandsmapping
|
|
msgid "Selected Command's Mapping"
|
|
msgstr "Valitun komennon kartta"
|
|
|
|
#: lazarusidestrconsts.lisselectedforinstallation
|
|
msgid "selected for installation"
|
|
msgstr "valittu asennettavaksi"
|
|
|
|
#: lazarusidestrconsts.lisselectedforuninstallation
|
|
msgid "selected for uninstallation"
|
|
msgstr "asennus valittu poistettavaksi"
|
|
|
|
#: lazarusidestrconsts.lisselectedleftneighbour
|
|
msgid "(selected left neighbour)"
|
|
msgstr "(valittu vasen naapuri)"
|
|
|
|
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
|
|
msgid "Selected message in messages window:"
|
|
msgstr "Valittu viesti viesti-ikkunassa:"
|
|
|
|
#: lazarusidestrconsts.lisselectedmodeswerebuilt
|
|
msgid "Selected %d modes were successfully built."
|
|
msgstr "Valitut %d moodia koottiin onnistuneesti."
|
|
|
|
#: lazarusidestrconsts.lisselectedrightneighbour
|
|
msgid "(selected right neighbour)"
|
|
msgstr "(valittu oikea naapuri)"
|
|
|
|
#: lazarusidestrconsts.lisselectedtopneighbour
|
|
msgid "(selected top neighbour)"
|
|
msgstr "(valittu yläpuolen naapuri)"
|
|
|
|
#: lazarusidestrconsts.lisselectfile
|
|
msgid "Select the file"
|
|
msgstr "Valitse tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisselectfpcsourcedirectory
|
|
msgid "Select FPC source directory"
|
|
msgstr "Valitse FPC lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lisselectframe
|
|
msgid "Select Frame"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisselectionexceedsstringconstant
|
|
msgid "Selection exceeds string constant"
|
|
msgstr "Valinta ylittää merkkijonovakion"
|
|
|
|
#: lazarusidestrconsts.lisselectiontool
|
|
msgid "Selection tool"
|
|
msgstr "Valintatyökalu"
|
|
|
|
#: lazarusidestrconsts.lisselectlazarussourcedirectory
|
|
msgid "Select Lazarus source directory"
|
|
msgstr "Valitse Lazaruksen lähdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lisselectpathto
|
|
msgid "Select path to %s"
|
|
msgstr "Valitse polku %s:lle"
|
|
|
|
#: lazarusidestrconsts.lisselecttargetdirectory
|
|
msgid "Select target directory"
|
|
msgstr "Valitse kohdehakemisto"
|
|
|
|
#: lazarusidestrconsts.lissetallcolors
|
|
msgid "Set all colors:"
|
|
msgstr "Aseta kaikki värit:"
|
|
|
|
#: lazarusidestrconsts.lissetdefault
|
|
msgid "Set default"
|
|
msgstr "Aseta oletus"
|
|
|
|
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
|
|
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
|
|
msgstr "Tämän avulla voidaan kääntäjän viestit kääntää toiselle kielelle (siis ei englanti). Esimerkiksi: Suomi: $(FPCSrcDir)/compiler/msg/errorfi.msg."
|
|
|
|
#: lazarusidestrconsts.lissetupdefaultindentation
|
|
msgid "(Set up default indentation)"
|
|
msgstr "(Aseta oletus sisennys)"
|
|
|
|
#: lazarusidestrconsts.lisshort
|
|
msgid "Short:"
|
|
msgstr "Lyhyt:"
|
|
|
|
#: lazarusidestrconsts.lisshortnopath
|
|
msgid "Short, no path"
|
|
msgstr "Lyhyt, ei polkua"
|
|
|
|
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
|
|
msgid "Should the component \"%s\" be auto created when the application starts?"
|
|
msgstr "Pitääkö komponentti \"%s\" luoda automaattisesti kun ohjelma käynnistyy?"
|
|
|
|
#: lazarusidestrconsts.lisshow
|
|
msgid "Show"
|
|
msgstr "Näytä"
|
|
|
|
#: lazarusidestrconsts.lisshowabstractmethodsof
|
|
msgid "Show abstract methods of \"%s\""
|
|
msgstr "Näytä \"%s\":n abstraktit metodit"
|
|
|
|
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
|
|
msgid "Show component tree"
|
|
msgstr "Näytä komponenttipuu"
|
|
|
|
#: lazarusidestrconsts.lisshowconsole
|
|
msgid "Show console"
|
|
msgstr "Näytä konsoli"
|
|
|
|
#: lazarusidestrconsts.lisshowdeclarationhints
|
|
msgid "Show declaration hints"
|
|
msgstr "Näytä määritysten vihjeet"
|
|
|
|
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
|
|
msgid "Show differences between modes ..."
|
|
msgstr "Näytä erot moodien välillä ..."
|
|
|
|
#: lazarusidestrconsts.lisshowemptyunitspackages
|
|
msgid "Show empty units/packages"
|
|
msgstr "Näytä tyhjät käännösyksiköt/paketit"
|
|
|
|
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
|
|
msgid "Show FPC message \"lines compiled\""
|
|
msgstr "Näytä FPC viesti \"rivejä käännetty\""
|
|
|
|
#: lazarusidestrconsts.lisshowglyphsfor
|
|
msgid "Show Glyphs for"
|
|
msgstr "Näytä kuvakkeet"
|
|
|
|
#: lazarusidestrconsts.lisshowgutterinobjectinspector
|
|
msgid "Show gutter"
|
|
msgstr "Näytä reunapalkki"
|
|
|
|
#: lazarusidestrconsts.lisshowhelp
|
|
msgid "Show help"
|
|
msgstr "Näytä ohje"
|
|
|
|
#: lazarusidestrconsts.lisshowhintsinobjectinspector
|
|
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
|
|
msgid "Show hints"
|
|
msgstr "Näytä vihjeet"
|
|
|
|
#: lazarusidestrconsts.lisshowidentifiers
|
|
msgid "Show identifiers"
|
|
msgstr "Näytä tunnisteet"
|
|
|
|
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
|
|
msgid "Show information box"
|
|
msgstr "Näytä lisätieto-osa"
|
|
|
|
#: lazarusidestrconsts.lisshowmessagetypeid
|
|
msgid "Show Message Type ID"
|
|
msgstr "Näytä viestin tyyppi ID"
|
|
|
|
#: lazarusidestrconsts.lisshowonlymodified
|
|
msgid "Show only modified"
|
|
msgstr "Näytä vain muutetut"
|
|
|
|
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
|
|
msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
|
|
msgstr "Näytä vain yksi nappi tehtäväpalkissa koko IDE:lle, ei siis nappi / ikkuna. Jotkin Linux ikkunamanagerit kuten Cinnamon eivät tue tätä ja näyttävät aina napin joka ikkunaa kohti."
|
|
|
|
#: lazarusidestrconsts.lisshowoutput
|
|
msgid "Show output"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisshowoverviewgutter
|
|
msgid "Show overview Gutter"
|
|
msgstr "Näytä yleiskuva-reunapalkki "
|
|
|
|
#: lazarusidestrconsts.lisshowpackages
|
|
msgid "Show packages"
|
|
msgstr "Näytä paketit"
|
|
|
|
#: lazarusidestrconsts.lisshowpositionofsourceeditor
|
|
msgid "Show position of source editor"
|
|
msgstr "Näytä koodieditorin sijainti"
|
|
|
|
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
|
|
msgid "Show recently used identifiers at top"
|
|
msgstr "Näytä äskettäin käytetyt tunnisteet ylhäällä"
|
|
|
|
#: lazarusidestrconsts.lisshowrelativepaths
|
|
msgid "Show relative paths"
|
|
msgstr "Näytä suhteelliset polut"
|
|
|
|
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
|
|
msgid "Shows all controls in tree hierarchy."
|
|
msgstr "Näytä kaikki kontrollit puu-rakenteessa."
|
|
|
|
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
|
|
msgid "A box at the bottom shows description for the selected property."
|
|
msgstr "Laatikko alhaalla näyttää valitun ominaisuuden selityksen."
|
|
|
|
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
|
|
msgid "Show setup dialog for most important settings"
|
|
msgstr "Näytä asetusikkuna tärkeimmille asetuksille"
|
|
|
|
#: lazarusidestrconsts.lisshowspecialcharacters
|
|
msgid "Show special characters"
|
|
msgstr "Näytä erikoismerkit"
|
|
|
|
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
|
|
msgid "Show statusbar"
|
|
msgstr "Näytä statuspalkki"
|
|
|
|
#: lazarusidestrconsts.lisshowunits
|
|
msgid "Show units"
|
|
msgstr "Näytä käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitialization
|
|
msgid "Show units with initialization/finalization sections"
|
|
msgstr "Näytä käännösyksiköt, missä initialization/finalization lohkot"
|
|
|
|
#: lazarusidestrconsts.lisshowunitswithinitializationhint
|
|
msgid "These units may initialize global data used by the program/application. Remove with care."
|
|
msgstr "Nämä käännösyksiköt voivat alustaa ohjelman käyttämiä julkisia muuttujia. Poista varoen."
|
|
|
|
#: lazarusidestrconsts.lisshowunusedunits
|
|
msgid "Show unused units ..."
|
|
msgstr "Näytä käyttämättömät käännösyksiköt ..."
|
|
|
|
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
|
|
msgid "Show value hints while debugging"
|
|
msgstr "Näytä arvot vihjeinä debuggaus-tilassa"
|
|
|
|
#: lazarusidestrconsts.lisshowversionandexit
|
|
msgid "show version and exit"
|
|
msgstr "näytä versio ja poistu"
|
|
|
|
#: lazarusidestrconsts.lisshrinktosmal
|
|
msgid "Shrink to smallest"
|
|
msgstr "Kutista pienimpään"
|
|
|
|
#: lazarusidestrconsts.lissibling
|
|
msgid "Sibling"
|
|
msgstr "Sisarus"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogram
|
|
msgid "Simple Program"
|
|
msgstr "Yksinkertainen ohjelma"
|
|
|
|
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
|
|
msgid "A most simple Free Pascal command line program."
|
|
msgstr "Yksinkertaisin mahdollinen Free Pascal -komentoriviohjelma"
|
|
|
|
#: lazarusidestrconsts.lissimplesyntax
|
|
msgid "Simple syntax"
|
|
msgstr "Yksinkertainen kielioppi"
|
|
|
|
#: lazarusidestrconsts.lisskiperrors
|
|
msgid "Skip errors"
|
|
msgstr "Ohita virheet"
|
|
|
|
#: lazarusidestrconsts.lisskipfile
|
|
msgid "Skip file"
|
|
msgstr "Ohita tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisskipfileandcontinueloading
|
|
msgid "Skip file and continue loading"
|
|
msgstr "Ohita tiedosto ja jatka lataamista"
|
|
|
|
#: lazarusidestrconsts.lisskiploadinglastproject
|
|
msgid "Skip loading last project"
|
|
msgstr "Ohita viime projektin lataaminen"
|
|
|
|
#: lazarusidestrconsts.lisskipthesewarnings
|
|
msgid "Skip these warnings"
|
|
msgstr "Ohita nämä varoitukset"
|
|
|
|
#: lazarusidestrconsts.lisslowerbutmoreaccurate
|
|
msgid "Slower but more accurate."
|
|
msgstr "Hitaampi mutta tarkempi."
|
|
|
|
#: lazarusidestrconsts.lissmallerratherthanfaster
|
|
msgid "Smaller rather than faster"
|
|
msgstr "Mieluummin pienempi kuin nopeampi"
|
|
|
|
#: lazarusidestrconsts.lissmatches
|
|
msgid "Matches"
|
|
msgstr "Löydetty"
|
|
|
|
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
|
|
msgid "Sorry, this type is not yet implemented"
|
|
msgstr "Valitan, tätä tyyppiä ei ole vielä toteutettu"
|
|
|
|
#: lazarusidestrconsts.lissortforscope
|
|
msgid "Sort for scope"
|
|
msgstr "Järjestä ulottuvuuden mukaan"
|
|
|
|
#: lazarusidestrconsts.lissorting
|
|
msgid "Sorting"
|
|
msgstr "Järjestää"
|
|
|
|
#: lazarusidestrconsts.lissortselascending
|
|
msgid "Ascending"
|
|
msgstr "Nouseva"
|
|
|
|
#: lazarusidestrconsts.lissortselcasesensitive
|
|
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
|
|
msgid "&Case Sensitive"
|
|
msgstr "&Sama kirjainkoko"
|
|
|
|
#: lazarusidestrconsts.lissortseldescending
|
|
msgid "Descending"
|
|
msgstr "Laskeva"
|
|
|
|
#: lazarusidestrconsts.lissortseldomain
|
|
msgid "Domain"
|
|
msgstr "Lajitteluperuste"
|
|
|
|
#: lazarusidestrconsts.lissortselignorespace
|
|
msgid "Ignore Space"
|
|
msgstr "Jätä huomiotta välilyönnit"
|
|
|
|
#: lazarusidestrconsts.lissortsellines
|
|
msgid "Lines"
|
|
msgstr "Rivit"
|
|
|
|
#: lazarusidestrconsts.lissortseloptions
|
|
msgctxt "lazarusidestrconsts.lissortseloptions"
|
|
msgid "Options"
|
|
msgstr "Asetukset"
|
|
|
|
#: lazarusidestrconsts.lissortselparagraphs
|
|
msgid "Paragraphs"
|
|
msgstr "Kappaleet"
|
|
|
|
#: lazarusidestrconsts.lissortselpreview
|
|
msgctxt "lazarusidestrconsts.lissortselpreview"
|
|
msgid "Preview"
|
|
msgstr "Esikatselu"
|
|
|
|
#: lazarusidestrconsts.lissortselsort
|
|
msgid "Accept"
|
|
msgstr "Hyväksy"
|
|
|
|
#: lazarusidestrconsts.lissortselsortselection
|
|
msgid "Sort selection"
|
|
msgstr "Järjestä valinta"
|
|
|
|
#: lazarusidestrconsts.lissortselwords
|
|
msgctxt "lazarusidestrconsts.lissortselwords"
|
|
msgid "Words"
|
|
msgstr "Sanat"
|
|
|
|
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
|
|
msgid "Sort Unicode range list alphabetically"
|
|
msgstr "Järjestä unicode lohkot aakkosjärjestykseen"
|
|
|
|
#: lazarusidestrconsts.lissourceanddestinationarethesame
|
|
msgid "Source and Destination are the same:%s%s"
|
|
msgstr "Lähde ja kohde ovat samat:%s%s"
|
|
|
|
#: lazarusidestrconsts.lissourcebreakpoint
|
|
msgid "&Source Breakpoint ..."
|
|
msgstr "&Lähdekoodin keskeytyskohta ..."
|
|
|
|
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
|
|
msgid "Source directory \"%s\"%sand destination directory \"%s\"%sare the same. Maybe you misunderstand this feature.%sIt will clean/recreate the destination directory and copy the package/project into it."
|
|
msgstr "Lähdehakemisto \"%s\"%sja kohdehakemisto \"%s\"%sovat samat. Ehkä ymmärsit toiminnon väärin.%sSe putsaa tai luo uudestaan kohdehakemiston ja kopioi paketin/projektin sinne."
|
|
|
|
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
|
|
msgid "Source directory \"%s\" does not exist."
|
|
msgstr "Lähdehakemistoa \"%s\" ei ole."
|
|
|
|
#: lazarusidestrconsts.lissourceeditorwindowmanager
|
|
msgid "Source Editor Window Manager"
|
|
msgstr "Koodieditorin ikkunat"
|
|
|
|
#: lazarusidestrconsts.lissourcemodified
|
|
msgid "Source modified"
|
|
msgstr "Lähdekoodi muuttunut"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsave
|
|
msgid "Source of page \"%s\" has changed. Save?"
|
|
msgstr "Sivun \"%s\" lähdekoodi on muuttunut. Tallenna?"
|
|
|
|
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
|
|
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
|
|
msgstr "Sivujen lähteet ovat muuttuneet. Tallenna sivu \"%s\"? (%d lisää)"
|
|
|
|
#: lazarusidestrconsts.lissourcepaths
|
|
msgid "Source paths"
|
|
msgstr "Lähdekoodin polut"
|
|
|
|
#: lazarusidestrconsts.lisspaceequally
|
|
msgid "Space equally"
|
|
msgstr "Tasaa välit"
|
|
|
|
#: lazarusidestrconsts.lissrcos
|
|
msgid "Src OS"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisssearching
|
|
msgid "Searching"
|
|
msgstr "Etsitään"
|
|
|
|
#: lazarusidestrconsts.lisssearchtext
|
|
msgid "Search text"
|
|
msgstr "Etsittävä teksti"
|
|
|
|
#: lazarusidestrconsts.lisstartconversion
|
|
msgid "Start Conversion"
|
|
msgstr "Aloita muunnos"
|
|
|
|
#: lazarusidestrconsts.lisstartide
|
|
msgid "Start IDE"
|
|
msgstr "Käynnistä IDE"
|
|
|
|
#: lazarusidestrconsts.lisstartwithanewproject
|
|
msgid "Start with a new project"
|
|
msgstr "Aloita uusi projekti"
|
|
|
|
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
|
|
msgid "Statusbar shows the property's name and the class where it is published."
|
|
msgstr "Statuspalkki näyttää ominaisuuden nimen ja luokan missä se julkaistiin."
|
|
|
|
#: lazarusidestrconsts.lisstop
|
|
msgid "Stop"
|
|
msgstr "Pysäytä"
|
|
|
|
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
|
|
msgid "Stop current debugging and rebuild project?"
|
|
msgstr "Pysäytetäänkö nykyinen virheenjäljitys ja kokoa uudelleen?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging
|
|
msgid "Stop Debugging?"
|
|
msgstr "Lopetetaanko virheenjäljitys?"
|
|
|
|
#: lazarusidestrconsts.lisstopdebugging2
|
|
msgid "Stop debugging?"
|
|
msgstr "Pysäytetäänkö virheenjäljitys?"
|
|
|
|
#: lazarusidestrconsts.lisstoponexception
|
|
msgid "Stop on exception"
|
|
msgstr "Pysähdy keskeytykseen"
|
|
|
|
#: lazarusidestrconsts.lisstopthedebugging
|
|
msgid "Stop the debugging?"
|
|
msgstr "Pysäytetäänkö virheenjäljitys?"
|
|
|
|
#: lazarusidestrconsts.lisstorepathdelimitersandas
|
|
msgid "Store path delimiters \\ and / as"
|
|
msgstr "Tallenna polkujen erottimet \\ ja / kuten"
|
|
|
|
#: lazarusidestrconsts.lisstrangelpifile
|
|
msgid "Strange lpi file"
|
|
msgstr "Outo lpi-tiedosto"
|
|
|
|
#: lazarusidestrconsts.lisstreamingerror
|
|
msgid "Streaming error"
|
|
msgstr "Virran virhe"
|
|
|
|
#: lazarusidestrconsts.lisstring
|
|
msgid "String"
|
|
msgstr "Merkkijono"
|
|
|
|
#: lazarusidestrconsts.lisstyle
|
|
msgctxt "lazarusidestrconsts.lisstyle"
|
|
msgid "Style"
|
|
msgstr "Tyyli"
|
|
|
|
#: lazarusidestrconsts.lissubprocedure
|
|
msgid "Sub Procedure"
|
|
msgstr "Aliohjelman sisäinen aliohjelma"
|
|
|
|
#: lazarusidestrconsts.lissubprocedureonsamelevel
|
|
msgid "Sub Procedure on same level"
|
|
msgstr "Aliohjelma samalla tasolla"
|
|
|
|
#: lazarusidestrconsts.lissuccess
|
|
msgid "Success"
|
|
msgstr "Onnistui"
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexported
|
|
msgid "Successfully exported to \"%s\"."
|
|
msgstr "Onnistuneesti vietiin \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
|
|
msgid "Successfully exported %d BuildModes to \"%s\"."
|
|
msgstr "Onnistuneesti vietiin %d koontamoodia \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
|
|
msgid "Successfully exported compiler options to \"%s\"."
|
|
msgstr "Onnistuneesti vietiin kääntäjän valinnat \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimported
|
|
msgid "Successfully imported from \"%s\"."
|
|
msgstr "Onnistuneesti tuotiin \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
|
|
msgid "Successfully imported %d BuildModes from \"%s\"."
|
|
msgstr "Onnistuneesti tuotiin %d koontamoodia \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
|
|
msgid "Successfully imported compiler options from \"%s\"."
|
|
msgstr "Onnistuneesti tuotiin kääntäjän valinnat \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
|
|
msgid "Suggest default name of new file in lowercase"
|
|
msgstr "Ehdota uuden tiedoston nimeen pieniä kirjaimia"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousincludepath
|
|
msgid "Suspicious include path"
|
|
msgstr "Epäilyttävä include polku"
|
|
|
|
#: lazarusidestrconsts.lissuspiciousunitpath
|
|
msgid "Suspicious unit path"
|
|
msgstr "Epäilyttävä käännösyksikön polku"
|
|
|
|
#: lazarusidestrconsts.lissvnrevision
|
|
msgid "SVN Revision: "
|
|
msgstr "SVN Revisio: "
|
|
|
|
#: lazarusidestrconsts.lissvuoinvalidvariablename
|
|
msgid "Invalid variable name"
|
|
msgstr "Kelvoton muuttujan nimi"
|
|
|
|
#: lazarusidestrconsts.lissvuoisnotavalididentifier
|
|
msgid "\"%s\" is not a valid identifier."
|
|
msgstr "\"%s\" ei ole kelvollinen tunniste."
|
|
|
|
#: lazarusidestrconsts.lissvuooverridesystemvariable
|
|
msgid "Override system variable"
|
|
msgstr "Syrjäytä järjestelmän muuttuja"
|
|
|
|
#: lazarusidestrconsts.lisswitchfiltersettings
|
|
msgid "Switch Filter Settings"
|
|
msgstr "Vaihda suodattimen asetukset"
|
|
|
|
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
|
|
msgid "Switch to Favorites tab after asking for component name."
|
|
msgstr "Vaihda Suosikit-lehdelle kun komponentin nimi on kysytty."
|
|
|
|
#: lazarusidestrconsts.lissyntaxmode
|
|
msgid "Syntax mode"
|
|
msgstr "Kielioppimoodi"
|
|
|
|
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
|
|
msgid "system.ppu not found. Check your fpc.cfg."
|
|
msgstr "system.ppu ei löydy. Tarkista fpc.cfg."
|
|
|
|
#: lazarusidestrconsts.listab
|
|
msgid "Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listaborderconfirmsort
|
|
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
|
|
msgstr "Järjestä \"%s\":n kaikkien kontrollien tabulointi sijainnin perusteella?"
|
|
|
|
#: lazarusidestrconsts.listaborderdownhint
|
|
msgid "Move the selected control down in tab order"
|
|
msgstr "Siirrä valittu kontrolli alas tabulointijärjestyksessä"
|
|
|
|
#: lazarusidestrconsts.listaborderof
|
|
msgid "Tab Order of %s"
|
|
msgstr "%s:n tabulointijärjestys"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursionhint
|
|
msgid "Calculate tab order recursively for child controls"
|
|
msgstr "Järjestä lapsikontrollien tabulointi rekursiivisesti"
|
|
|
|
#: lazarusidestrconsts.listaborderrecursively
|
|
msgid "recursively"
|
|
msgstr "rekursiivisesti"
|
|
|
|
#: lazarusidestrconsts.listabordersorthint
|
|
msgid "Calculate tab order for controls by their X- and Y- positions"
|
|
msgstr "Laske kontrollien tabulointijärjestys X- and Y-sijainnin perusteella"
|
|
|
|
#: lazarusidestrconsts.listaborderuphint
|
|
msgid "Move the selected control up in tab order"
|
|
msgstr "Siirrä valittu kontrolli ylös tabulointijärjestyksessä"
|
|
|
|
#: lazarusidestrconsts.listabsfor
|
|
msgid "Tabs for %s"
|
|
msgstr "%s:n tabit"
|
|
|
|
#: lazarusidestrconsts.listakesnapshot
|
|
msgid "Take a Snapshot"
|
|
msgstr "Ota pikakuva"
|
|
|
|
#: lazarusidestrconsts.listarget
|
|
msgid "Target:"
|
|
msgstr "Kohde:"
|
|
|
|
#: lazarusidestrconsts.listarget2
|
|
msgid ", Target: %s"
|
|
msgstr ", Kohde: %s"
|
|
|
|
#: lazarusidestrconsts.listargetcpu
|
|
msgid "Target CPU"
|
|
msgstr "Kohde-CPU"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
|
|
msgid "Target file name: (-o, empty = use unit output directory)"
|
|
msgstr "Kohdetiedoston nimi (-o, tyhjä = käytä käännöshakemistoa)"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameo
|
|
msgid "Target file name (-o):"
|
|
msgstr "Kohdetiedoston nimi (-o):"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameofproject
|
|
msgid "Target filename of project"
|
|
msgstr "Projektin kohdetiedosto"
|
|
|
|
#: lazarusidestrconsts.listargetfilenameplusparams
|
|
msgid "Target filename + params"
|
|
msgstr "Kohdetiedosto + parametrit"
|
|
|
|
#: lazarusidestrconsts.listargetisreadonly
|
|
msgid "Target is read only"
|
|
msgstr "Kohde on vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.listargetos
|
|
msgctxt "lazarusidestrconsts.listargetos"
|
|
msgid "Target OS"
|
|
msgstr "Kohdekäyttöjärjestelmä"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcell
|
|
msgid "Editable Cell"
|
|
msgstr "Muokattava solu"
|
|
|
|
#: lazarusidestrconsts.listemplateeditparamcellhelp
|
|
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listemplatefile
|
|
msgid "Template file"
|
|
msgstr "Mallinetiedosto"
|
|
|
|
#: lazarusidestrconsts.listestdirectory
|
|
msgid "Test directory"
|
|
msgstr "Testihakemisto"
|
|
|
|
#: lazarusidestrconsts.listesturl
|
|
msgid "Test URL"
|
|
msgstr "Kokeile URL"
|
|
|
|
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
|
|
msgid "The Application Bundle was created for \"%s\""
|
|
msgstr "\"Application Bundle\" luotiin \"%s\":lle"
|
|
|
|
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
|
|
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
|
|
msgstr "Luokka \"%s\" on TControl eikä sitä voi liittää muuhun kuin kontrolliin.%sLiittäminen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.listhecodetoolsfoundanerror
|
|
msgid "The Codetools found an error:%s%s"
|
|
msgstr "Codetools löysi virheen:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecommandafterisnotexecutable
|
|
msgid "The command after \"%s\" is not executable."
|
|
msgstr "Komento \"%s\":n jälkeen ei ole suoritettava ohjelma."
|
|
|
|
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
|
|
msgid "The command after publishing is invalid:%s\"%s\""
|
|
msgstr "Komento julkaisun jälkeen on kelvoton:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
|
|
msgid "The compiler file \"%s\" does not look correct:%s%s"
|
|
msgstr "Kääntäjä-tiedosto \"%s\" ei näytä oikealta:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
|
|
msgid "The component %s can not be deleted, because it is not owned by %s."
|
|
msgstr "Komponenttia %s ei voi poistaa, koska %s ei omista sitä."
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
|
|
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
|
|
msgstr "Luokan \"%s\" komponenttieditori synnytti virheen:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
|
|
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
|
|
msgstr "Luokan \"%s\" komponenttieditori%skäynnistetty verbillä #%s \"%s\"%ssynnytti virheen:%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
|
|
msgstr "Komponentti %s periytyy %s:sta.%sSen voi poistaa avaamalla kyseinen luokka ja poistamalla se sieltä."
|
|
|
|
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
|
|
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
|
|
msgstr "Komponentti %s periytyy %s:sta.%sSen voi nimetä avaamalla kyseinen luokka ja nimeämällä se siellä."
|
|
|
|
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
|
|
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
|
|
msgstr "Komponentin nimen pitää olla yksilöllinen lomakkeen/datamodulin sisällä. Nimiä verrataan kuten Pascal tunnisteita välittämättä kirjaimen koosta."
|
|
|
|
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
|
|
msgid "The configuration will be downgraded/converted."
|
|
msgstr "Asetukset muunnetaan vanhempaan versioon."
|
|
|
|
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
|
|
msgid "The %s contains a nonexistent directory:%s%s"
|
|
msgstr "%s sisältää olemattoman hakemiston:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
|
|
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
|
|
msgstr "%s sisältää tähtimerkin *.%sLazarus kohtelee sitä tavallisena merkkinä eikä laajenna sitä tiedostohaussa"
|
|
|
|
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
|
|
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
|
|
msgstr "Nykyisellä FPC:llä ei ole asetustiedostoa. Joitain käännösyksikköjä tulee puuttumaan. Tarkista FPC:n asennus."
|
|
|
|
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
|
|
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
|
|
msgstr "Virheenjäljitin \"%s\"%sei ole olemassa tai ei ole suoritettava.%sKatso Työkalut -> Asetukset -> Virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
|
|
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
|
|
msgstr "Virheenjäljittimen nimi on tyypillisesti \"%s\". Anna tiedoston nimi polkuineen."
|
|
|
|
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
|
|
msgid "The default mode must be stored in project, not in session."
|
|
msgstr "Oletusmoodi pitää tallentaa projektiin, ei istuntoon."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
|
|
msgid "The destination directory%s\"%s\" does not exist."
|
|
msgstr "Kohdehakemistoa%s\"%s\" ei ole."
|
|
|
|
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
|
|
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
|
|
msgstr "Kohdehakemistoa \"%s\" ei ole.%sTarkista kohdehakemisto projektin asetuksista."
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
|
|
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
|
|
msgstr "Hakemistossa \"%s\" ei ole enää projektin include-tiedostoja. Poista hakemisto projektin include-hakupolusta?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
|
|
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
|
|
msgstr "Hakemistossa \"%s\" ei ole enää käännösyksiköitä. Poistetaanko hakemisto projektin käännösyksikköjen hakupolusta?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
|
|
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
|
|
msgstr "Kansiota \"%s\" ei enää tarvita käännösyksikön tiedostopolussa.%sPoistetaanko se?"
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotwritable
|
|
msgid "The directory \"%s\" is not writable."
|
|
msgstr "Hakemistoon \"%s\" ei voi kirjoittaa."
|
|
|
|
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
|
|
msgid "The directory \"%s\" is not yet in the unit path.%sAdd it?"
|
|
msgstr "Kansio \"%s\" ei vielä ole käännösyksikön polussa.%sLisätäänkö se sinne?"
|
|
|
|
#: lazarusidestrconsts.listhedirectorywasnotfound
|
|
msgid "The directory %s was not found."
|
|
msgstr "Hakemistoa %s ei loytynyt."
|
|
|
|
#: lazarusidestrconsts.listhefile
|
|
msgid "The file \"%s\""
|
|
msgstr "Tiedosto \"%s\""
|
|
|
|
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
|
|
msgid "The file %s does not look like a lpi file."
|
|
msgstr "Tiedosto %s ei vaikuttaisi olevan lpi-tiedosto."
|
|
|
|
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
|
|
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
|
|
msgstr "Tiedostoindexiä tarvitaan esim. määrittelyjen hakemiseen. Tiedostoja tutkittaessa koodia voi muokata, mutta määrittelyn haku antaa virheen käännösyksikköä-ei-löydy. Tämä voi kestää minuutin."
|
|
|
|
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
|
|
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
|
|
msgstr "Tiedosto \"%s\" symbolinen linkki.%sAvataanko \"%s\" sen sijaan?"
|
|
|
|
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
|
|
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
|
|
msgstr "Tiedosto \"%s\" ei ole Lazarus-projekti.%sLuodaanko uusi projekti tälle \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisinvalid
|
|
msgid "The file mask \"%s\" is invalid."
|
|
msgstr "Tiedostomaski \"%s\" on kelvoton."
|
|
|
|
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
|
|
msgid "The file mask \"%s\" is not a valid regular expression."
|
|
msgstr "Tiedostomaski \"%s\" ei ole säännöllinen lauseke."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
|
|
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
|
|
msgstr "Tiedosto \"%s\" näyttää olevan Pascal-ohjelma.%sSuljetaanko nykyinen projekti ja avataan tämä uutena projektina?%s\"Ei\" lataa sen vain lähdekoodina."
|
|
|
|
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
|
|
msgid "The file %s seems to be the program file of an existing Lazarus Project."
|
|
msgstr "Tiedosto %s vaikuttaa Lazarus-projektin ohjelmatiedostolta."
|
|
|
|
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
|
|
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
|
|
msgstr "Tiedosto \"%s\"%slöytyy paketin %s lähdehakemistosta ja näyttää käännetyltä yksiköltä. Käännetyn yksikön pitää olla paketin käännöshakemistossa, muuten muilla paketeilla on vaikeuksia käyttää tätä pakettia.%sPoistetaanko ristiriitainen tiedosto?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
|
|
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
|
|
msgstr "Tiedostoa \"%s\" ei löydy.%sTahdotko etsiä sen itse ?"
|
|
|
|
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
|
|
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
|
|
msgstr "Tiedostoa \"%s\" ei löytynyt.%sOhita-nappi jatkaa projektin lataamista,%sKeskeytä-nappi keskeyttää sen."
|
|
|
|
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
|
|
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
|
|
msgstr "Seuraavia metodeja käyttää %s mutta niitä ei löydy lähdekoodista%s%s%s%s%sPoistetaanko 'roikkuva' viittaus?"
|
|
|
|
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
|
|
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
|
|
msgstr "FPC lähdehakemisto \"%s\" ei näytä oikealta:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
|
|
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
|
|
msgstr "Free Pascal -kääntäjän nimi on tyypillisesti \"%s\". Se voi olla myös tietylle kohteelle tehty kääntäjä kuten \"%s\". Anna koko tiedostopolku."
|
|
|
|
#: lazarusidestrconsts.listheideisstillbuilding
|
|
msgid "The IDE is still building."
|
|
msgstr "IDE:ä kootaan yhä."
|
|
|
|
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
|
|
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
|
|
msgstr "Tunniste on käännösyksikkö. Käytä Tiedosto - Tallenna nimetäksesi sen."
|
|
|
|
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
|
|
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
|
|
msgstr "Näppäin %s%son jo kiinnitetty %s:lle.%sPoista vanha kiinnitys ja kiinnitä näppäin uuteen funktioon%s%s?"
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
|
|
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
|
|
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
|
|
msgstr "Käynnistävä ohjelma \"%s\"%sei ole olemassa tai se ei ole suoritettava.%sKatso Suorita -> Suoritusparametrit -> Paikallinen"
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
|
|
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
|
|
msgstr "Lazarus-hakemistossa ovat IDEn lähdekoodit sekä LCL:n ja muiden pakettien tiedostot. Siellä on esimerkiksi tiedosto \"ide%slazarus.lpi\". Myös käännöstiedostot ovat siellä."
|
|
|
|
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
|
|
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
|
|
msgstr "Lazarus hakemisto \"%s\" ei näytä oikealta:%s%s"
|
|
|
|
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
|
|
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
|
|
msgstr "LFM (Lazarus-lomake) sisältää vääriä ominaisuuksia. Tämä tarkoittaa esim. että jotain luokkaa tai ominaisuutta ei ole LCL-kirjastossa. Normaali korjaus on poistaa nämä ominaisuudet LFM-tiedostosta ja korjata Pascal-koodi käsin."
|
|
|
|
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
|
|
msgid "The macro \"%s\" does not begin with \"%s\"."
|
|
msgstr "Makro \"%s\" ei ala \"%s\":lla."
|
|
|
|
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
|
|
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
|
|
msgstr "\"make\" ohjelman nimi on tyypillisesti \"%s\". Se tarvitaan IDE:n kokoamiseen. Anna tiedoston nimi polkuineen."
|
|
|
|
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
|
|
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
|
|
msgstr "Uusi include tiedosto ei ole vielä hakupolussa.%sLisätäänkö hakemisto %s?"
|
|
|
|
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
|
|
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
|
|
msgstr "Uusi käännösyksikkö ei ole vielä hakupolussa.%sLisätäänkö hakemisto %s?"
|
|
|
|
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
|
|
msgid "The old configuration will be upgraded."
|
|
msgstr "Vanhat asetukset päivitetään."
|
|
|
|
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
|
|
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
|
|
msgstr "\"Muut lähdekoodit\" sisältää hakemiston, mikä on jo kohdassa \"Muut käännösyksiköt\".%s%s"
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryismissing
|
|
msgid "The output directory \"%s\" is missing."
|
|
msgstr "Käännöshakemisto \"%s\" puuttuu."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
|
|
msgid "The output directory of %s is listed in the include search path of %s."
|
|
msgstr "%s:n käännöshakemisto on jo mukana %s:n include hakupolussa."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
|
|
msgid "The output directory of %s is listed in the inherited include search path of %s."
|
|
msgstr "%s:n käännöshakemisto on jo mukana %s:n periytyvässä include hakupolussa."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
|
|
msgid "The output directory of %s is listed in the inherited unit search path of %s."
|
|
msgstr "%s:n käännöshakemisto on jo mukana periytyvässä %s:n käännösyksikköjen hakupolussa."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
|
|
msgid "The output directory of %s is listed in the unit search path of %s."
|
|
msgstr "%s:n käännöshakemisto on jo mukana %s:n käännösyksikköjen hakupolussa."
|
|
|
|
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
|
|
msgid " The output directory should be a separate directory and not contain any source files."
|
|
msgstr "Käännöshakemiston pitäisi olla erillinen hakemisto, missä ei ole lähdekoodeja."
|
|
|
|
#: lazarusidestrconsts.listheownerclasshasthisname
|
|
msgid "The owner class has this name"
|
|
msgstr "Omistajaluokan nimi on"
|
|
|
|
#: lazarusidestrconsts.listheownerhasthisname
|
|
msgid "The owner has this name"
|
|
msgstr "Omistajan nimi on"
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
|
|
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Paketti %s lisää polun \"%s\" include-hakupolkuun IDE:ssä.%sSyynä lienee paketin väärät asetukset."
|
|
|
|
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
|
|
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
|
|
msgstr "Paketti %s lisää polun \"%s\" käännösyksiköiden hakupolkuun IDE:ssä.%sSyynä lienee paketin väärät asetukset."
|
|
|
|
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
|
|
msgid "The package already contains a unit with this name."
|
|
msgstr "Paketissa on jo tämän niminen käännösyksikkö."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
|
|
msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
|
|
msgstr "Pakettia %s ei voi asentaa, koska se vaatii paketin \"%s\", mikä on vain ajo-paketti."
|
|
|
|
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
|
|
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
|
|
msgstr "Paketin %s asennusta ei voi poistaa, koska IDE itse tarvitsee sitä."
|
|
|
|
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
|
|
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
|
|
msgstr "Paketilla %s ei ole \"Register\" aliohjelmaa, mikä yleensä tarkoittaa ettei se tarjoa mitään lisäyksiä IDE:een. Sen asennus luultavasti vain kasvattaa IDE:n kokoa ja voi jopa heikentää sen vakautta.%sVihje: Jos tahdot käyttää pakettia projektissa, käytä \"Lisää projektiin\" valintaa."
|
|
|
|
#: lazarusidestrconsts.listhepackageisalreadyinthelist
|
|
msgid "The package %s is already in the list"
|
|
msgstr "Paketti %s on jo luettelossa"
|
|
|
|
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
|
|
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
|
|
msgstr "Paketti %s ei ole suunnittelupaketti. Sitä ei voi asentaa IDE:een."
|
|
|
|
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
|
|
msgid "The path of \"make\" is not correct: \"%s\""
|
|
msgstr "\"make\" komennon polku on väärin: \"%s\""
|
|
|
|
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
|
|
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
|
|
msgstr "\"make\" ohjelmaa ei löydy.%sSe tarvitaan Lazaruksen kokoamiseen."
|
|
|
|
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
|
|
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
|
|
msgstr "Projektin kääntäjän asetukset ja pää-lähdekoodissa olevat ohjeet eroavat. Uudelle käännösyksikölle käytetään projektin asetusten moodia ja string-tyyppiä:"
|
|
|
|
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
|
|
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
|
|
msgstr "Projekti ei käytä LCL \"interfaces\" käännösyksikköä, Mitä LCLBase tarvitsee.%sLinkittäjä antaa omituisia virheitä, jos LCL käytetään ilman \"interfaces\":a."
|
|
|
|
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
|
|
msgid "The project has no main source file."
|
|
msgstr "Projektilla ei ole päätiedostoa."
|
|
|
|
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
|
|
msgid "The project info file \"%s\"%sis equal to the project main source file!"
|
|
msgstr "Projektin info-tiedosto \"%s\"%son saman niminen kuin projektin päätiedosto!"
|
|
|
|
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
|
|
msgid "The project information file \"%s\"%shas changed on disk."
|
|
msgstr "Projektin info-tiedosto \"%s\"%son muuttunut levyllä."
|
|
|
|
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
|
|
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
|
|
msgstr "Projekti pitää tallentaa ennen kokoamista%sJos asetat testihakemiston IDE:n asetuksissa,%svoit luoda uusia projekteja ja koota ne saman tien.%sTallenna projekti?"
|
|
|
|
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
|
|
msgid "The project uses FPC resources, which require at least FPC 2.4"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
|
|
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
|
|
msgstr "Projektin kohdekäyttöjärjestelmä=%s ja CPU=%s.%sKohteelle ei löydy system.ppu tiedostoa FPC:n binaari-hakemistoista.%sVarmista että fpc on asennettu oikein tälle kohteelle ja että fpc.cfg:ssa on oikeat hakemistot."
|
|
|
|
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
|
|
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
|
|
msgstr "Projekti kirjoittaa virheenjäljitys symbolit ulkoiseen tiedostoon. \"%s\" tukee vain symboleja suoritettavassa ohjelmassa."
|
|
|
|
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
|
|
msgid "%sThere are additional notes for this message on%s"
|
|
msgstr "%sLisätietoja tähän viestiin löytyy täältä%s"
|
|
|
|
#: lazarusidestrconsts.listherearenoconflictingkeys
|
|
msgid "There are no conflicting keys."
|
|
msgstr "Ei ristiriitaisia näppäimiä."
|
|
|
|
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
|
|
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
|
|
msgstr "Kansiossa on muitakin saman nimisiä tiedostoja,%sne eroavat ainoastaan kirjaimien koon perusteella:%s%s%sPoistetaanko ne?"
|
|
|
|
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
|
|
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
|
|
msgstr "Löytyy samanniminen tiedosto samantapaisella tiedostopäätteellä%sTiedosto: %s%sRistiriitainen tiedosto: %s%sPoistetaanko?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
|
|
msgid "There is already a build mode with this name."
|
|
msgstr "Tämänniminen koontamoodi on jo olemaassa."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
|
|
msgid "There is already a component class with the name %s."
|
|
msgstr "Komponenttiluokka nimellä %s on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
|
|
msgid "There is already a component with this name"
|
|
msgstr "Samanniminen komponentti on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafilein
|
|
msgid "There is already a file%s%s%sin %s"
|
|
msgstr "Tiedosto%s%s%s %s:ssa on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
|
|
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
|
|
msgstr "Tiedosto \"%s\" on jo olemassa täällä: %s%sVanha: %s%sUusi: %s%s%sJatka?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaformwiththename
|
|
msgid "There is already a form with the name \"%s\""
|
|
msgstr "\"%s\"-niminen lomake on jo olemassa"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
|
|
msgid "There is already a macro with the name \"%s\"."
|
|
msgstr "Makro nimeltä \"%s\" on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
|
|
msgid "There is already an IDE macro with the name \"%s\""
|
|
msgstr "On jo \"%s\" niminen IDE-makro."
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
|
|
msgid "There is already a package %s in the list"
|
|
msgstr "Luettelossa on jo paketti %s"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
|
|
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
|
|
msgstr "Käännösyksikkö \"%s\" on jo %s:ssa%sVanha: %s%sUusi: %s%sVarmista että käännösyksikköjen hakupolussa on vain toinen niistä.%s%sJatketaanko?"
|
|
|
|
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
|
|
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Käännösyksikkö nimellä \"%s\" on jo olemassa. Pascal-tunnisteiden pitää olla yksilöllisiä."
|
|
|
|
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
|
|
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
|
|
msgstr "Projektissa on käännösyksikkö nimeltään \"%s\".%sValitse toinen nimi"
|
|
|
|
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
|
|
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
|
|
msgstr "fpc.exe ei ole %s:n hakemistossa. Yleensä make ohjelma asennetaan yhdessä FPC:n kanssa."
|
|
|
|
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
|
|
msgid "There must be at least one build mode."
|
|
msgstr "Ainakin yksi koontamoodi tarvitaan."
|
|
|
|
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
|
|
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
|
|
msgstr "Resurssiluokka \"%s\" periytyy \"%s\":sta. Kyseessä on ehkä kirjoitusvirhe TForm:lle."
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
|
|
msgid "There was an error during writing the selected component %s:%s:%s%s"
|
|
msgstr "Tapahtui virhe kirjoitettaessa valittua komponenttia %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
|
|
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
|
|
msgstr "Tapahtui virhe muunnettaessa binaarivuota valitulle komponentille %s:%s:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
|
|
msgid "There was an error while copying the component stream to clipboard:%s%s"
|
|
msgstr "Tapahtui virhe kopioitaessa komponentin vuota leikepöydälle:%s%s"
|
|
|
|
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
|
|
msgid "The root component cannot be deleted."
|
|
msgstr "Juurikomponenttia ei voi poistaa."
|
|
|
|
#: lazarusidestrconsts.listhesefileswillbedeleted
|
|
msgid "These files will be deleted"
|
|
msgstr "Nämä tiedostot poistetaan"
|
|
|
|
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
|
|
msgid "These settings are stored with the project."
|
|
msgstr "Nämä asetukset talletetaan projektin mukana."
|
|
|
|
#: lazarusidestrconsts.listheseunitswerenotfound
|
|
msgid "These units were not found:"
|
|
msgstr "Näitä käännösyksikköjä ei löydy:"
|
|
|
|
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
|
|
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
|
|
msgstr "Free Pascalin pakettien lähdekoodit tarvitaan niiden tutkimista ja koodin täydennystä varten. Niissä on mukana esim. tiedosto \"%s\"."
|
|
|
|
#: lazarusidestrconsts.listhetargetisnotwritable
|
|
msgid "The target %s is not writable."
|
|
msgstr "Kohde %s ei ole kirjoitettava."
|
|
|
|
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
|
|
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
|
|
msgstr "Testihakemistoa ei löydy:%s\"%s\"%s(katso IDE asetukset)"
|
|
|
|
#: lazarusidestrconsts.listheunitalreadyexists
|
|
msgid "The unit \"%s\" already exists."
|
|
msgstr "Käännösyksikkö \"%s\" on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.listheunitbelongstopackage
|
|
msgid "The unit belongs to package %s."
|
|
msgstr "Käännösyksikkö kuuluu pakettiin %s."
|
|
|
|
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
|
|
msgid "The unit %s exists twice in the unit path of the %s:"
|
|
msgstr "Käännösyksikkö %s löytyy %s:n kahdesta eri hakupolusta:"
|
|
|
|
#: lazarusidestrconsts.listheunithasthisname
|
|
msgid "The unit has this name"
|
|
msgstr "Käännösyksiköllä on tämä nimi"
|
|
|
|
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
|
|
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
|
|
msgstr "Käännösyksikön nimi \"%s\" ei ole pienillä kirjaimilla.%sFree Pascal -kääntäjä ei etsi kaikkia variaatioita. On suositeltavaa käyttää vain pieniä kirjaimia.%sVaihdetaanko tiedoston nimi?"
|
|
|
|
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
|
|
msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
|
|
msgstr "Käännösyksikkö %s kuuluu FPC:n lähdekoodeihin, mutta vastaavaa fpdoc xml tiedostoa ei löydy.%sJoko et ole lisännyt fpcdoc hakemistoa hakupolkuun tai käännösyksikköä ei ole vielä dokumentoitu.%sfpdoc tiedostot FPC lähdekoodeille voi ladata täältä: %s%sLisää hakemisto fpdoc editorin valintoihin.%sUuden tiedoston luomiseksi hakemistoon pitää olla kirjoitusoikeus."
|
|
|
|
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
|
|
msgid "The unit %s is used by other files.%sUpdate references automatically?"
|
|
msgstr "Muutkin tiedostot käyttävät käännösyksikköä %s.%sPäivitetäänkö viittaukset niihin automaattisesti?"
|
|
|
|
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
|
|
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
|
|
msgstr "Käännösyksikkö on jo nimeltään \"%s\". Pascal-tunnisteiden pitää olla yksilöllisiä."
|
|
|
|
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
|
|
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
|
|
msgstr "Käännösyksikön hakupolku \"%s\":lle sisältää lähdehakemiston \"%s\" paketille %s"
|
|
|
|
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
|
|
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
|
|
msgstr "Työhakemistoa \"%s\" ei ole olemassa.%sTarkista työhakemisto valikosta Suorita > Suoritusparametrit."
|
|
|
|
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
|
|
msgid "This component already contains a class with the name %s."
|
|
msgstr "Komponentilla on jo luokka nimeltä %s."
|
|
|
|
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
|
|
msgid "This function needs an open .lfm file in the source editor."
|
|
msgstr "Tämä ominaisuus vaatii .lfm tiedoston avoinna editorissa."
|
|
|
|
#: lazarusidestrconsts.listhishelpmessage
|
|
msgid "this help message"
|
|
msgstr "tämä avusteviesti"
|
|
|
|
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
|
|
msgid "This is a test project for a design time package, testing it outside the IDE."
|
|
msgstr "Tämä on testiprojekti suunnittelupaketille, IDE:n ulkopuolella testausta varten."
|
|
|
|
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
|
|
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
|
|
msgstr "Tämä vaikuttaa Pascal-tiedostolta.%sOn suositeltavaa käyttää pieniä kirjaimia tiedoston nimessä, jotta vältytään ongelmilta joissakin tiedostojärjestelmissä.%sVaihdetaanko nimi pieniksi kirjaimiksi?"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
|
|
msgid "This project has no main source file"
|
|
msgstr "Tällä projektilla ei ole päätiedostoa"
|
|
|
|
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
|
|
msgid "This project has only the default build mode."
|
|
msgstr "Projektilla on vain oletus koontamoodi."
|
|
|
|
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
|
|
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
|
|
msgstr "Asennus ei tue näitä valintoja Lazaruksen kokoamiseksi%sHakemisto \"%s\" ei ole kirjoitettava.%sKatso Lazaruksen web-sivulta muita ohjeita Lazaruksen asentamiseen."
|
|
|
|
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
|
|
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
|
|
msgstr "Tästä ei voi tehdä omaa aliohjelmaa.%sValitse ensin jokin muu koodin osa josta voi tehdä uusi aliohjelma tai metodi"
|
|
|
|
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
|
|
msgid "This will allow changing all build modes at once. Not implemented yet."
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.listhiswillcreateacirculardependency
|
|
msgid "This will create a circular dependency."
|
|
msgstr "Tämä synnyttää kehäriippuvuuden."
|
|
|
|
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
|
|
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
|
|
msgstr "Tämä kopioi paljon tekstiä (%s) leikepöydälle.%sJatketaanko?"
|
|
|
|
#: lazarusidestrconsts.listhreads
|
|
msgctxt "lazarusidestrconsts.listhreads"
|
|
msgid "Threads"
|
|
msgstr "Säikeet"
|
|
|
|
#: lazarusidestrconsts.listhreadscurrent
|
|
msgctxt "lazarusidestrconsts.listhreadscurrent"
|
|
msgid "Current"
|
|
msgstr "Nykyinen"
|
|
|
|
#: lazarusidestrconsts.listhreadsfunc
|
|
msgctxt "lazarusidestrconsts.listhreadsfunc"
|
|
msgid "Function"
|
|
msgstr "Funktio"
|
|
|
|
#: lazarusidestrconsts.listhreadsgoto
|
|
msgid "Goto"
|
|
msgstr "Mene"
|
|
|
|
#: lazarusidestrconsts.listhreadsline
|
|
msgctxt "lazarusidestrconsts.listhreadsline"
|
|
msgid "Line"
|
|
msgstr "Rivi"
|
|
|
|
#: lazarusidestrconsts.listhreadsnotevaluated
|
|
msgid "Threads not evaluated"
|
|
msgstr "Säikeitä ei arvioida"
|
|
|
|
#: lazarusidestrconsts.listhreadssrc
|
|
msgctxt "lazarusidestrconsts.listhreadssrc"
|
|
msgid "Source"
|
|
msgstr "Lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.listhreadsstate
|
|
msgctxt "lazarusidestrconsts.listhreadsstate"
|
|
msgid "State"
|
|
msgstr "Tila"
|
|
|
|
#: lazarusidestrconsts.listitle
|
|
msgid "&Title"
|
|
msgstr "&Otsikko"
|
|
|
|
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
|
|
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
|
|
msgstr "Tehtäväpalkin otsikko näyttää esim: project1.lpi - Lazarus"
|
|
|
|
#: lazarusidestrconsts.listitleleaveemptyfordefault
|
|
msgid "Title (leave empty for default)"
|
|
msgstr "Otsikko (oletusotsikko jos tyhjä)"
|
|
|
|
#: lazarusidestrconsts.listitleopencomponenticon24x24
|
|
msgid "Choose a component icon 24x24"
|
|
msgstr "Valitse komponentin kuvake 24x24"
|
|
|
|
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
|
|
msgid "Function: append path delimiter"
|
|
msgstr "Funktio: lisää polkuerotin"
|
|
|
|
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
|
|
msgid "Function: remove trailing path delimiter"
|
|
msgstr "Funktio: poista polkuerotin lopusta"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfileextension
|
|
msgid "Function: extract file extension"
|
|
msgstr "Funktio: erota tiedoston pääte"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameextension
|
|
msgid "Function: extract file name+extension"
|
|
msgstr "Funktio: erota tiedoston nimi ja pääte"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilenameonly
|
|
msgid "Function: extract file name only"
|
|
msgstr "Funktio: erota pelkkä tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.listmfunctionextractfilepath
|
|
msgid "Function: extract file path"
|
|
msgstr "Funktio: erota tiedoston polku"
|
|
|
|
#: lazarusidestrconsts.listmunknownmacro
|
|
msgid "(unknown macro: %s)"
|
|
msgstr "(tuntematon makro: %s)"
|
|
|
|
#: lazarusidestrconsts.listofpcpath
|
|
msgid "Path:"
|
|
msgstr "Polku:"
|
|
|
|
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
|
|
msgid "Toggle showing filenames with full path or with relative path"
|
|
msgstr "Vaihda näyttö tiedostojen täyden polun ja suhteellisen polun välillä"
|
|
|
|
#: lazarusidestrconsts.listoolbarconfiguration
|
|
msgid "Toolbar Configuration"
|
|
msgstr "Työkalupalkin asetukset"
|
|
|
|
#: lazarusidestrconsts.listoolbaroptions
|
|
msgid "Toolbar"
|
|
msgstr "Työkalupalkki"
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionshighlight
|
|
msgid "Highlight toolbars buttons"
|
|
msgstr "Korosta työkalupalkin napit"
|
|
|
|
#: lazarusidestrconsts.listoolbaroptionsraise
|
|
msgid "Raise toolbars"
|
|
msgstr "Nosta työkalupalkit"
|
|
|
|
#: lazarusidestrconsts.listoolhasnoexecutable
|
|
msgid "tool \"%s\" has no executable"
|
|
msgstr "työkalulla \"%s\" ei ole suoritettavaa ohjelmaa"
|
|
|
|
#: lazarusidestrconsts.listoolheaderfailed
|
|
msgid "Tool Header: Failed"
|
|
msgstr "Työkalu otsikko: Epäonnistui"
|
|
|
|
#: lazarusidestrconsts.listoolheaderrunning
|
|
msgid "Tool Header: Running"
|
|
msgstr "Työkalu otsikko: Suorittaa"
|
|
|
|
#: lazarusidestrconsts.listoolheaderscrolledup
|
|
msgid "Tool Header: Scrolled up"
|
|
msgstr "Työkalu otsikko: Rullattu ylös"
|
|
|
|
#: lazarusidestrconsts.listoolheadersuccess
|
|
msgid "Tool Header: Success"
|
|
msgstr "Työkalu otsikko: Onnistui"
|
|
|
|
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
|
|
msgid "tool stopped with exit code %s. Use context menu to get more information."
|
|
msgstr "työkalu lopetti koodilla %s. Lisää tietoa pikavalikosta."
|
|
|
|
#: lazarusidestrconsts.listop
|
|
msgctxt "lazarusidestrconsts.listop"
|
|
msgid "Top"
|
|
msgstr "Ylhäällä"
|
|
|
|
#: lazarusidestrconsts.listopanchoring
|
|
msgid "Top anchoring"
|
|
msgstr "Yläosan ankkurointi"
|
|
|
|
#: lazarusidestrconsts.listopborderspacespinedithint
|
|
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
|
|
msgstr "Yläpuolen reuna-alue. Tämä arvo lisätään yhteiseen reuna-alueeseen."
|
|
|
|
#: lazarusidestrconsts.listopinfoview
|
|
msgid "Show Class/Proc Hint"
|
|
msgstr "Näytä luokan/metodin vihje"
|
|
|
|
#: lazarusidestrconsts.listops
|
|
msgid "Tops"
|
|
msgstr "Yläreunat"
|
|
|
|
#: lazarusidestrconsts.listopsiblingcomboboxhint
|
|
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
|
|
msgstr "Tämä on naapurikontrolli, mihin yläreuna on ankkuroitu. Tyhjä tarkoittaa ankkurointia Delphi-tyyliin (BorderSpacing and ReferenceSide eivät vaikuta)."
|
|
|
|
#: lazarusidestrconsts.listopspaceequally
|
|
msgid "Top space equally"
|
|
msgstr "Tasaa välit ylhäällä"
|
|
|
|
#: lazarusidestrconsts.listotalpages
|
|
msgid "Total Pages: %s"
|
|
msgstr "Sivuja yhteensä: %s"
|
|
|
|
#: lazarusidestrconsts.listranslatetheenglishmessages
|
|
msgid "Translate the English Messages"
|
|
msgstr "Käännä englanninkieliset viestit"
|
|
|
|
#: lazarusidestrconsts.listreeneedsrefresh
|
|
msgid "Tree needs refresh"
|
|
msgstr "Puu pitää päivittää"
|
|
|
|
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
|
|
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
|
|
msgstr "Kahdella siirretyllä tiedostolla on sama nimi:%s%s%s%s%s %s:ssa"
|
|
|
|
#: lazarusidestrconsts.listypes
|
|
msgid "Types (not removed if no replacement)"
|
|
msgstr "Tyypit (ei poisteta vaikkei ole korvaavaa)"
|
|
|
|
#: lazarusidestrconsts.lisudadditionaldirectories
|
|
msgid "Additional directories:"
|
|
msgstr "Lisähakemistot:"
|
|
|
|
#: lazarusidestrconsts.lisudallpackageunits
|
|
msgid "All package units"
|
|
msgstr "Kaikki paketin käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisudallsourceeditorunits
|
|
msgid "All source editor units"
|
|
msgstr "Kaikki editorin käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisudallunits
|
|
msgid "All units"
|
|
msgstr "Kaikki käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
|
|
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
|
|
msgstr "Oletuksena vain projektin ja editorin käännösyksiköistä etsitään. Lisää tähän puolipisteellä erotettu luettelo hakemistoista, mistä myös etsitään."
|
|
|
|
#: lazarusidestrconsts.lisudcollapseallnodes
|
|
msgid "Collapse all nodes"
|
|
msgstr "Supista kaikki solmut"
|
|
|
|
#: lazarusidestrconsts.lisudexpandallnodes
|
|
msgid "Expand all nodes"
|
|
msgstr "Laajenna kaikki solmut"
|
|
|
|
#: lazarusidestrconsts.lisudfile
|
|
msgid "File: %s"
|
|
msgstr "Tiedosto: %s"
|
|
|
|
#: lazarusidestrconsts.lisudfilter
|
|
msgid "(Filter)"
|
|
msgstr "(Suodatin)"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses
|
|
msgid "Implementation Uses: %s"
|
|
msgstr "Toteutuksen uses-lause: %s"
|
|
|
|
#: lazarusidestrconsts.lisudimplementationuses2
|
|
msgid "implementation uses: %s"
|
|
msgstr "Toteutuksen uses-lause: %s"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses
|
|
msgid "Interface Uses: %s"
|
|
msgstr "Rajapinnan uses-lause: %s"
|
|
|
|
#: lazarusidestrconsts.lisudinterfaceuses2
|
|
msgid "interface uses: %s"
|
|
msgstr "Rajapinnan uses-lause: %s"
|
|
|
|
#: lazarusidestrconsts.lisudprojectsandpackages
|
|
msgid "Projects and packages"
|
|
msgstr "Projektit ja paketit"
|
|
|
|
#: lazarusidestrconsts.lisudscanning
|
|
msgid "Scanning ..."
|
|
msgstr "Tutkii ..."
|
|
|
|
#: lazarusidestrconsts.lisudscanningunits
|
|
msgid "Scanning: %s units ..."
|
|
msgstr "Tutkii: %s käännösyksikköä ..."
|
|
|
|
#: lazarusidestrconsts.lisudsearch
|
|
msgid "(Search)"
|
|
msgstr "(Etsi)"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
|
|
msgid "Find next occurrence of this phrase"
|
|
msgstr "Etsi tämän lauseen seuraava esiintymä"
|
|
|
|
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
|
|
msgid "Find next unit with this phrase"
|
|
msgstr "Etsi seuraava käännösyksikkö, missä tämä lause esiintyy"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
|
|
msgid "Find previous occurrence of this phrase"
|
|
msgstr "Etsi tämän lauseen edellinen esiintymä"
|
|
|
|
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
|
|
msgid "Find previous unit with this phrase"
|
|
msgstr "Etsi edellinen käännösyksikkö, missä tämä lause esiintyy"
|
|
|
|
#: lazarusidestrconsts.lisudselectedunits
|
|
msgid "Selected units"
|
|
msgstr "Valitut käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesfordirectories
|
|
msgid "Show nodes for directories"
|
|
msgstr "Näytä hakemistot solmuina"
|
|
|
|
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
|
|
msgid "Show nodes for project and packages"
|
|
msgstr "Näytä projektit ja paketit solmuina"
|
|
|
|
#: lazarusidestrconsts.lisudunits
|
|
msgid "Units"
|
|
msgstr "Käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.lisudunits2
|
|
msgid "Units: %s"
|
|
msgstr "Käännösyksiköt: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations
|
|
msgid "Used by Implementations: %s"
|
|
msgstr "Toteutus käyttää: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyimplementations2
|
|
msgid "used by implementations: %s"
|
|
msgstr "toteutus käyttää: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces
|
|
msgid "Used by Interfaces: %s"
|
|
msgstr "Rajapinta käyttää: %s"
|
|
|
|
#: lazarusidestrconsts.lisudusedbyinterfaces2
|
|
msgid "used by interfaces: %s"
|
|
msgstr "rajapinta käyttää: %s"
|
|
|
|
#: lazarusidestrconsts.lisuedonotsho
|
|
msgid "Do not show this message again."
|
|
msgstr "Älä näytä tätä viestiä uudelleen"
|
|
|
|
#: lazarusidestrconsts.lisueerrorinregularexpression
|
|
msgid "Error in regular expression"
|
|
msgstr "Virhe säännöllisessä lausekkeessa"
|
|
|
|
#: lazarusidestrconsts.lisuefontwith
|
|
msgid "Font without UTF-8"
|
|
msgstr "Fontti ilman UTF-8:aa"
|
|
|
|
#: lazarusidestrconsts.lisuegotoline
|
|
msgid "Goto line:"
|
|
msgstr "Hyppää riville:"
|
|
|
|
#: lazarusidestrconsts.lisuemodeseparator
|
|
msgid "/"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuenotfound
|
|
msgid "Not found"
|
|
msgstr "Ei löytynyt"
|
|
|
|
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
|
|
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
|
|
msgstr "Korvataanko tässä esiintyvä \"%s\"%s tekstillä \"%s\"?"
|
|
|
|
#: lazarusidestrconsts.lisuesearching
|
|
msgid "Searching: %s"
|
|
msgstr "Etsitään tiedostosta: %s"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
|
|
msgid "Continue search from the beginning?"
|
|
msgstr "Jatka etsimistä alusta?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringcontinueend
|
|
msgid "Continue search from the end?"
|
|
msgstr "Jatka etsimistä lopusta?"
|
|
|
|
#: lazarusidestrconsts.lisuesearchstringnotfound
|
|
msgid "Search string '%s' not found!"
|
|
msgstr "Etsittyä merkkijonoa '%s' ei löydetty!"
|
|
|
|
#: lazarusidestrconsts.lisuethecurre
|
|
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
|
|
msgstr "Nykyinen editorin kirjasin ei tue UTF-8-merkistöä, mutta käyttöjärjestelmä tukee sitä. %sTämä merkitsee sitä että ei-ASCII merkit voivat näkyä väärin.%sSopivamman kirjasimen voi valita editorin asetuksista."
|
|
|
|
#: lazarusidestrconsts.lisuiclearincludedbyreference
|
|
msgid "Clear include cache"
|
|
msgstr "Tyhjennä include-tiedostojen välimuisti"
|
|
|
|
#: lazarusidestrconsts.lisuidbytes
|
|
msgid "%s bytes"
|
|
msgstr "%s tavua"
|
|
|
|
#: lazarusidestrconsts.lisuidincludedby
|
|
msgid "Included by:"
|
|
msgstr "Luettu käännösyksiköihin:"
|
|
|
|
#: lazarusidestrconsts.lisuidinproject
|
|
msgid "In project:"
|
|
msgstr "Projektissa:"
|
|
|
|
#: lazarusidestrconsts.lisuidlines
|
|
msgctxt "lazarusidestrconsts.lisuidlines"
|
|
msgid "Lines:"
|
|
msgstr "Rivejä:"
|
|
|
|
#: lazarusidestrconsts.lisuidname
|
|
msgctxt "lazarusidestrconsts.lisuidname"
|
|
msgid "Name:"
|
|
msgstr "Nimi:"
|
|
|
|
#: lazarusidestrconsts.lisuidno
|
|
msgid "no"
|
|
msgstr "ei"
|
|
|
|
#: lazarusidestrconsts.lisuidsize
|
|
msgid "Size:"
|
|
msgstr "Koko:"
|
|
|
|
#: lazarusidestrconsts.lisuidtype
|
|
msgid "Type:"
|
|
msgstr "Tyyppi"
|
|
|
|
#: lazarusidestrconsts.lisuidyes
|
|
msgid "yes"
|
|
msgstr "kyllä"
|
|
|
|
#: lazarusidestrconsts.lisuishowcodetoolsvalues
|
|
msgid "Show CodeTools Values"
|
|
msgstr "Näytä CodeTools-arvot"
|
|
|
|
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
|
|
msgid "Unable convert binary stream to text"
|
|
msgstr "Binaarivirran muuttaminen tekstiksi ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
|
|
msgid "Unable copy components to clipboard"
|
|
msgstr "Komponenttien kopiointi leikepöydälle ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
|
|
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Resurssiotsikon kommentin lisääminen resurssitiedostoon %s\"%s\" ei onnistu.%sEhkä kielioppivirhe."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
|
|
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
|
|
msgstr "Resurssin T%s:FORMDATA lisääminen resurssitiedostoon %s\"%s\" ei onnistu.%sEhkä kielioppivirhe."
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
|
|
msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
|
|
msgstr "Riippuvuuden %s lisääminen ei onnistu, koska paketilla %s on jo riippuvuus %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
|
|
msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
|
|
msgstr "Riippuvuuden %s lisääminen ei onnistu, koska se synnyttäisi kehäriippuvuuden. %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
|
|
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
|
|
msgstr "%s:n lisääminen projektiin ei onnistu, koska projektissa on jo samanniminen tiedosto."
|
|
|
|
#: lazarusidestrconsts.lisunabletobackupfileto
|
|
msgid "Unable to backup file \"%s\" to \"%s\"!"
|
|
msgstr "Ei voida tehdä varmuuskopiota tiedostosta \"%s\" tiedostoon \"%s\"!"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeclassofto
|
|
msgid "%s%sUnable to change class of %s to %s"
|
|
msgstr "%s%sEi voida muuttaa luokkaa %s luokaksi %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
|
|
msgid "Unable to change project scaled in source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
|
|
msgid "Unable to change project title in source.%s%s"
|
|
msgstr "Ei voida muuttaa projektin otsikkoa lähdekoodissa.%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
|
|
msgid "Unable to clean up destination directory"
|
|
msgstr "Ei voida siivota kohdehakemistoa"
|
|
|
|
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
|
|
msgid "Unable to clean up \"%s\".%sPlease check permissions."
|
|
msgstr "Ei voida siivota \"%s\".%sTarkista oikeudet."
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
|
|
msgid "Unable to convert component text into binary format:%s%s"
|
|
msgstr "Ei voida muuntaa komponentin tekstiä binaariseksi:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconvertfileerror
|
|
msgid "Unable to convert file \"%s\"%sError: %s"
|
|
msgstr "Ei voida muuntaa tiedostoa \"%s\"%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
|
|
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
|
|
msgstr "Teksti-lomakedatan tiedostossa %s\"%s\"%sbinaarivuoksi ei onnistu. (%s)"
|
|
|
|
#: lazarusidestrconsts.lisunabletoconverttoencoding
|
|
msgid "Unable to convert to encoding \"%s\""
|
|
msgstr "Muunnos merkkikoodaukselle \"%s\" ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfile
|
|
msgid "Unable to copy file"
|
|
msgstr "Tiedoston kopiointi ei onnistunut"
|
|
|
|
#: lazarusidestrconsts.lisunabletocopyfileto
|
|
msgid "Unable to copy file \"%s\"%sto \"%s\""
|
|
msgstr "Tiedoston \"%s\"%skopiointi ei onnistunut tiedostoksi \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
|
|
msgid "Unable to create backup directory \"%s\"."
|
|
msgstr "Backup-hakemiston \"%s\" luominen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatedirectory
|
|
msgid "Unable to create directory \"%s\"."
|
|
msgstr "Hakemiston \"%s\" luominen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile
|
|
msgid "Unable to create file"
|
|
msgstr "Tiedoston luominen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile2
|
|
msgid "Unable to create file \"%s\""
|
|
msgstr "Tiedoston \"%s\" luominen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatefile3
|
|
msgid "Unable to create file%s\"%s\""
|
|
msgstr "Tiedoston%s\"%s\" luominen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
|
|
msgid "Unable to create link \"%s\" with target \"%s\""
|
|
msgstr "Linkin \"%s\" luominen kohteeseen \"%s\" ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
|
|
msgid "Unable to create new file, because there is already a directory with this name."
|
|
msgstr "Tiedoston luominen ei onnistu, koska samanniminen hakemisto on jo olemassa."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatenewmethod
|
|
msgid "Unable to create new method."
|
|
msgstr "Uuden metodin luominen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
|
|
msgid "Unable to create temporary lfm buffer."
|
|
msgstr "Väliaikaisen lfm bufferin luominen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletodelete
|
|
msgid "Unable to delete"
|
|
msgstr "Poistaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
|
|
msgid "Unable to delete ambiguous file \"%s\""
|
|
msgstr "Ristiriitaisen tiedoston \"%s\" poistaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoexecute
|
|
msgid "unable to execute: %s"
|
|
msgstr "ei voi suorittaa: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
|
|
msgid "Unable to find a ResourceString section in this or any of the used units."
|
|
msgstr "Resurssitekstin osiota ei löydy tästä eikä muista käännösyksiköistä."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
|
|
msgid "Unable to find a valid classname in \"%s\""
|
|
msgstr "Kelvollista luokkanimeä ei löydy \"%s\":ssa"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfile
|
|
msgid "Unable to find file \"%s\"."
|
|
msgstr "Ei löydetä tiedostoa \"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
|
|
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
|
|
msgstr "Tiedostoa \"%s\" ei löydy.%sJos se kuuluu projektiin, tarkista hakupolku%sProjekti -> Kääntäjän asetukset -> Hakupolut -> Muut lähdekoodit. Jos se kuuluu pakettiin, tarkista vastaavasti paketin kääntäjän asetukset. Jos se kuuluu Lazarukseen, käännä kaikki (siivoa ja kokoa). Jos se kuuluu FPC:hen, tarkista fpc.cfg. Jos olet epävarma, tarkista Projekti -> Kääntäjän asetukset -> Testi-nappi"
|
|
|
|
#: lazarusidestrconsts.lisunabletofindinlfmstream
|
|
msgid "Unable to find %s in LFM Stream."
|
|
msgstr "%s ei löydy LFM virrasta."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindmethod
|
|
msgid "Unable to find method."
|
|
msgstr "Metodia ei löydy."
|
|
|
|
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
|
|
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
|
|
msgstr "Ei löydy Pascal-käännösyksikköä (.pas,.pp) .lfm-tiedostolle%s\"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
|
|
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
|
|
msgstr "Komponenttiluokkaa \"%s\" ei löydy.%sSitä ei ole rekisteröity RegisterClass funktion kautta eikä lfm:ää löydy.%sSitä tarvitsee käännösyksikkö:%s%s"
|
|
|
|
#: lazarusidestrconsts.lisunabletogathereditorchanges
|
|
msgid "Unable to gather editor changes."
|
|
msgstr "Editorin muutosten kokoaminen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
|
|
msgid "Unable to get source for designer."
|
|
msgstr "Lomakkeen lähdekoodia ei löydy."
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadfile2
|
|
msgid "unable to load file %s: %s"
|
|
msgstr "Tiedoston %s: %s lataaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadpackage
|
|
msgid "Unable to load package \"%s\""
|
|
msgstr "Paketin \"%s\" lataaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
|
|
msgid "Unable to load the component class \"%s\", because it depends on itself."
|
|
msgstr "Komponenttiluokan \"%s\" lataaminen ei onnistu, koska sillä on riippuvuus itseensä."
|
|
|
|
#: lazarusidestrconsts.lisunabletoopen
|
|
msgid "Unable to open \"%s\""
|
|
msgstr "Ei voi avata \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
|
|
msgid "Unable to open ancestor component"
|
|
msgstr "Kantakomponentin avaaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
|
|
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
|
|
msgstr "Lomake-editorin avaaminen ei onnistu.%sLuokka %s ei periydy sopivasta luokasta kuten TForm tai TDataModule."
|
|
|
|
#: lazarusidestrconsts.lisunabletoread
|
|
msgid "Unable to read %s"
|
|
msgstr "%s:n lukeminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile
|
|
msgid "Unable to read file"
|
|
msgstr "Tiedoston lukeminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfile2
|
|
msgid "Unable to read file \"%s\"."
|
|
msgstr "Tiedoston \"%s\" lukeminen ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadfileerror
|
|
msgid "Unable to read file \"%s\"%sError: %s"
|
|
msgstr "Tiedoston \"%s\" lukeminen ei onnistu%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadlpi
|
|
msgid "Unable to read lpi"
|
|
msgstr "lpi:n lukeminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
|
|
msgid "unable to read process ExitStatus"
|
|
msgstr "Prosessin ExitStatus lukeminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
|
|
msgid "Unable to read the project info file%s\"%s\"."
|
|
msgstr "Projektin lukeminen ei onnistu tiedostoon%s\"%s\"."
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
|
|
msgid "Unable to remove old backup file \"%s\"!"
|
|
msgstr "Vanhan varmuuskopion \"%s\" poisto ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
|
|
msgid "Unable to remove project scaled from source.%s%s"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
|
|
msgid "Unable to remove project title from source.%s%s"
|
|
msgstr "Projektin otsikon %s%s poisto ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
|
|
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
|
|
msgstr "Ristiriitaisen tiedoston \"%s\"%s nimeäminen \"%s\":ksi ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefile
|
|
msgid "Unable to rename file"
|
|
msgstr "Tiedoston nimeäminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto
|
|
msgid "Unable to rename file \"%s\" to \"%s\"!"
|
|
msgstr "Tiedoston \"%s\" nimeäminen \"%s\":ksi ei onnistu!"
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamefileto2
|
|
msgid "Unable to rename file \"%s\"%sto \"%s\"."
|
|
msgstr "Tiedoston \"%s\"%snimeäminen \"%s\":ksi ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenameforminsource
|
|
msgid "Unable to rename form in source."
|
|
msgstr "Lomakkeen nimeäminen lähdekoodissa ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
|
|
msgid "Unable to rename method. Please fix the error shown in the message window."
|
|
msgstr "Metodin nimeäminen ei onnistu. Korjaa viesti-ikkunassa näkyvä virhe."
|
|
|
|
#: lazarusidestrconsts.lisunabletorenamevariableinsource
|
|
msgid "Unable to rename variable in source."
|
|
msgstr "Muutujan nimeäminen lähdekoodissa ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletorun
|
|
msgid "Unable to run"
|
|
msgstr "Suoritus ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletorun2
|
|
msgid "Unable to run \"%s\""
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
|
|
msgid "Unable to set AnchorSide Control"
|
|
msgstr "Ankkurikontrollin asettaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletoshowmethod
|
|
msgid "Unable to show method."
|
|
msgstr "Metodin näyttäminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
|
|
msgid "Unable to stream selected components"
|
|
msgstr "Valittujen komponenttien kirjoittaminen virtaan ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
|
|
msgid "Unable to stream selected components."
|
|
msgstr "Valittujen komponenttien kirjoittaminen virtaan ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletostreamt
|
|
msgid "Unable to stream %s:T%s."
|
|
msgstr "%s:T%s kirjoittaminen virtaan ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
|
|
msgid "Unable to transform binary component stream of %s:T%s into text."
|
|
msgstr "%s:T%s binaari komponenttivuon muuttaminen tekstiksi ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
|
|
msgid "Unable to update CreateForm statement in project source"
|
|
msgstr "CreateForm lausekkeen päivitys projektin lähdekoodissa ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletowrite2
|
|
msgid "Unable to write \"%s\""
|
|
msgstr "\"%s\":n kirjoittaminen ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile
|
|
msgid "Unable to write file"
|
|
msgstr "Tallentaminen tiedostoon ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefile2
|
|
msgid "Unable to write file \"%s\"."
|
|
msgstr "Kirjoittaminen tiedostoon \"%s\" ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletowritefileerror
|
|
msgid "Unable to write file \"%s\"%sError: %s"
|
|
msgstr "Tallentaminen tiedostoon \"%s\" ei onnistu%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
|
|
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
|
|
msgstr "Tallentaminen projektin infotiedostoon%s\"%s\" ei onnistu%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
|
|
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
|
|
msgstr "Tallentaminen projektin istuntotiedostoon%s\"%s\" ei onnistu%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisunabletowritetofile2
|
|
msgid "Unable to write to file \"%s\"."
|
|
msgstr "Kirjoittaminen tiedostoon \"%s\" ei onnistu."
|
|
|
|
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
|
|
msgid "Unable to write xml stream to %s%sError: %s"
|
|
msgstr "Xml vuon kirjoittaminen tiedostoon %s ei onnistu%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisuncheckall
|
|
msgid "Uncheck All"
|
|
msgstr "Poista valinta kaikista"
|
|
|
|
#: lazarusidestrconsts.lisundo
|
|
msgctxt "lazarusidestrconsts.lisundo"
|
|
msgid "Undo"
|
|
msgstr "Kumoa"
|
|
|
|
#: lazarusidestrconsts.lisuninstall
|
|
msgid "Uninstall %s"
|
|
msgstr "Poista %s:n asennus"
|
|
|
|
#: lazarusidestrconsts.lisuninstallimpossible
|
|
msgid "Uninstall impossible"
|
|
msgstr "Asennuksen poisto on mahdotonta"
|
|
|
|
#: lazarusidestrconsts.lisuninstallselection
|
|
msgid "Uninstall selection"
|
|
msgstr "Poista asennuksesta"
|
|
|
|
#: lazarusidestrconsts.lisunit
|
|
msgctxt "lazarusidestrconsts.lisunit"
|
|
msgid "Unit"
|
|
msgstr "Käännösyksikkö"
|
|
|
|
#: lazarusidestrconsts.lisunithaschangedsave
|
|
msgid "Unit \"%s\" has changed. Save?"
|
|
msgstr "Käännösyksikkö \"%s\" on muuttunut. Talletetaanko?"
|
|
|
|
#: lazarusidestrconsts.lisunitidentifierexists
|
|
msgid "Unit identifier exists"
|
|
msgstr "Käännösyksikön tunniste on olemassa"
|
|
|
|
#: lazarusidestrconsts.lisunitinpackage
|
|
msgid "%s unit %s in package %s"
|
|
msgstr "%s käännösyksikkö %s paketissa %s"
|
|
|
|
#: lazarusidestrconsts.lisunitnamealreadyexistscap
|
|
msgid "Unitname already in project"
|
|
msgstr "Tätä käännösyksikön nimeä käytetään jo projektissa"
|
|
|
|
#: lazarusidestrconsts.lisunitnamebeginswith
|
|
msgid "Unit name begins with ..."
|
|
msgstr "Käännösyksikön nimi alkaa ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnamecontains
|
|
msgid "Unit name contains ..."
|
|
msgstr "Käännösyksikön nimi sisältää ..."
|
|
|
|
#: lazarusidestrconsts.lisunitnotfound
|
|
msgid "unit %s not found"
|
|
msgstr "käännösyksikköä %s ei löydy"
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundatnewposition
|
|
msgid "unit %s not found at new position \"%s\""
|
|
msgstr "käännösyksikköä %s ei löydy uudesta paikasta \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisunitnotfoundinproject
|
|
msgid "A unit not found in project %s"
|
|
msgstr "Käännösyksikköä ei löydy projektista %s"
|
|
|
|
#: lazarusidestrconsts.lisunitoutputdirectory
|
|
msgid "Unit Output directory"
|
|
msgstr "Käännösyksiköiden kirjoitushakemisto"
|
|
|
|
#: lazarusidestrconsts.lisunitpath
|
|
msgid "unit path"
|
|
msgstr "Käännösyksiköiden polku"
|
|
|
|
#: lazarusidestrconsts.lisunitpaths
|
|
msgid "Unit paths"
|
|
msgstr "Käännösyksiköiden polut"
|
|
|
|
#: lazarusidestrconsts.lisunitrequirespackage
|
|
msgid "unit %s requires package %s"
|
|
msgstr "käännösyksikkö %s riippuu paketista %s"
|
|
|
|
#: lazarusidestrconsts.lisunitsnotfoundinproject
|
|
msgid "Units not found in project %s"
|
|
msgstr "Käännösyksiköitä ei löydy projektista %s"
|
|
|
|
#: lazarusidestrconsts.lisunsigned
|
|
msgid "Unsigned"
|
|
msgstr "Etumerkitön"
|
|
|
|
#: lazarusidestrconsts.lisunusedunitsof
|
|
msgid "Unused units of %s"
|
|
msgstr "%s:n käyttämättömät yksiköt"
|
|
|
|
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
|
|
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
|
|
msgstr "Epätavallinen kääntäjän nimi. Yleensä se alkaa fpc, ppc tai ppcross."
|
|
|
|
#: lazarusidestrconsts.lisup
|
|
msgctxt "lazarusidestrconsts.lisup"
|
|
msgid "Up"
|
|
msgstr "Ylös"
|
|
|
|
#: lazarusidestrconsts.lisupdateinfo
|
|
msgid "Update info"
|
|
msgstr "Päivitä tiedot"
|
|
|
|
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
|
|
msgid "Update other procedure signatures when only letter case has changed"
|
|
msgstr "Päivitä muut aliohjelman määritykset, kun vain kirjainten koko on muuttunut"
|
|
|
|
#: lazarusidestrconsts.lisupdatereferences
|
|
msgid "Update references?"
|
|
msgstr "Päivitetäänkö viittaukset?"
|
|
|
|
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
|
|
msgid "Updating PO files failed for package %s"
|
|
msgstr "PO tiedostojen päivitys epäonnistui paketille %s"
|
|
|
|
#: lazarusidestrconsts.lisupgrade
|
|
msgid "Upgrade"
|
|
msgstr "Päivitä"
|
|
|
|
#: lazarusidestrconsts.lisupgradeconfiguration
|
|
msgid "Upgrade configuration"
|
|
msgstr "Päivitä asetukset"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestring
|
|
msgid "uppercase string"
|
|
msgstr "muuta isoiksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
|
|
#, fuzzy
|
|
#| msgid "Uppercase string given as parameter"
|
|
msgid "Uppercase string given as parameter."
|
|
msgstr "muuta parametrina annettu merkkijono isoiksi kirjaimiksi"
|
|
|
|
#: lazarusidestrconsts.lisurlonwikithebaseurlis
|
|
msgid "URL on wiki (the base url is %s)"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisusagemessagehoption
|
|
msgid "Usage message (-h option)"
|
|
msgstr "Käyttöopastus (-h valinta)"
|
|
|
|
#: lazarusidestrconsts.lisuse
|
|
msgid "Use"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lisuseansistrings
|
|
msgctxt "lazarusidestrconsts.lisuseansistrings"
|
|
msgid "Use Ansistrings"
|
|
msgstr "Käytä Ansistringia"
|
|
|
|
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
|
|
msgid "Use CheckBox for Boolean values"
|
|
msgstr "Käytä CheckBox:ia Boolean tyypille"
|
|
|
|
#: lazarusidestrconsts.lisusecommentsincustomoptions
|
|
msgid "Use comments in custom options"
|
|
msgstr "Käytä kommentteja mukautetuissa asetuksissa"
|
|
|
|
#: lazarusidestrconsts.lisusedby
|
|
msgid " used by %s"
|
|
msgstr " %s käyttää"
|
|
|
|
#: lazarusidestrconsts.lisusedesigntimepackages
|
|
msgid "Use design time packages"
|
|
msgstr "Käytä suunnittelupaketteja"
|
|
|
|
#: lazarusidestrconsts.lisusedforautocreatedforms
|
|
msgid "Used for auto-created forms."
|
|
msgstr "Automaattisesti luodut lomakkeet käyttävät."
|
|
|
|
#: lazarusidestrconsts.lisuseexcludefilter
|
|
msgid "Use exclude filter"
|
|
msgstr "Käytä poissulkevaa suodatinta"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifier
|
|
msgid "Use identifier"
|
|
msgstr "Käytä tunnistetta"
|
|
|
|
#: lazarusidestrconsts.lisuseidentifierinat
|
|
msgid "Use identifier %s in %s at %s"
|
|
msgstr "Käytä tunnistetta %s %s:ssa %s:n kanssa"
|
|
|
|
#: lazarusidestrconsts.lisuseincludefilter
|
|
msgid "Use include filter"
|
|
msgstr "Käytä mukaan ottavaa suodatinta"
|
|
|
|
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
|
|
msgid "Launching application"
|
|
msgstr "Käynnistävä ohjelma"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage
|
|
msgid "Use package %s in package %s"
|
|
msgstr "Käytä pakettia %s paketissa %s"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinpackage2
|
|
msgid "Use package in package"
|
|
msgstr "Käytä pakettia paketissa"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject
|
|
msgid "Use package %s in project"
|
|
msgstr "Käytä pakettia %s projektissa"
|
|
|
|
#: lazarusidestrconsts.lisusepackageinproject2
|
|
msgid "Use package in project"
|
|
msgstr "Käytä pakettia projektissa"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
|
|
msgid "Add to list \"%s\""
|
|
msgstr "Lisää luetteloon \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
|
|
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
|
|
msgid "User defined text markup"
|
|
msgstr "Käyttäjän määrittelemä tekstin merkkaus"
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
|
|
msgid "Remove from list \"%s\""
|
|
msgstr "Poista luettelosta \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
|
|
msgid "Toggle on list \"%s\""
|
|
msgstr "Vaihda luettelosta \"%s\""
|
|
|
|
#: lazarusidestrconsts.lisusershomedirectory
|
|
msgid "User's home directory"
|
|
msgstr "Käyttäjän kotihakemisto"
|
|
|
|
#: lazarusidestrconsts.lisuseunit
|
|
msgid "Add Unit to Uses Section"
|
|
msgstr "Lisää käännösyksikkö uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.lisuseunitinunit
|
|
msgid "Use unit %s in unit %s"
|
|
msgstr "Käytä käännösyksikköä %s käännösyksikössä %s"
|
|
|
|
#: lazarusidestrconsts.lisutf8withbom
|
|
msgid "UTF-8 with BOM"
|
|
msgstr "UTF-8 BOM:n kanssa"
|
|
|
|
#: lazarusidestrconsts.lisvalue
|
|
msgctxt "lazarusidestrconsts.lisvalue"
|
|
msgid "Value"
|
|
msgstr "Arvo"
|
|
|
|
#: lazarusidestrconsts.lisvalue2
|
|
msgid "Value%s"
|
|
msgstr "Arvo%s"
|
|
|
|
#: lazarusidestrconsts.lisvalue3
|
|
msgid "Value: "
|
|
msgstr "Arvo: "
|
|
|
|
#: lazarusidestrconsts.lisvalues
|
|
msgid "Values"
|
|
msgstr "Arvot"
|
|
|
|
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
|
|
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
|
|
msgstr "Arvot jotka eroavat oletuksista talletetaan .lfm tiedostoon ja näytetään eri lailla Komponenttimuokkaimessa."
|
|
|
|
#: lazarusidestrconsts.lisvariable
|
|
msgctxt "lazarusidestrconsts.lisvariable"
|
|
msgid "Variable"
|
|
msgstr "Muuttuja"
|
|
|
|
#: lazarusidestrconsts.lisverbose
|
|
msgctxt "lazarusidestrconsts.lisverbose"
|
|
msgid "Verbose"
|
|
msgstr "Monisanainen"
|
|
|
|
#: lazarusidestrconsts.lisverifymethodcalls
|
|
msgid "Verify method calls"
|
|
msgstr "Tarkista metodikutsut"
|
|
|
|
#: lazarusidestrconsts.lisversion
|
|
msgid "Version"
|
|
msgstr "Versio"
|
|
|
|
#: lazarusidestrconsts.lisversionmismatch
|
|
msgid "Version mismatch"
|
|
msgstr "Versiot eivät täsmää"
|
|
|
|
#: lazarusidestrconsts.lisvertical
|
|
msgid "Vertical"
|
|
msgstr "Pystysuunta"
|
|
|
|
#: lazarusidestrconsts.lisvertoclipboard
|
|
msgid "Copy version information to clipboard"
|
|
msgstr "Kopioi versiotieto leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.lisveryverbose
|
|
msgid "Very Verbose"
|
|
msgstr "Hyvin monisanainen"
|
|
|
|
#: lazarusidestrconsts.lisviewbreakpointproperties
|
|
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
|
|
msgid "Breakpoint Properties ..."
|
|
msgstr "Keskeytyskohdan ominaisuudet ..."
|
|
|
|
#: lazarusidestrconsts.lisviewsource
|
|
msgid "View Source"
|
|
msgstr "Näytä lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.lisviewsourcedisass
|
|
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
|
|
msgid "View Assembler"
|
|
msgstr "Näytä assembler"
|
|
|
|
#: lazarusidestrconsts.lisviewsourcelfm
|
|
msgid "View Source (.lfm)"
|
|
msgstr "Näytä lomakkeen koodi (.lfm)"
|
|
|
|
#: lazarusidestrconsts.liswarning
|
|
msgid "Warning: "
|
|
msgstr "Varoitus: "
|
|
|
|
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
|
|
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
|
|
msgstr "Varoitus: ristiriitainen tiedosto löytyi: \"%s\". Lähdekooditiedosto on: \"%s\""
|
|
|
|
#: lazarusidestrconsts.liswarnings
|
|
msgid ", Warnings: %s"
|
|
msgstr ", Varoituksia: %s"
|
|
|
|
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
|
|
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
|
|
msgstr "%sVaroitus: Tämä on pääkäännösyksikkö. Uusi pää-käännösyksikkö tulee olemaan %s.pas."
|
|
|
|
#: lazarusidestrconsts.liswatch
|
|
msgid "&Watch"
|
|
msgstr "&Vahti"
|
|
|
|
#: lazarusidestrconsts.liswatchdata
|
|
msgid "Watch:"
|
|
msgstr "Vahti:"
|
|
|
|
#: lazarusidestrconsts.liswatchkind
|
|
msgid "Watch action"
|
|
msgstr "Vahtitoiminto"
|
|
|
|
#: lazarusidestrconsts.liswatchkindread
|
|
msgid "Read"
|
|
msgstr "Lue"
|
|
|
|
#: lazarusidestrconsts.liswatchkindreadwrite
|
|
msgid "Read/Write"
|
|
msgstr "Lue/kirjoita"
|
|
|
|
#: lazarusidestrconsts.liswatchkindwrite
|
|
msgid "Write"
|
|
msgstr "Kirjoita"
|
|
|
|
#: lazarusidestrconsts.liswatchpoint
|
|
msgid "&Data/Watch Breakpoint ..."
|
|
msgstr "&Tieto/Vahti keskeytyskohta ..."
|
|
|
|
#: lazarusidestrconsts.liswatchpointbreakpoint
|
|
msgid "&Data/watch Breakpoint ..."
|
|
msgstr "&Tieto/Vahti keskeytyskohta ..."
|
|
|
|
#: lazarusidestrconsts.liswatchpropert
|
|
msgid "Watch Properties"
|
|
msgstr "Vahdin ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.liswatchscope
|
|
msgid "Watch scope"
|
|
msgstr "Vahdin ulottuvuus"
|
|
|
|
#: lazarusidestrconsts.liswatchscopeglobal
|
|
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
|
|
msgid "Global"
|
|
msgstr "Kaiken kattava"
|
|
|
|
#: lazarusidestrconsts.liswatchscopelocal
|
|
msgid "Declaration"
|
|
msgstr "Julistus"
|
|
|
|
#: lazarusidestrconsts.liswatchtowatchpoint
|
|
msgid "Create &Data/Watch Breakpoint ..."
|
|
msgstr "Luo &Tieto/Vahti keskeytyskohta ..."
|
|
|
|
#: lazarusidestrconsts.liswelcometolazaruside
|
|
msgid "Welcome to Lazarus IDE %s"
|
|
msgstr "Tervetuloa Lazarus IDE:en %s"
|
|
|
|
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
|
|
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
|
|
msgstr "Tervetuloa Lazarus versioon %s%sVersion %s asetukset löytyvät hakemistosta%s%s"
|
|
|
|
#: lazarusidestrconsts.liswhatneedsbuilding
|
|
msgid "What needs building"
|
|
msgstr "Mitä tarvitsee koota"
|
|
|
|
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
|
|
msgid "When a unit is renamed, update references"
|
|
msgstr "Käännösyksikön nimeä muutettaessa päivitetään viittaukset"
|
|
|
|
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
|
|
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
|
|
msgstr "Nykyiset asetukset talletetaan malliksi, mitä käytetään luotaessa uusia projekteja"
|
|
|
|
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
|
|
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
|
|
msgid "When the source editor cursor moves, show the current node in the code explorer"
|
|
msgstr "Kun kursori liikkuu lähdekoodissa, näytä aktiivinen solmu koodin tutkijassa"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
|
|
msgid "Window menu shows designed form's name instead of caption"
|
|
msgstr "Ikkunat-valikko näyttää muokattavan lomakkeen nimen otsikon sijaan"
|
|
|
|
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
|
|
msgid "Useful especially if the caption is left empty."
|
|
msgstr "Hyödyllinen varsinkin jos otsikko jätetään tyhjäksi."
|
|
|
|
#: lazarusidestrconsts.liswindowstaysontop
|
|
msgid "Window stays on top"
|
|
msgstr "Ikkuna pysyy ylimmäisenä"
|
|
|
|
#: lazarusidestrconsts.liswithincludes2
|
|
msgid ", with includes "
|
|
msgstr ", includes-tiedostojen kanssa "
|
|
|
|
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
|
|
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
|
|
msgstr "Ilman toimivaa kääntäjää koodin selailu ja käännös tuottavat pettymyksen."
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
|
|
msgid "Without a proper debugger, debugging will be disappointing."
|
|
msgstr "Virheiden jäljitys onnistuu huonosti ilman virheenjäljitintä."
|
|
|
|
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
|
|
msgid "Without a proper Lazarus directory you will get a lot of warnings."
|
|
msgstr "Ilman oikeaa Lazarus-hakemistoa tulee paljon varoituksia."
|
|
|
|
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
|
|
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
|
|
msgstr "Ilman toimivaa \"make\" ohjelmaa IDEä ei voi kääntää."
|
|
|
|
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
|
|
msgid "Without the proper FPC sources code browsing and completion will be very limited."
|
|
msgstr "Ilman oikeita FPC lähdekoodeja koodin selailu ja täydennys toimivat vain rajoitetusti."
|
|
|
|
#: lazarusidestrconsts.liswithrequiredpackages
|
|
msgid "With required packages"
|
|
msgstr "Tarvittavien pakettien kanssa"
|
|
|
|
#: lazarusidestrconsts.liswldeleteall
|
|
msgid "De&lete All"
|
|
msgstr "&Poista kaikki"
|
|
|
|
#: lazarusidestrconsts.liswldisableall
|
|
msgid "D&isable All"
|
|
msgstr "&Estä kaikki"
|
|
|
|
#: lazarusidestrconsts.liswlenableall
|
|
msgid "E&nable All"
|
|
msgstr "&Salli kaikki"
|
|
|
|
#: lazarusidestrconsts.liswlexpression
|
|
msgid "Expression"
|
|
msgstr "Lauseke"
|
|
|
|
#: lazarusidestrconsts.liswlinspectpane
|
|
msgid "Inspect pane"
|
|
msgstr "Tarkastusosa"
|
|
|
|
#: lazarusidestrconsts.liswlproperties
|
|
msgid "&Properties"
|
|
msgstr "&Ominaisuudet"
|
|
|
|
#: lazarusidestrconsts.liswlwatchlist
|
|
msgid "Watch List"
|
|
msgstr "Vahtiluettelo"
|
|
|
|
#: lazarusidestrconsts.liswordatcursorincurrenteditor
|
|
msgid "Word at cursor in current editor"
|
|
msgstr "Aktiivisen editorin kursorin kohdalla oleva sana"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
|
|
msgid "Working directory for building"
|
|
msgstr "Työhakemisto kokoamista varten"
|
|
|
|
#: lazarusidestrconsts.lisworkingdirectoryforrun
|
|
msgid "Working directory for run"
|
|
msgstr "Työhakemisto suoritusta varten"
|
|
|
|
#: lazarusidestrconsts.liswriteerror
|
|
msgid "Write Error"
|
|
msgstr "Tiedoston tallentaminen ei onnistunut"
|
|
|
|
#: lazarusidestrconsts.liswriteerrorfile
|
|
msgid "Write error: %s%sFile: %s%s%s"
|
|
msgstr "Virhe kirjoittaessa: %s%sTiedosto: %s%s%s"
|
|
|
|
#: lazarusidestrconsts.liswrongversionin
|
|
msgid "wrong version in %s: %s"
|
|
msgstr "väärä versio %s: %s"
|
|
|
|
#: lazarusidestrconsts.lisxmlerror
|
|
msgid "XML Error"
|
|
msgstr "XML-virhe"
|
|
|
|
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
|
|
msgid "XML parser error in file %s%sError: %s"
|
|
msgstr "XML jäsentäjän virhe tiedostossa %s%sVirhe: %s"
|
|
|
|
#: lazarusidestrconsts.lisyes
|
|
msgid "Yes"
|
|
msgstr "Kyllä"
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
|
|
msgid "You can disable this for individual forms via the package editor"
|
|
msgstr "Tämän voi estää yksittäisille lomakkeille pakettimuokkaimessa"
|
|
|
|
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
|
|
msgid "You can disable this for individual forms via the popup menu in the project inspector"
|
|
msgstr "Tämän voi estää yksittäisille lomakkeille projektinhallinnan paikallisvalikosta"
|
|
|
|
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
|
|
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
|
|
msgstr "FPC ja sen lähdekoodit löytyvät: http://sourceforge.net/projects/lazarus/?source=directory"
|
|
|
|
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
|
|
msgid "You cannot build Lazarus while debugging or compiling."
|
|
msgstr "Lazarusta ei voi koota kun ohjelmaa ajetaan tai käännetään."
|
|
|
|
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
|
|
msgid "You can select items by simply pressing underscored letters"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.lis_all_
|
|
msgctxt "lazarusidestrconsts.lis_all_"
|
|
msgid "<All>"
|
|
msgstr "<Kaikki>"
|
|
|
|
#: lazarusidestrconsts.locwndsrceditor
|
|
msgctxt "lazarusidestrconsts.locwndsrceditor"
|
|
msgid "Source Editor"
|
|
msgstr "Lähdekoodieditori"
|
|
|
|
#: lazarusidestrconsts.lrsplddeleteselected
|
|
msgid "Delete selected"
|
|
msgstr "Poista valittu"
|
|
|
|
#: lazarusidestrconsts.lrspldinvalid
|
|
msgid "invalid"
|
|
msgstr "kelvoton"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfileinvalid
|
|
msgid "lpk file invalid (%s)"
|
|
msgstr "lpk-tiedosto on kelvoton (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldlpkfilevalid
|
|
msgid "lpk file valid (%s)"
|
|
msgstr "lpk-tiedosto on kelvollinen (%s)"
|
|
|
|
#: lazarusidestrconsts.lrspldunabletodeletefile
|
|
msgid "Unable to delete file \"%s\""
|
|
msgstr "Tiedoston \"%s\" poisto ei onnistu"
|
|
|
|
#: lazarusidestrconsts.lrspldvalid
|
|
msgid "valid"
|
|
msgstr "kelvollinen"
|
|
|
|
#: lazarusidestrconsts.lrsrescanlplfiles
|
|
msgid "Rescan lpl files"
|
|
msgstr "Käy läpi lpl tiedostot"
|
|
|
|
#: lazarusidestrconsts.podaddpackageunittousessection
|
|
msgid "Add package unit to uses section"
|
|
msgstr "Lisää paketin käännösyksikkö uses-lauseeseen"
|
|
|
|
#: lazarusidestrconsts.regdlgbinary
|
|
msgctxt "lazarusidestrconsts.regdlgbinary"
|
|
msgid "Binary"
|
|
msgstr "Binaari"
|
|
|
|
#: lazarusidestrconsts.regdlgdecimal
|
|
msgctxt "lazarusidestrconsts.regdlgdecimal"
|
|
msgid "Decimal"
|
|
msgstr "Decimaali"
|
|
|
|
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
|
|
msgid "Display type for selected Registers"
|
|
msgstr "Näyttö valituille rekistereille"
|
|
|
|
#: lazarusidestrconsts.regdlgformat
|
|
msgid "Format"
|
|
msgstr "Muoto"
|
|
|
|
#: lazarusidestrconsts.regdlghex
|
|
msgid "Hex"
|
|
msgstr "Hexa"
|
|
|
|
#: lazarusidestrconsts.regdlgoctal
|
|
msgid "Octal"
|
|
msgstr "Oktaali"
|
|
|
|
#: lazarusidestrconsts.regdlgraw
|
|
msgid "Raw"
|
|
msgstr "Raaka"
|
|
|
|
#: lazarusidestrconsts.rsaddinverse
|
|
msgid "Add Inverse"
|
|
msgstr "Lisää käänteinen"
|
|
|
|
#: lazarusidestrconsts.rsattachto
|
|
msgid "Attach to"
|
|
msgstr "Kiinnitä"
|
|
|
|
#: lazarusidestrconsts.rsattributes
|
|
msgid "Attributes"
|
|
msgstr "Määritteet"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
|
|
msgid "Automatically increase build number"
|
|
msgstr "Kasvata koonnan numeroa automaattisesti"
|
|
|
|
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
|
|
msgid "Increased every time the project is compiled."
|
|
msgstr "Kasvaa aina kun projekti käännetään."
|
|
|
|
#: lazarusidestrconsts.rsbuild
|
|
msgid "&Build:"
|
|
msgstr "&Käännä:"
|
|
|
|
#: lazarusidestrconsts.rscharacterset
|
|
msgid "Character set:"
|
|
msgstr "Merkkijoukko:"
|
|
|
|
#: lazarusidestrconsts.rsclosecurrentpage
|
|
msgid "Close current page"
|
|
msgstr "Sulje käytössä oleva välilehti"
|
|
|
|
#: lazarusidestrconsts.rsconditionaldefines
|
|
msgid "Conditional defines"
|
|
msgstr "Ehdolliset määritteet"
|
|
|
|
#: lazarusidestrconsts.rscreatenewdefine
|
|
msgid "Create new define"
|
|
msgstr "Luo uusi määrite"
|
|
|
|
#: lazarusidestrconsts.rsenablei18n
|
|
msgid "Enable i18n"
|
|
msgstr "Salli kansainvälistäminen"
|
|
|
|
#: lazarusidestrconsts.rsenterpid
|
|
msgid "Enter PID"
|
|
msgstr "Anna PID"
|
|
|
|
#: lazarusidestrconsts.rsfilterthelistwithstring
|
|
msgid "Filter the lines in list with a string"
|
|
msgstr "Suodata luettelon rivit tekstillä"
|
|
|
|
#: lazarusidestrconsts.rsfoundbutnotlistedhere
|
|
msgid "Found, but not listed here: "
|
|
msgstr "Löytyi, muttei ole luettelossa: "
|
|
|
|
#: lazarusidestrconsts.rsi18nexcluded
|
|
msgid "Excluded"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextcompile
|
|
msgid "Force update PO files on next compile"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18nidentifiers
|
|
msgid "Identifiers:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsi18noptions
|
|
msgid "i18n Options"
|
|
msgstr "Kansainvälisyysasetukset"
|
|
|
|
#: lazarusidestrconsts.rsi18noriginals
|
|
msgid "Originals:"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfohint
|
|
msgid "Version info is stored if the executable format supports it."
|
|
msgstr "Versiotieto talletetaan jos ohjelmatiedoston formaatti tukee sitä."
|
|
|
|
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
|
|
msgid "Include version info in executable"
|
|
msgstr "Lisää versiotieto suoritettavaan ohjelmaan"
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnnameshint
|
|
msgid "Column Names"
|
|
msgstr "Sarakenimet"
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnstrategyhint
|
|
msgid "Strategy for saving Columns"
|
|
msgstr "Sarakkeiden tallennuksen strategia"
|
|
|
|
#: lazarusidestrconsts.rsiwpcolumnwidthhint
|
|
msgid "Column Width"
|
|
msgstr "Sarakeleveys"
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometry
|
|
msgid "Custom geometry"
|
|
msgstr "Mukautetut mitat"
|
|
|
|
#: lazarusidestrconsts.rsiwpcustomgeometryhint
|
|
msgid "User can define window's position and size"
|
|
msgstr "Käyttäjä voi määritellä ikkunan sijainnin ja koon"
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometry
|
|
msgid "Fixed default geometry"
|
|
msgstr "Kiinteät oletusmitat"
|
|
|
|
#: lazarusidestrconsts.rsiwpfixeddefaultgeometryhint
|
|
msgid "Always the same fixed position and size"
|
|
msgstr "Aina sama kiinteä sijainti ja koko"
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecide
|
|
msgid "Let windowmanager decide"
|
|
msgstr "Anna ikkunamanagerin päättää"
|
|
|
|
#: lazarusidestrconsts.rsiwpletwindowmanagerdecidehint
|
|
msgid "System windowmanagers have different strategies for positioning windows"
|
|
msgstr "Järjestelmillä on eri strategiat ikkunoiden sijoittamiseen"
|
|
|
|
#: lazarusidestrconsts.rsiwppositionwindowlisthint
|
|
msgid "Windows that have been open. They may be closed now."
|
|
msgstr "Auki olleet ikkunat. Ne pitää nyt sulkea."
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometry
|
|
msgid "Restore window geometry"
|
|
msgstr "Palauta ikkunan mitat"
|
|
|
|
#: lazarusidestrconsts.rsiwprestorewindowgeometryhint
|
|
msgid "Use previous position and size"
|
|
msgstr "Käytä edellistä sijaintia ja kokoa"
|
|
|
|
#: lazarusidestrconsts.rsiwpsplittercustomposition
|
|
msgid "Custom Size"
|
|
msgstr "Mukautettu koko"
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterdefault
|
|
msgid "Default Size"
|
|
msgstr "Oletuskoko"
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterfollowwindow
|
|
msgid "Restore with window"
|
|
msgstr "Palauta ikkunan kanssa"
|
|
|
|
#: lazarusidestrconsts.rsiwpsplitterrestorewindowgeometry
|
|
msgid "Restore Size"
|
|
msgstr "Palauta koko"
|
|
|
|
#: lazarusidestrconsts.rslanguageafrikaans
|
|
msgid "Afrikaans"
|
|
msgstr "afrikaans"
|
|
|
|
#: lazarusidestrconsts.rslanguagearabic
|
|
msgid "Arabic"
|
|
msgstr "arabia"
|
|
|
|
#: lazarusidestrconsts.rslanguageautomatic
|
|
msgid "Automatic (or English)"
|
|
msgstr "Oletuskieli (tai englanti)"
|
|
|
|
#: lazarusidestrconsts.rslanguagecatalan
|
|
msgid "Catalan"
|
|
msgstr "katalaani"
|
|
|
|
#: lazarusidestrconsts.rslanguagechinese
|
|
msgid "Chinese"
|
|
msgstr "kiina"
|
|
|
|
#: lazarusidestrconsts.rslanguageczech
|
|
msgid "Czech"
|
|
msgstr "tsekki"
|
|
|
|
#: lazarusidestrconsts.rslanguagedutch
|
|
msgid "Dutch"
|
|
msgstr "hollanti"
|
|
|
|
#: lazarusidestrconsts.rslanguageenglish
|
|
msgid "English"
|
|
msgstr "englanti"
|
|
|
|
#: lazarusidestrconsts.rslanguagefinnish
|
|
msgid "Finnish"
|
|
msgstr "suomi"
|
|
|
|
#: lazarusidestrconsts.rslanguagefrench
|
|
msgid "French"
|
|
msgstr "ranska"
|
|
|
|
#: lazarusidestrconsts.rslanguagegerman
|
|
msgid "German"
|
|
msgstr "saksa"
|
|
|
|
#: lazarusidestrconsts.rslanguagehebrew
|
|
msgid "Hebrew"
|
|
msgstr "heprea"
|
|
|
|
#: lazarusidestrconsts.rslanguagehungarian
|
|
msgid "Hungarian"
|
|
msgstr "unkari"
|
|
|
|
#: lazarusidestrconsts.rslanguageindonesian
|
|
msgid "Indonesian"
|
|
msgstr "indonesia"
|
|
|
|
#: lazarusidestrconsts.rslanguageitalian
|
|
msgid "Italian"
|
|
msgstr "italia"
|
|
|
|
#: lazarusidestrconsts.rslanguagejapanese
|
|
msgid "Japanese"
|
|
msgstr "japani"
|
|
|
|
#: lazarusidestrconsts.rslanguagelithuanian
|
|
msgid "Lithuanian"
|
|
msgstr "liettua"
|
|
|
|
#: lazarusidestrconsts.rslanguageoptions
|
|
msgid "Language options"
|
|
msgstr "Kielivalinnat"
|
|
|
|
#: lazarusidestrconsts.rslanguagepolish
|
|
msgid "Polish"
|
|
msgstr "puola"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguese
|
|
msgid "Portuguese"
|
|
msgstr "portugali"
|
|
|
|
#: lazarusidestrconsts.rslanguageportuguesebr
|
|
msgid "Brazilian Portuguese"
|
|
msgstr "Brasilian portugali"
|
|
|
|
#: lazarusidestrconsts.rslanguagerussian
|
|
msgid "Russian"
|
|
msgstr "venäjä"
|
|
|
|
#: lazarusidestrconsts.rslanguageselection
|
|
msgid "Language selection:"
|
|
msgstr "Kielen valinta:"
|
|
|
|
#: lazarusidestrconsts.rslanguageslovak
|
|
msgid "Slovak"
|
|
msgstr "slovakki"
|
|
|
|
#: lazarusidestrconsts.rslanguagespanish
|
|
msgid "Spanish"
|
|
msgstr "espanja"
|
|
|
|
#: lazarusidestrconsts.rslanguageturkish
|
|
msgid "Turkish"
|
|
msgstr "turkki"
|
|
|
|
#: lazarusidestrconsts.rslanguageukrainian
|
|
msgid "Ukrainian"
|
|
msgstr "ukraina"
|
|
|
|
#: lazarusidestrconsts.rsmajorversion
|
|
msgid "&Major version:"
|
|
msgstr "&Iso versio:"
|
|
|
|
#: lazarusidestrconsts.rsminorversion
|
|
msgid "Mi&nor version:"
|
|
msgstr "&Pieni versio:"
|
|
|
|
#: lazarusidestrconsts.rsotherinfo
|
|
msgid "Other info"
|
|
msgstr "Muuta tietoa"
|
|
|
|
#: lazarusidestrconsts.rspooutputdirectory
|
|
msgid "PO Output Directory:"
|
|
msgstr "PO-kirjoitushakemisto"
|
|
|
|
#: lazarusidestrconsts.rsresource
|
|
msgid "Resource"
|
|
msgstr "Resurssi"
|
|
|
|
#: lazarusidestrconsts.rsresourceclear
|
|
msgid "Delete all resources?"
|
|
msgstr "Poistetaanko kaikki resurssit?"
|
|
|
|
#: lazarusidestrconsts.rsresourcefilename
|
|
msgid "File name"
|
|
msgstr "Tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.rsresourcetype
|
|
msgctxt "lazarusidestrconsts.rsresourcetype"
|
|
msgid "Type"
|
|
msgstr "Tyyppi"
|
|
|
|
#: lazarusidestrconsts.rsrevision
|
|
msgid "&Revision:"
|
|
msgstr "&Revisio:"
|
|
|
|
#: lazarusidestrconsts.rsselectaninheritedentry
|
|
msgid "Select an inherited entry"
|
|
msgstr "Valitse periytyvä kohta"
|
|
|
|
#: lazarusidestrconsts.rsstartanewsearch
|
|
msgid "Start a new search"
|
|
msgstr "Aloita uusi etsintä"
|
|
|
|
#: lazarusidestrconsts.rsversionnumbering
|
|
msgid "Version numbering"
|
|
msgstr "Versionumerointi"
|
|
|
|
#: lazarusidestrconsts.srkmcarhelpmenu
|
|
msgid "Help menu commands"
|
|
msgstr "Ohjevalikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatcmdcmd
|
|
msgid "Command commands"
|
|
msgstr "Komentojen komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatcodetools
|
|
msgid "CodeTools commands"
|
|
msgstr "CodeTools-komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatcolselection
|
|
msgid "Text column selection commands"
|
|
msgstr "Tekstisarakkeen valintakomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatcursormoving
|
|
msgid "Cursor moving commands"
|
|
msgstr "Kursorin siirtokomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatediting
|
|
msgid "Text editing commands"
|
|
msgstr "Tekstin muokkauskomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatfilemenu
|
|
msgid "File menu commands"
|
|
msgstr "Tiedostovalikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatfold
|
|
msgid "Text folding commands"
|
|
msgstr "Tekstin laskostuskomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatmacrorecording
|
|
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
|
|
msgid "Macros"
|
|
msgstr "Makrot"
|
|
|
|
#: lazarusidestrconsts.srkmcatmarker
|
|
#, fuzzy
|
|
#| msgid "Text marker commands"
|
|
msgid "Text bookmark commands"
|
|
msgstr "Tekstin merkkauskomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatmulticaret
|
|
msgid "Multi caret commands"
|
|
msgstr "Moni-osoitin komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatpackagemenu
|
|
msgid "Package menu commands"
|
|
msgstr "Pakettivalikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatprojectmenu
|
|
msgid "Project menu commands"
|
|
msgstr "Projektivalikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatrunmenu
|
|
msgid "Run menu commands"
|
|
msgstr "Suorita-valikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatsearchreplace
|
|
msgid "Text search and replace commands"
|
|
msgstr "Tekstin etsintä- ja korvauskomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatselection
|
|
msgid "Text selection commands"
|
|
msgstr "Tekstin valintakomennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatsrcnotebook
|
|
msgid "Source Notebook commands"
|
|
msgstr "Lähdekoodieditorin komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroedit
|
|
msgid "Syncron Editing"
|
|
msgstr "Tahdistettu muokkaus"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditoff
|
|
msgid "Syncron Editing (not in Cell)"
|
|
msgstr "Tahdistettu muokkaus (ei solussa)"
|
|
|
|
#: lazarusidestrconsts.srkmcatsyncroeditsel
|
|
msgid "Syncron Editing (while selecting)"
|
|
msgstr "Tahdistettu muokkaus (valittaessa)"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateedit
|
|
msgid "Template Editing"
|
|
msgstr "Mallineen muokkaus"
|
|
|
|
#: lazarusidestrconsts.srkmcattemplateeditoff
|
|
msgid "Template Editing (not in Cell)"
|
|
msgstr "Mallineen muokkaus (ei solussa)"
|
|
|
|
#: lazarusidestrconsts.srkmcattoolmenu
|
|
msgid "Tools menu commands"
|
|
msgstr "Työkaluvalikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcatviewmenu
|
|
msgid "View menu commands"
|
|
msgstr "Näytä valikon komennot"
|
|
|
|
#: lazarusidestrconsts.srkmcommand
|
|
msgctxt "lazarusidestrconsts.srkmcommand"
|
|
msgid "Command:"
|
|
msgstr "Komento:"
|
|
|
|
#: lazarusidestrconsts.srkmconflic
|
|
msgid "Conflict "
|
|
msgstr "Ristiriita"
|
|
|
|
#: lazarusidestrconsts.srkmecabortbuild
|
|
msgid "abort build"
|
|
msgstr "keskeytä kokoaminen"
|
|
|
|
#: lazarusidestrconsts.srkmecabstractmethods
|
|
msgid "Abstract Methods ..."
|
|
msgstr "Abstraktit metodit ..."
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpaddress
|
|
msgid "add address breakpoint"
|
|
msgstr "lisää keskeytyskohta osoitteeseen"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpsource
|
|
msgid "add source breakpoint"
|
|
msgstr "lisää keskeytyskohta lähdekoodiin"
|
|
|
|
#: lazarusidestrconsts.srkmecaddbpwatchpoint
|
|
msgid "add data/watchpoint"
|
|
msgstr "lisää data/vahtipiste"
|
|
|
|
#: lazarusidestrconsts.srkmecaddjumppoint
|
|
msgid "Add Jump Point"
|
|
msgstr "Lisää hyppypiste"
|
|
|
|
#: lazarusidestrconsts.srkmecaddwatch
|
|
msgid "add watch"
|
|
msgstr "lisää vahti"
|
|
|
|
#: lazarusidestrconsts.srkmecattach
|
|
msgid "Attach to program"
|
|
msgstr "Liitä ohjelmaan"
|
|
|
|
#: lazarusidestrconsts.srkmecautocompletion
|
|
msgid "Code template completion"
|
|
msgstr "Koodimallineen täydennys"
|
|
|
|
#: lazarusidestrconsts.srkmecblockcopy
|
|
msgid "Copy Block"
|
|
msgstr "Kopioi lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblockdelete
|
|
msgid "Delete Block"
|
|
msgstr "Poista lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotobegin
|
|
msgid "Goto Block begin"
|
|
msgstr "Mene lohkon alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmecblockgotoend
|
|
msgid "Goto Block end"
|
|
msgstr "Mene lohkon loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmecblockhide
|
|
msgid "Hide Block"
|
|
msgstr "Piilota lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblockindent
|
|
msgid "Indent block"
|
|
msgstr "Sisennä lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblockmove
|
|
msgid "Move Block"
|
|
msgstr "Siirrä lohkoa"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetbegin
|
|
msgid "Set block begin"
|
|
msgstr "Aseta lohkon alku"
|
|
|
|
#: lazarusidestrconsts.srkmecblocksetend
|
|
msgid "Set block end"
|
|
msgstr "Aseta lohkon loppu"
|
|
|
|
#: lazarusidestrconsts.srkmecblockshow
|
|
msgid "Show Block"
|
|
msgstr "Näytä lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblocktogglehide
|
|
msgid "Toggle block"
|
|
msgstr "Vaihda lohko"
|
|
|
|
#: lazarusidestrconsts.srkmecblockunindent
|
|
msgid "Unindent block"
|
|
msgstr "Poista lohkon sisennys"
|
|
|
|
#: lazarusidestrconsts.srkmecbuild
|
|
msgid "build program/project"
|
|
msgstr "Kokoa ohjelma / projekti"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildfile
|
|
msgid "build file"
|
|
msgstr "Kokoa tiedosto"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildlazarus
|
|
msgid "Build Lazarus"
|
|
msgstr "Kokoa Lazarus"
|
|
|
|
#: lazarusidestrconsts.srkmecbuildmanymodes
|
|
msgid "build many modes"
|
|
msgstr "kokoa monta moodia"
|
|
|
|
#: lazarusidestrconsts.srkmecchar
|
|
msgid "Char"
|
|
msgstr "Merkki"
|
|
|
|
#: lazarusidestrconsts.srkmeccleanupandbuild
|
|
msgid "clean up and build"
|
|
msgstr "siivoa ja kokoa"
|
|
|
|
#: lazarusidestrconsts.srkmecclearall
|
|
msgid "Delete whole text"
|
|
msgstr "Poista koko teksti"
|
|
|
|
#: lazarusidestrconsts.srkmecclearallbookmark
|
|
msgid "Clear all Bookmarks"
|
|
msgstr "Tyhjennä kaikki kirjanmerkit"
|
|
|
|
#: lazarusidestrconsts.srkmecclearbookmarkforfile
|
|
msgid "Clear Bookmarks for current file"
|
|
msgstr "Tyhjennä nykyisen tiedoston kirjanmerkit"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseldown
|
|
msgid "Column Select Down"
|
|
msgstr "Sarake valinta alas"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditorbottom
|
|
msgid "Column Select to absolute end"
|
|
msgstr "Sarake valinta aivan loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmeccolseleditortop
|
|
msgid "Column Select to absolute beginning"
|
|
msgstr "Sarake valinta aivan alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselleft
|
|
msgid "Column Select Left"
|
|
msgstr "Sarake valinta vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellineend
|
|
msgid "Column Select Line End"
|
|
msgstr "Sarake valinta rivin loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinestart
|
|
msgid "Column Select Line Start"
|
|
msgstr "Sarake valinta rivin alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmeccolsellinetextstart
|
|
msgid "Column Select to text start in line"
|
|
msgstr "Sarake valinta rivin alussa olevaan tekstiin"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagebottom
|
|
msgid "Column Select Page Bottom"
|
|
msgstr "Sarake valinta viimeinen sivu"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagedown
|
|
msgid "Column Select Page Down"
|
|
msgstr "Sarake valinta sivu alas"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpagetop
|
|
msgid "Column Select Page Top"
|
|
msgstr "Sarake valinta ensimmäinen sivu"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselpageup
|
|
msgid "Column Select Page Up"
|
|
msgstr "Sarake valinta sivu ylös"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselright
|
|
msgid "Column Select Right"
|
|
msgstr "Sarake valinta oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselup
|
|
msgid "Column Select Up"
|
|
msgstr "Sarake valinta ylös"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordleft
|
|
msgid "Column Select Word Left"
|
|
msgstr "Sarake valinta sana vasemmalla"
|
|
|
|
#: lazarusidestrconsts.srkmeccolselwordright
|
|
msgid "Column Select Word Right"
|
|
msgstr "Sarake valinta sana oikealla"
|
|
|
|
#: lazarusidestrconsts.srkmeccolumnselect
|
|
msgid "Column selection mode"
|
|
msgstr "Sarake valintatila"
|
|
|
|
#: lazarusidestrconsts.srkmeccompile
|
|
msgid "compile program/project"
|
|
msgstr "käännä ohjelma/projekti"
|
|
|
|
#: lazarusidestrconsts.srkmecconfigbuildfile
|
|
msgid "config build file"
|
|
msgstr "configuroi kokoa tiedosto"
|
|
|
|
#: lazarusidestrconsts.srkmeccopy
|
|
#, fuzzy
|
|
#| msgid "Copy selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccopy"
|
|
msgid "Copy"
|
|
msgstr "Kopioi valinta leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornewwindow
|
|
msgid "Copy editor to new window"
|
|
msgstr "Kopioi editori uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditornextwindow
|
|
msgid "Copy editor to next free window"
|
|
msgstr "Kopioi editori seuraavaan vapaaseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
|
|
msgid "Copy editor to prior free window"
|
|
msgstr "Kopioi editori edelliseen vapaaseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmeccut
|
|
#, fuzzy
|
|
#| msgid "Cut selection to clipboard"
|
|
msgctxt "lazarusidestrconsts.srkmeccut"
|
|
msgid "Cut"
|
|
msgstr "Leikkaa valinta leikepöydälle"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletebol
|
|
msgid "Delete to beginning of line"
|
|
msgstr "Poista rivin alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletechar
|
|
msgid "Delete char at cursor"
|
|
msgstr "Poista kirjain kursorin kohdasta"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteeol
|
|
msgid "Delete to end of line"
|
|
msgstr "Poista kursorin kohdasta rivin loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastchar
|
|
msgid "Delete Last Char"
|
|
msgstr "Poista edellinen kirjain"
|
|
|
|
#: lazarusidestrconsts.srkmecdeletelastword
|
|
msgid "Delete to start of word"
|
|
msgstr "Poista edellinen sana"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteline
|
|
msgid "Delete current line"
|
|
msgstr "Poista tämä rivi"
|
|
|
|
#: lazarusidestrconsts.srkmecdeleteword
|
|
msgid "Delete to end of word"
|
|
msgstr "Poista seuraava sana"
|
|
|
|
#: lazarusidestrconsts.srkmecdetach
|
|
msgid "Detach from program"
|
|
msgstr "Irrota ohjelmasta"
|
|
|
|
#: lazarusidestrconsts.srkmecdiff
|
|
msgctxt "lazarusidestrconsts.srkmecdiff"
|
|
msgid "Diff"
|
|
msgstr "Eroavuudet"
|
|
|
|
#: lazarusidestrconsts.srkmecdown
|
|
msgid "Move cursor down"
|
|
msgstr "Siirrä kursori alas"
|
|
|
|
#: lazarusidestrconsts.srkmeceditorbottom
|
|
msgid "Move cursor to absolute end"
|
|
msgstr "Siirrä kursori aivan loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmeceditortop
|
|
msgid "Move cursor to absolute beginning"
|
|
msgstr "Siirrä kursori aivan alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmecemptymethods
|
|
msgid "Empty Methods ..."
|
|
msgstr "Tyhjät metodit ..."
|
|
|
|
#: lazarusidestrconsts.srkmecenvironmentoptions
|
|
msgid "IDE options"
|
|
msgstr "IDE-asetukset"
|
|
|
|
#: lazarusidestrconsts.srkmecevaluate
|
|
msgid "evaluate/modify"
|
|
msgstr "arvioi/muuta"
|
|
|
|
#: lazarusidestrconsts.srkmecextractproc
|
|
msgctxt "lazarusidestrconsts.srkmecextractproc"
|
|
msgid "Extract Procedure"
|
|
msgstr "Erota aliohjelma"
|
|
|
|
#: lazarusidestrconsts.srkmecexttool
|
|
msgid "External tool %d"
|
|
msgstr "Ulkoinen työkalu %d"
|
|
|
|
#: lazarusidestrconsts.srkmecexttoolsettings
|
|
msgid "External tools settings"
|
|
msgstr "Ulkoisten työkalujen asetukset"
|
|
|
|
#: lazarusidestrconsts.srkmecfind
|
|
msgid "Find Text"
|
|
msgstr "Etsi tekstiä"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockotherend
|
|
msgid "Find block other end"
|
|
msgstr "Etsi lohkon toinen pää"
|
|
|
|
#: lazarusidestrconsts.srkmecfindblockstart
|
|
msgid "Find block start"
|
|
msgstr "Etsi lohkon alku"
|
|
|
|
#: lazarusidestrconsts.srkmecfinddeclaration
|
|
msgid "Find Declaration"
|
|
msgstr "Etsi määrittely"
|
|
|
|
#: lazarusidestrconsts.srkmecfindidentifierrefs
|
|
msgid "Find Identifier References"
|
|
msgstr "Etsi viittauksia tunnisteisiin"
|
|
|
|
#: lazarusidestrconsts.srkmecfindinfiles
|
|
msgid "Find in Files"
|
|
msgstr "Etsi tiedostoista"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnext
|
|
msgctxt "lazarusidestrconsts.srkmecfindnext"
|
|
msgid "Find Next"
|
|
msgstr "Etsi seuraava"
|
|
|
|
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
|
|
msgid "Find Next Word Occurrence"
|
|
msgstr "Etsi sanan seuraava esiintymiskohta"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloads
|
|
msgid "Find Overloads"
|
|
msgstr "Etsi Overload-metodit"
|
|
|
|
#: lazarusidestrconsts.srkmecfindoverloadscapt
|
|
msgid "Find Overloads ..."
|
|
msgstr "Etsi Overload-metodit ..."
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevious
|
|
msgid "Find Previous"
|
|
msgstr "Etsi edellinen"
|
|
|
|
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
|
|
msgid "Find Previous Word Occurrence"
|
|
msgstr "Etsi sanan edellinen esiintymiskohta"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduredefinition
|
|
msgid "Find Procedure Definiton"
|
|
msgstr "Etsi aliohjelman määritys"
|
|
|
|
#: lazarusidestrconsts.srkmecfindproceduremethod
|
|
msgid "Find Procedure Method"
|
|
msgstr "Etsi aliohjelman toteutus"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldcurrent
|
|
msgid "Fold at Cursor"
|
|
msgstr "Laskosta kursorin kohdalta"
|
|
|
|
#: lazarusidestrconsts.srkmecfoldlevel
|
|
msgid "Fold to Level %d"
|
|
msgstr "Laskosta tasolle %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoeditor
|
|
msgid "Go to editor %d"
|
|
msgstr "Siirry muokkaimeen %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoincludedirective
|
|
msgid "Go to include directive of current include file"
|
|
msgstr "Siirry riville, mistä tämä include-tiedosto on luettu"
|
|
|
|
#: lazarusidestrconsts.srkmecgotolinenumber
|
|
msgid "Go to Line Number"
|
|
msgstr "Siirry riville"
|
|
|
|
#: lazarusidestrconsts.srkmecgotomarker
|
|
msgid "Go to bookmark %d"
|
|
msgstr "Siirry merkkiin %d"
|
|
|
|
#: lazarusidestrconsts.srkmecgotoxy
|
|
msgid "Goto XY"
|
|
msgstr "Siirry XY"
|
|
|
|
#: lazarusidestrconsts.srkmecguessmisplacedifdef
|
|
msgid "Guess Misplaced $IFDEF"
|
|
msgstr "Arvaa väärin sijoitettu $IFDEF"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordleft
|
|
msgid "Move cursor part-word left (e.g. CamelCase)"
|
|
msgstr "Siirrä kursori osa sanasta vasemmalle (esim. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmechalfwordright
|
|
msgid "Move cursor part-word right (e.g. CamelCase)"
|
|
msgstr "Siirrä kursori osa sanasta oikealle (esim. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecimestr
|
|
msgid "Ime Str"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecinsertchangelogentry
|
|
msgid "Insert ChangeLog entry"
|
|
msgstr "Lisää muutoslokiin tapahtuma"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcharacter
|
|
msgid "Insert from Charactermap"
|
|
msgstr "Lisää merkkikartasta"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsauthor
|
|
msgid "Insert CVS keyword Author"
|
|
msgstr "Aseta CVS:n avainsana Author"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsdate
|
|
msgid "Insert CVS keyword Date"
|
|
msgstr "Aseta CVS:n avainsana Date"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsheader
|
|
msgid "Insert CVS keyword Header"
|
|
msgstr "Aseta CVS:n avainsana Header"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsid
|
|
msgid "Insert CVS keyword ID"
|
|
msgstr "Aseta CVS:n avainsana ID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvslog
|
|
msgid "Insert CVS keyword Log"
|
|
msgstr "Aseta CVS:n avainsana Log"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsname
|
|
msgid "Insert CVS keyword Name"
|
|
msgstr "Aseta CVS:n avainsana Name"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvsrevision
|
|
msgid "Insert CVS keyword Revision"
|
|
msgstr "Aseta CVS:n avainsana Revision"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertcvssource
|
|
msgid "Insert CVS keyword Source"
|
|
msgstr "Aseta CVS:n avainsana Source"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertdatetime
|
|
msgid "Insert current date and time"
|
|
msgstr "Aseta nykyinen päiväys ja aika"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertfilename
|
|
msgid "Insert Full Filename"
|
|
msgstr "Aseta koko tiedostonimi"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnotice
|
|
msgid "Insert GPL notice"
|
|
msgstr "Lisää GPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
|
|
msgid "Insert GPL notice (translated)"
|
|
msgstr "Lisää GPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertguid
|
|
msgid "Insert a GUID"
|
|
msgstr "Lisää GUID"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnotice
|
|
msgid "Insert LGPL notice"
|
|
msgstr "Lisää LGPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
|
|
msgid "Insert LGPL notice (translated)"
|
|
msgstr "Lisää LGPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertline
|
|
msgid "Break line, leave cursor"
|
|
msgstr "Rivinvaihto ilman kursorinsiirtoa"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnotice
|
|
msgid "Insert MIT notice"
|
|
msgstr "Lisää MIT ilmoitus"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
|
|
msgid "Insert MIT notice (translated)"
|
|
msgstr "Lisää MIT ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmode
|
|
msgid "Insert Mode"
|
|
msgstr "Lisäysmoodi"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
|
|
msgid "Insert modified LGPL notice"
|
|
msgstr "Lisää muokattu LGPL-ilmoitus"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
|
|
msgid "Insert modified LGPL notice (translated)"
|
|
msgstr "Lisää muokattu LGPL-ilmoitus (käännetty)"
|
|
|
|
#: lazarusidestrconsts.srkmecinsertusername
|
|
msgid "Insert current username"
|
|
msgstr "Lisä nykyisen käyttäjän nimi"
|
|
|
|
#: lazarusidestrconsts.srkmecinspect
|
|
msgid "inspect"
|
|
msgstr "tutki"
|
|
|
|
#: lazarusidestrconsts.srkmecinvertassignment
|
|
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Käännä asettaminen"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapleft
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
|
|
msgid "Left"
|
|
msgstr "Vasen"
|
|
|
|
#: lazarusidestrconsts.srkmeckeymapright
|
|
msgctxt "lazarusidestrconsts.srkmeckeymapright"
|
|
msgid "Right"
|
|
msgstr "Oikea"
|
|
|
|
#: lazarusidestrconsts.srkmecleft
|
|
msgid "Move cursor left"
|
|
msgstr "Siirrä kursori vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmeclinebreak
|
|
msgid "Break line and move cursor"
|
|
msgstr "Rivinvaihto ja siirrä kursoria"
|
|
|
|
#: lazarusidestrconsts.srkmeclineend
|
|
msgid "Move cursor to line end"
|
|
msgstr "Siirrä kursori rivin loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmeclineselect
|
|
msgid "Line selection mode"
|
|
msgstr "Rivin valintamoodi"
|
|
|
|
#: lazarusidestrconsts.srkmeclinestart
|
|
msgid "Move cursor to line start"
|
|
msgstr "Siirrä kursori rivin alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmeclinetextstart
|
|
msgid "Move cursor to text start in line"
|
|
msgstr "Siirrä kursori rivillä olevan tekstin alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmeclockeditor
|
|
msgid "Lock Editor"
|
|
msgstr "Lukitse editori"
|
|
|
|
#: lazarusidestrconsts.srkmecmakeresourcestring
|
|
msgid "Make Resource String"
|
|
msgstr "Tee 'Resource String'"
|
|
|
|
#: lazarusidestrconsts.srkmecmatchbracket
|
|
msgid "Go to matching bracket"
|
|
msgstr "Siirry vastaavaan sulkumerkkiin"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleft
|
|
msgid "Move editor left"
|
|
msgstr "Siirrä editori vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorleftmost
|
|
msgid "Move editor leftmost"
|
|
msgstr "Siirrä editori vasempaan reunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornewwindow
|
|
msgid "Move editor to new window"
|
|
msgstr "Siirrä editori uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditornextwindow
|
|
msgid "Move editor to next free window"
|
|
msgstr "Siirrä editori seuraavaan vapaaseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
|
|
msgid "Move editor to prior free window"
|
|
msgstr "Siirrä editori edelliseen vapaaseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorright
|
|
msgid "Move editor right"
|
|
msgstr "Siirrä editori oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecmoveeditorrightmost
|
|
msgid "Move editor rightmost"
|
|
msgstr "Siirrä editori oikeaan reunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecmultipaste
|
|
#, fuzzy
|
|
#| msgid "MultiPaste clipboard to current position"
|
|
msgctxt "lazarusidestrconsts.srkmecmultipaste"
|
|
msgid "MultiPaste"
|
|
msgstr "MoniLiitä leikepöytä nykyiseen sijaintiin"
|
|
|
|
#: lazarusidestrconsts.srkmecnextbookmark
|
|
msgid "Next Bookmark"
|
|
msgstr "Seuraava kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditor
|
|
msgid "Go to next editor"
|
|
msgstr "Mene seuraavan editoriin"
|
|
|
|
#: lazarusidestrconsts.srkmecnexteditorinhistory
|
|
msgid "Go to next editor in history"
|
|
msgstr "Mene seuraavaan editoriin historiassa"
|
|
|
|
#: lazarusidestrconsts.srkmecnextsharededitor
|
|
msgid "Go to next editor with same Source"
|
|
msgstr "Mene seuraavaan samansisältöiseen editoriin"
|
|
|
|
#: lazarusidestrconsts.srkmecnextwindow
|
|
msgid "Go to next window"
|
|
msgstr "Mene seuraavaan ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecnormalselect
|
|
msgid "Normal selection mode"
|
|
msgstr "Normaali valintamoodi"
|
|
|
|
#: lazarusidestrconsts.srkmecopenfileatcursor
|
|
msgid "Open File at Cursor"
|
|
msgstr "Avaa kursorin osoittama tiedosto"
|
|
|
|
#: lazarusidestrconsts.srkmecoverwritemode
|
|
msgid "Overwrite Mode"
|
|
msgstr "Ylikirjoitusmoodi"
|
|
|
|
#: lazarusidestrconsts.srkmecpagebottom
|
|
msgid "Move cursor to bottom of page"
|
|
msgstr "Siirrä kursori sivun loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmecpagedown
|
|
msgid "Move cursor down one page"
|
|
msgstr "Siirrä kursoria sivu alas"
|
|
|
|
#: lazarusidestrconsts.srkmecpageleft
|
|
msgid "Move cursor left one page"
|
|
msgstr "Siirrä kursoria sivu vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecpageright
|
|
msgid "Move cursor right one page"
|
|
msgstr "Siirrä kursoria sivu oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecpagetop
|
|
msgid "Move cursor to top of page"
|
|
msgstr "Siirrä kursori sivun alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmecpageup
|
|
msgid "Move cursor up one page"
|
|
msgstr "Siirrä kursoria sivu ylös"
|
|
|
|
#: lazarusidestrconsts.srkmecpaste
|
|
#, fuzzy
|
|
#| msgid "Paste clipboard to current position"
|
|
msgctxt "lazarusidestrconsts.srkmecpaste"
|
|
msgid "Paste"
|
|
msgstr "Liitä leikepöydältä"
|
|
|
|
#: lazarusidestrconsts.srkmecpause
|
|
msgid "pause program"
|
|
msgstr "keskeytä ohjelma"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
|
|
msgid "Clear all extra carets"
|
|
msgstr "Poista muut tekstikursorit"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
|
|
msgid "Cursor keys clear all extra carets"
|
|
msgstr "Kursorinäppäimet poistavat muut tekstikursorit"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
|
|
msgid "Cursor keys move all extra carets"
|
|
msgstr "Kursorinäppäimet siirtävät muita tekstikursoreita"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
|
|
msgid "Add extra caret"
|
|
msgstr "Lisää tekstikursori"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
|
|
msgid "Toggle extra caret"
|
|
msgstr "Vaihda tekstikursori"
|
|
|
|
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
|
|
msgid "Remove extra caret"
|
|
msgstr "Poista tekstikursori"
|
|
|
|
#: lazarusidestrconsts.srkmecprevbookmark
|
|
msgid "Previous Bookmark"
|
|
msgstr "Edellinen kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditor
|
|
msgid "Go to prior editor"
|
|
msgstr "Mene edelliselle välilehdelle"
|
|
|
|
#: lazarusidestrconsts.srkmecpreveditorinhistory
|
|
msgid "Go to previous editor in history"
|
|
msgstr "Mene edelliseen editoriin historiassa"
|
|
|
|
#: lazarusidestrconsts.srkmecprevsharededitor
|
|
msgid "Go to prior editor with same Source"
|
|
msgstr "Mene edelliseen samansisältöiseen editoriin"
|
|
|
|
#: lazarusidestrconsts.srkmecprevwindow
|
|
msgid "Go to prior window"
|
|
msgstr "Mene edelliseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.srkmecquickcompile
|
|
msgid "quick compile, no linking"
|
|
msgstr "nopea käännös, ei linkitystä"
|
|
|
|
#: lazarusidestrconsts.srkmecremovebreakpoint
|
|
msgid "remove breakpoint"
|
|
msgstr "poista keskeytyskohta"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveemptymethods
|
|
msgid "Remove Empty Methods"
|
|
msgstr "Poista tyhjät metodit"
|
|
|
|
#: lazarusidestrconsts.srkmecremoveunusedunits
|
|
msgid "Remove Unused Units"
|
|
msgstr "Poista käyttämättömät käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.srkmecrenameidentifier
|
|
msgid "Rename Identifier"
|
|
msgstr "Vaihda tunnisteiden nimiä"
|
|
|
|
#: lazarusidestrconsts.srkmecreplace
|
|
msgid "Replace Text"
|
|
msgstr "Etsi ja korvaa"
|
|
|
|
#: lazarusidestrconsts.srkmecreportingbug
|
|
msgid "Reporting a bug"
|
|
msgstr "Virheen raportointi"
|
|
|
|
#: lazarusidestrconsts.srkmecresetdebugger
|
|
msgid "reset debugger"
|
|
msgstr "nollaa virheenjäljitin"
|
|
|
|
#: lazarusidestrconsts.srkmecright
|
|
msgid "Move cursor right"
|
|
msgstr "Siirrä kursori oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecrun
|
|
msgid "run program"
|
|
msgstr "suorita ohjelma"
|
|
|
|
#: lazarusidestrconsts.srkmecrunfile
|
|
msgid "run file"
|
|
msgstr "suorita tiedosto"
|
|
|
|
#: lazarusidestrconsts.srkmecrunparameters
|
|
msgid "run parameters"
|
|
msgstr "suoritusparametrit"
|
|
|
|
#: lazarusidestrconsts.srkmecrunwithoutdebugging
|
|
msgid "run without debugging"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecscrolldown
|
|
msgid "Scroll down one line"
|
|
msgstr "Vieritä alas yksi rivi"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollleft
|
|
msgid "Scroll left one char"
|
|
msgstr "Vieritä vasemmalle yksi merkki"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollright
|
|
msgid "Scroll right one char"
|
|
msgstr "Vieritä oikealle yksi merkki"
|
|
|
|
#: lazarusidestrconsts.srkmecscrollup
|
|
msgid "Scroll up one line"
|
|
msgstr "Vieritä ylös yksi rivi"
|
|
|
|
#: lazarusidestrconsts.srkmecseldown
|
|
msgid "Select Down"
|
|
msgstr "Valitse alas"
|
|
|
|
#: lazarusidestrconsts.srkmecselectall
|
|
msgctxt "lazarusidestrconsts.srkmecselectall"
|
|
msgid "Select All"
|
|
msgstr "Valitse kaikki"
|
|
|
|
#: lazarusidestrconsts.srkmecselectiontabs2spaces
|
|
msgid "Convert tabs to spaces in selection"
|
|
msgstr "Muunna valinnan tabulaattorit välilyönneiksi"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditorbottom
|
|
msgid "Select to absolute end"
|
|
msgstr "Valitse aivan loppuun asti"
|
|
|
|
#: lazarusidestrconsts.srkmecseleditortop
|
|
msgid "Select to absolute beginning"
|
|
msgstr "Valitse aivan alkuun asti"
|
|
|
|
#: lazarusidestrconsts.srkmecselgotoxy
|
|
msgid "Select Goto XY"
|
|
msgstr "Valitse Goto XY"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordleft
|
|
msgid "Select part-word left (e.g. CamelCase)"
|
|
msgstr "Valitse osa sanasta vasemmalle (esim. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselhalfwordright
|
|
msgid "Select part-word right (e.g. CamelCase)"
|
|
msgstr "Valitse osa sanasta oikealle (esim. CamelCase)"
|
|
|
|
#: lazarusidestrconsts.srkmecselleft
|
|
msgid "Select Left"
|
|
msgstr "Valitse vasen"
|
|
|
|
#: lazarusidestrconsts.srkmecsellineend
|
|
msgctxt "lazarusidestrconsts.srkmecsellineend"
|
|
msgid "Select Line End"
|
|
msgstr "Valitse rivin loppu"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinestart
|
|
msgctxt "lazarusidestrconsts.srkmecsellinestart"
|
|
msgid "Select Line Start"
|
|
msgstr "Valitse rivin alku"
|
|
|
|
#: lazarusidestrconsts.srkmecsellinetextstart
|
|
msgid "Select to text start in line"
|
|
msgstr "Valitse rivillä tekstin alkuun"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagebottom
|
|
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
|
|
msgid "Select Page Bottom"
|
|
msgstr "Valitse alimmainen sivu"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagedown
|
|
msgid "Select Page Down"
|
|
msgstr "Valitse sivu alas"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageleft
|
|
msgid "Select Page Left"
|
|
msgstr "Valitse sivu vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageright
|
|
msgid "Select Page Right"
|
|
msgstr "Valitse sivu oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecselpagetop
|
|
msgctxt "lazarusidestrconsts.srkmecselpagetop"
|
|
msgid "Select Page Top"
|
|
msgstr "Valitse ylimmäinen sivu"
|
|
|
|
#: lazarusidestrconsts.srkmecselpageup
|
|
msgid "Select Page Up"
|
|
msgstr "Valitse sivu ylös"
|
|
|
|
#: lazarusidestrconsts.srkmecselright
|
|
msgid "Select Right"
|
|
msgstr "Valitse oikea"
|
|
|
|
#: lazarusidestrconsts.srkmecselsticky
|
|
msgid "Start sticky selecting"
|
|
msgstr "Aloita tahmea valinta"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickycol
|
|
msgid "Start sticky selecting (Columns)"
|
|
msgstr "Aloita tahmea valinta (sarakkeet)"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickyline
|
|
msgid "Start sticky selecting (Line)"
|
|
msgstr "Aloita tahmea valinta (rivi)"
|
|
|
|
#: lazarusidestrconsts.srkmecselstickystop
|
|
msgid "Stop sticky selecting"
|
|
msgstr "Lopeta tahmea valinta"
|
|
|
|
#: lazarusidestrconsts.srkmecselup
|
|
msgid "Select Up"
|
|
msgstr "Valitse ylös"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendleft
|
|
msgid "Select word-end left"
|
|
msgstr "Valitse sanan loppuun vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordendright
|
|
msgid "Select word-end right"
|
|
msgstr "Valitse sanan loppuun oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordleft
|
|
msgctxt "lazarusidestrconsts.srkmecselwordleft"
|
|
msgid "Select Word Left"
|
|
msgstr "Valitse sana vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecselwordright
|
|
msgctxt "lazarusidestrconsts.srkmecselwordright"
|
|
msgid "Select Word Right"
|
|
msgstr "Valitse sana oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmecsetfreebookmark
|
|
msgid "Set a free Bookmark"
|
|
msgstr "Aseta vapaa kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.srkmecsetmarker
|
|
#, fuzzy
|
|
#| msgid "Set Marker %d"
|
|
msgid "Set bookmark %d"
|
|
msgstr "Aseta merkki %d"
|
|
|
|
#: lazarusidestrconsts.srkmecshifttab
|
|
msgid "Shift Tab"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecshowabstractmethods
|
|
msgid "Show Abstract Methods"
|
|
msgstr "Näytä abstraktit metodit"
|
|
|
|
#: lazarusidestrconsts.srkmecshowcodecontext
|
|
msgid "Show Code Context"
|
|
msgstr "Näytä koodin konteksti"
|
|
|
|
#: lazarusidestrconsts.srkmecshowexecutionpoint
|
|
msgid "show execution point"
|
|
msgstr "näytä suorituskohta"
|
|
|
|
#: lazarusidestrconsts.srkmecstopprogram
|
|
msgid "stop program"
|
|
msgstr "Pysäytä ohjelma"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacroplay
|
|
msgid "Play Macro"
|
|
msgstr "Toista makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynmacrorecord
|
|
msgid "Record Macro"
|
|
msgstr "Nauhoita makro"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Mene solun viimeiseen asemaan"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Mene solun ensimmäiseen asemaan"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
|
|
msgid "Select Cell"
|
|
msgstr "Valitse solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Seuraava solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Seuraava solu (kaikki valitut)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Seuraava solu (vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Seuraava solu (kaikki valitut / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Edellinen solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Edellinen solu (kaikki valitut)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Edellinen solu (vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Edellinen solu (kaikki valitut / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynpsyncroedstart
|
|
msgid "Start Syncro edit"
|
|
msgstr "Aloita Syncro editointi"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellend
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
|
|
msgid "Goto last pos in cell"
|
|
msgstr "Mene solun viimeiseen paikkaan"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellhome
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
|
|
msgid "Goto first pos in cell"
|
|
msgstr "Mene solun ensimmäiseen paikkaan"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledcellselect
|
|
msgid "Select cell"
|
|
msgstr "Valitse solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledescape
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
|
|
msgid "Escape"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledfinish
|
|
msgid "Finish"
|
|
msgstr "Loppu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
|
|
msgid "Next Cell"
|
|
msgstr "Seuraava solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
|
|
msgid "Next Cell (rotate)"
|
|
msgstr "Seuraava solu (kierrätä)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
|
|
msgid "Next Cell (all selected)"
|
|
msgstr "Seuraava solu (kaikki valittu)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
|
|
msgid "Next Cell (rotate / all selected)"
|
|
msgstr "Seuraava solu (kierrätä / kaikki valitut)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
|
|
msgid "Next Cell (firsts only)"
|
|
msgstr "Seuraava solu (vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
|
|
msgid "Next Cell (rotate / firsts only)"
|
|
msgstr "Seuraava solu (kierrätä / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
|
|
msgid "Next Cell (all selected / firsts only)"
|
|
msgstr "Seuraava solu (kaikki valitut / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
|
|
msgid "Next Cell (rotate / all selected / firsts only)"
|
|
msgstr "Seuraava solu (kierrätä / kaikki valitut / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
|
|
msgid "Previous Cell"
|
|
msgstr "Edellinen solu"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
|
|
msgid "Previous Cell (all selected)"
|
|
msgstr "Edellinen solu (kaikki valitut)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
|
|
msgid "Previous Cell (firsts only)"
|
|
msgstr "Edellinen solu (vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
|
|
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
|
|
msgid "Previous Cell (all selected / firsts only)"
|
|
msgstr "Edellinen solu (kaikki valitut / vain ensimmäiset)"
|
|
|
|
#: lazarusidestrconsts.srkmecsyntaxcheck
|
|
msgid "Syntax Check"
|
|
msgstr "Kieliopin tarkistus"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleassembler
|
|
msgid "View assembler"
|
|
msgstr "Näytä assembler"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoint
|
|
msgid "toggle breakpoint"
|
|
msgstr "Keskeytyskohta päälle/pois"
|
|
|
|
#: lazarusidestrconsts.srkmectogglebreakpoints
|
|
msgid "View breakpoints"
|
|
msgstr "Näytä keskeytyskohdat"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecallstack
|
|
msgid "View call stack"
|
|
msgstr "Näytä kutsupino"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodebrowser
|
|
msgid "View code browser"
|
|
msgstr "Näytä koodin selain"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecodeexpl
|
|
msgid "View Code Explorer"
|
|
msgstr "Naytä koodin tutkija"
|
|
|
|
#: lazarusidestrconsts.srkmectogglecomppalette
|
|
msgid "View component palette"
|
|
msgstr "Naytä komponenttipaletti"
|
|
|
|
#: lazarusidestrconsts.srkmectoggledebuggerout
|
|
msgid "View debugger output"
|
|
msgstr "Naytä virheenjäljittimen tuloste"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleformunit
|
|
msgid "Switch between form and unit"
|
|
msgstr "Siirry lomakkeen ja käännösyksikön välillä"
|
|
|
|
#: lazarusidestrconsts.srkmectogglefpdoceditor
|
|
msgid "View Documentation Editor"
|
|
msgstr "Naytä dokumentointi-editori"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleidespeedbtns
|
|
msgid "View IDE speed buttons"
|
|
msgstr "Naytä IDEn pikavalinnat"
|
|
|
|
#: lazarusidestrconsts.srkmectogglelocals
|
|
msgid "View local variables"
|
|
msgstr "Näytä paikalliset muuttujat"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarker
|
|
#, fuzzy
|
|
#| msgid "Toggle Marker %d"
|
|
msgid "Toggle bookmark %d"
|
|
msgstr "Vaihda merkki %d"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemarkupword
|
|
msgid "Toggle Current-Word highlight"
|
|
msgstr "Vaihda aktiivisen sanan korostus"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemessages
|
|
msgid "View messages"
|
|
msgstr "Näytä viestit"
|
|
|
|
#: lazarusidestrconsts.srkmectogglemode
|
|
msgid "Toggle Mode"
|
|
msgstr "Vaihda moodi"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleobjectinsp
|
|
msgid "View Object Inspector"
|
|
msgstr "Näytä komponenttimuokkain"
|
|
|
|
#: lazarusidestrconsts.srkmectoggleregisters
|
|
msgid "View registers"
|
|
msgstr "Näytä rekisterit"
|
|
|
|
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
|
|
msgid "View restriction browser"
|
|
msgstr "Näytä rajoitukset"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesearchresults
|
|
msgid "View Search Results"
|
|
msgstr "Näytä etsinnän tulokset"
|
|
|
|
#: lazarusidestrconsts.srkmectogglesourceeditor
|
|
msgid "View Source Editor"
|
|
msgstr "Näytä lähdekoodieditori"
|
|
|
|
#: lazarusidestrconsts.srkmectogglewatches
|
|
msgid "View watches"
|
|
msgstr "Näytä vahdit"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldall
|
|
msgctxt "lazarusidestrconsts.srkmecunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Poista laskostus kaikkialta"
|
|
|
|
#: lazarusidestrconsts.srkmecunfoldcurrent
|
|
msgid "Unfold at Cursor"
|
|
msgstr "Poista laskostus kursorin kohdalta"
|
|
|
|
#: lazarusidestrconsts.srkmecunknown
|
|
msgid "unknown editor command"
|
|
msgstr "Tuntematon editorin komento"
|
|
|
|
#: lazarusidestrconsts.srkmecunusedunits
|
|
msgid "Unused Units ..."
|
|
msgstr "Käyttämättömät käännösyksiköt ..."
|
|
|
|
#: lazarusidestrconsts.srkmecup
|
|
msgid "Move cursor up"
|
|
msgstr "Siirrä kursori ylös"
|
|
|
|
#: lazarusidestrconsts.srkmecviewanchoreditor
|
|
msgid "View anchor editor"
|
|
msgstr "Näytä ankkurointi-editori"
|
|
|
|
#: lazarusidestrconsts.srkmecviewcomponents
|
|
msgid "View components"
|
|
msgstr "Näytä komponentit"
|
|
|
|
#: lazarusidestrconsts.srkmecvieweditormacros
|
|
msgid "View editor macros"
|
|
msgstr "Näytä editorin makrot"
|
|
|
|
#: lazarusidestrconsts.srkmecviewforms
|
|
msgid "View forms"
|
|
msgstr "Näytä lomakkeet"
|
|
|
|
#: lazarusidestrconsts.srkmecviewhistory
|
|
msgctxt "lazarusidestrconsts.srkmecviewhistory"
|
|
msgid "View History"
|
|
msgstr "Näytä historia"
|
|
|
|
#: lazarusidestrconsts.srkmecviewpseudoterminal
|
|
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
|
|
msgid "View Terminal Output"
|
|
msgstr "Näytä komentorivin tuloste"
|
|
|
|
#: lazarusidestrconsts.srkmecviewtaborder
|
|
msgid "View Tab Order"
|
|
msgstr "Näytä tabulointijärjestys"
|
|
|
|
#: lazarusidestrconsts.srkmecviewthreads
|
|
msgctxt "lazarusidestrconsts.srkmecviewthreads"
|
|
msgid "View Threads"
|
|
msgstr "Näytä Säikeet"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitdependencies
|
|
msgid "View unit dependencies"
|
|
msgstr "Näytä käännösyksiköiden riippuvuudet"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunitinfo
|
|
msgid "View unit information"
|
|
msgstr "Näytä käännösyksiköiden tiedot"
|
|
|
|
#: lazarusidestrconsts.srkmecviewunits
|
|
msgid "View units"
|
|
msgstr "Näytä käännösyksiköt"
|
|
|
|
#: lazarusidestrconsts.srkmecwordcompletion
|
|
msgid "Word Completion"
|
|
msgstr "Sanan täydennys"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendleft
|
|
msgid "Move cursor word-end left"
|
|
msgstr "Siirrä kursori vasemmalle sanan loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmecwordendright
|
|
msgid "Move cursor word-end right"
|
|
msgstr "Siirrä kursori oikealle sanan loppuun"
|
|
|
|
#: lazarusidestrconsts.srkmecwordleft
|
|
msgid "Move cursor word left"
|
|
msgstr "Siirrä kursori sana vasemmalle"
|
|
|
|
#: lazarusidestrconsts.srkmecwordright
|
|
msgid "Move cursor word right"
|
|
msgstr "Siirrä kursori sana oikealle"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomin
|
|
msgid "Zoom in"
|
|
msgstr "Zoomaa sisään"
|
|
|
|
#: lazarusidestrconsts.srkmeczoomout
|
|
msgid "Zoom out"
|
|
msgstr "Zoomaa ulos"
|
|
|
|
#: lazarusidestrconsts.srkmeditforcmd
|
|
msgid "Edit keys of command"
|
|
msgstr "Muokkaa komennon näppäimiä"
|
|
|
|
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
|
|
msgid "Continue with next mouse up action"
|
|
msgstr "Jatka seuraavalla hiiri-ylös toiminnolla"
|
|
|
|
#: lazarusidestrconsts.synffoldcomments
|
|
msgid "Fold comments"
|
|
msgstr "Laskosta kommentit"
|
|
|
|
#: lazarusidestrconsts.synffoldcommentsinselection
|
|
msgid "Fold comments in selection"
|
|
msgstr "Laskosta valinnan kommentit"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdef
|
|
msgid "Fold inactive Ifdef"
|
|
msgstr "Laskosta passiivinen Ifdef"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
|
|
msgid "Fold inactive Ifdef (exclude mixed state)"
|
|
msgstr "Laskosta passiivinen Ifdef (paitsi sekoitettu tila)"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselection
|
|
msgid "Fold inactive Ifdef in selection"
|
|
msgstr "Laskosta passiivinen Ifdef valinnassa"
|
|
|
|
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
|
|
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
|
|
msgstr "Laskosta passiivinen Ifdef valinnassa (paitsi sekoitettu tila)"
|
|
|
|
#: lazarusidestrconsts.synfhidecomments
|
|
msgid "Hide comments"
|
|
msgstr "Piilota kommentit"
|
|
|
|
#: lazarusidestrconsts.synfhidecommentsinselection
|
|
msgid "Hide comments in selection"
|
|
msgstr "Piilota valinnan kommentit"
|
|
|
|
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
|
|
msgid "Match action button of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionlineofmousedown
|
|
msgid "Match action line of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
|
|
msgid "Match action modifiers of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfmatchactionposofmousedown
|
|
msgid "Match action pos of mouse down"
|
|
msgstr ""
|
|
|
|
#: lazarusidestrconsts.synfsearchallactionofmousedown
|
|
msgid "Search all action of mouse down"
|
|
msgstr "Etsi kaikki hiiri-alas toiminnot"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdef
|
|
msgid "Unfold active Ifdef"
|
|
msgstr "Poista aktiivisen Ifdef:in laskostus"
|
|
|
|
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
|
|
msgid "Unfold active Ifdef in selection"
|
|
msgstr "Poista aktiivisen Ifdef:in laskostus valinnassa"
|
|
|
|
#: lazarusidestrconsts.synfunfoldall
|
|
msgctxt "lazarusidestrconsts.synfunfoldall"
|
|
msgid "Unfold all"
|
|
msgstr "Poista kaikki laskostus"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdef
|
|
msgid "Unfold all Ifdef"
|
|
msgstr "Poista kaikki Ifdef:n laskostus"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallifdefinselection
|
|
msgid "Unfold all Ifdef in selection"
|
|
msgstr "Poista Ifdef:in laskostus valinnassa"
|
|
|
|
#: lazarusidestrconsts.synfunfoldallinselection
|
|
msgid "Unfold all in selection"
|
|
msgstr "Poista kaikki laskostus valinnassa"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcomments
|
|
msgid "Unfold comments"
|
|
msgstr "Poista kommenttien laskostus"
|
|
|
|
#: lazarusidestrconsts.synfunfoldcommentsinselection
|
|
msgid "Unfold comments in selection"
|
|
msgstr "Poista kommenttien laskostus valinnassa"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdef
|
|
msgid "Unfold inactive Ifdef"
|
|
msgstr "Poista passiivisen Ifdef:in laskostus"
|
|
|
|
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
|
|
msgid "Unfold inactive Ifdef in selection"
|
|
msgstr "Poista passiivisen Ifdef:in laskostus valinnassa"
|
|
|
|
#: lazarusidestrconsts.uefilerocap
|
|
msgid "File is readonly"
|
|
msgstr "Tiedosto on vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.uefilerotext1
|
|
msgid "The file \""
|
|
msgstr "Tiedosto \""
|
|
|
|
#: lazarusidestrconsts.uefilerotext2
|
|
msgid "\" is not writable."
|
|
msgstr "\" ei voida tallentaa."
|
|
|
|
#: lazarusidestrconsts.uelocked
|
|
msgid "Locked"
|
|
msgstr "Lukittu"
|
|
|
|
#: lazarusidestrconsts.uemacrorecording
|
|
msgid "Recording"
|
|
msgstr "Nauhoittaa"
|
|
|
|
#: lazarusidestrconsts.uemacrorecordingpaused
|
|
msgid "Rec-pause"
|
|
msgstr "Keskeytä"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchatcursor
|
|
msgid "Add &Watch At Cursor"
|
|
msgstr "Lisää &vahti kursorin kohdalta"
|
|
|
|
#: lazarusidestrconsts.uemaddwatchpointatcursor
|
|
msgid "Add Watch&Point At Cursor"
|
|
msgstr "Lisää Vahti&piste kursorin kohtaan"
|
|
|
|
#: lazarusidestrconsts.uembookmarkn
|
|
msgid "Bookmark"
|
|
msgstr "Kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.uemcloseotherpages
|
|
msgid "Close All &Other Pages"
|
|
msgstr "Sulje kaikki &muut välilehdet"
|
|
|
|
#: lazarusidestrconsts.uemclosepage
|
|
msgid "&Close Page"
|
|
msgstr "&Sulje välilehti"
|
|
|
|
#: lazarusidestrconsts.uemcopyfilename
|
|
msgid "Copy Filename"
|
|
msgstr "Kopioi tiedoston nimi"
|
|
|
|
#: lazarusidestrconsts.uemcopytonewwindow
|
|
msgid "Clone to New Window"
|
|
msgstr "Tee uusi näkymä uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindow
|
|
msgid "Clone to Other Window"
|
|
msgstr "Tee uusi näkymä toiseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.uemcopytootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Uusi ikkuna"
|
|
|
|
#: lazarusidestrconsts.uemdebugword
|
|
msgctxt "lazarusidestrconsts.uemdebugword"
|
|
msgid "Debug"
|
|
msgstr "Virheenjäljitys"
|
|
|
|
#: lazarusidestrconsts.uemencoding
|
|
msgid "Encoding"
|
|
msgstr "Merkkikoodaus"
|
|
|
|
#: lazarusidestrconsts.uemevaluatemodify
|
|
msgid "&Evaluate/Modify ..."
|
|
msgstr "&Arvioi/Muuta ..."
|
|
|
|
#: lazarusidestrconsts.uemfinddeclaration
|
|
msgid "&Find Declaration"
|
|
msgstr "&Etsi määrittely"
|
|
|
|
#: lazarusidestrconsts.uemfindinotherwindow
|
|
msgid "Find in other Window"
|
|
msgstr "Etsi toisesta ikkunasta"
|
|
|
|
#: lazarusidestrconsts.uemgotobookmark
|
|
msgid "&Goto Bookmark"
|
|
msgstr "&Siirry kirjaimerkkiin"
|
|
|
|
#: lazarusidestrconsts.uemhighlighter
|
|
msgid "Highlighter"
|
|
msgstr "Syntaksin korostus"
|
|
|
|
#: lazarusidestrconsts.ueminspect
|
|
msgctxt "lazarusidestrconsts.ueminspect"
|
|
msgid "&Inspect ..."
|
|
msgstr "&Tutki ..."
|
|
|
|
#: lazarusidestrconsts.ueminvertassignment
|
|
msgctxt "lazarusidestrconsts.ueminvertassignment"
|
|
msgid "Invert Assignment"
|
|
msgstr "Käännä sijoitus päinvastaiseksi"
|
|
|
|
#: lazarusidestrconsts.uemlineending
|
|
msgid "Line Ending"
|
|
msgstr "Rivin loppu"
|
|
|
|
#: lazarusidestrconsts.uemlockpage
|
|
msgid "&Lock Page"
|
|
msgstr "&Lukitse sivu"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleft
|
|
msgid "Move Page Left"
|
|
msgstr "Siirrä sivua vasemmalle"
|
|
|
|
#: lazarusidestrconsts.uemmovepageleftmost
|
|
msgid "Move Page Leftmost"
|
|
msgstr "Siirrä sivu vasempaan reunaan"
|
|
|
|
#: lazarusidestrconsts.uemmovepageright
|
|
msgid "Move Page Right"
|
|
msgstr "Siirrä sivua oikealle"
|
|
|
|
#: lazarusidestrconsts.uemmovepagerightmost
|
|
msgid "Move Page Rightmost"
|
|
msgstr "Siirrä sivu oikeaan reunaan"
|
|
|
|
#: lazarusidestrconsts.uemmovetonewwindow
|
|
msgid "Move to New Window"
|
|
msgstr "Siirrä uuteen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindow
|
|
msgid "Move to Other Window"
|
|
msgstr "Siirrä toiseen ikkunaan"
|
|
|
|
#: lazarusidestrconsts.uemmovetootherwindownew
|
|
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
|
|
msgid "New Window"
|
|
msgstr "Uusi ikkuna"
|
|
|
|
#: lazarusidestrconsts.uemnextbookmark
|
|
msgid "Goto Next Bookmark"
|
|
msgstr "Siirry seuraavaan kirjanmerkkiin"
|
|
|
|
#: lazarusidestrconsts.uemodified
|
|
msgid "Modified"
|
|
msgstr "Muutettu"
|
|
|
|
#: lazarusidestrconsts.uemopenfileatcursor
|
|
msgid "&Open File at Cursor"
|
|
msgstr "&Avaa kursorin osoittama tiedosto"
|
|
|
|
#: lazarusidestrconsts.uemprevbookmark
|
|
msgid "Goto Previous Bookmark"
|
|
msgstr "Mene edelliseen kirjanmerkkiin"
|
|
|
|
#: lazarusidestrconsts.uemprocedurejump
|
|
msgid "Procedure Jump"
|
|
msgstr "Siirry aliohjelman rajapinnan ja toteutuksen välillä"
|
|
|
|
#: lazarusidestrconsts.uemreadonly
|
|
msgctxt "lazarusidestrconsts.uemreadonly"
|
|
msgid "Read Only"
|
|
msgstr "Vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.uemrefactor
|
|
msgid "Refactoring"
|
|
msgstr "Järjestele uudelleen"
|
|
|
|
#: lazarusidestrconsts.uemsetfreebookmark
|
|
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
|
|
msgid "Set a Free Bookmark"
|
|
msgstr "Aseta vapaa kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.uemshowlinenumbers
|
|
msgid "Show Line Numbers"
|
|
msgstr "Näytä rivinumerot"
|
|
|
|
#: lazarusidestrconsts.uemsource
|
|
msgctxt "lazarusidestrconsts.uemsource"
|
|
msgid "Source"
|
|
msgstr "Lähdekoodi"
|
|
|
|
#: lazarusidestrconsts.uemtogglebookmark
|
|
msgid "&Toggle Bookmark"
|
|
msgstr "&Vaihda kirjanmerkki"
|
|
|
|
#: lazarusidestrconsts.uemtogglebreakpoint
|
|
msgid "Toggle &Breakpoint"
|
|
msgstr "&Keskeytyskohta päälle/pois"
|
|
|
|
#: lazarusidestrconsts.uemviewcallstack
|
|
msgctxt "lazarusidestrconsts.uemviewcallstack"
|
|
msgid "View Call Stack"
|
|
msgstr "Näytä kutsupino"
|
|
|
|
#: lazarusidestrconsts.uenotimplcap
|
|
msgid "Not implemented yet"
|
|
msgstr "Ei vielä toteutettu"
|
|
|
|
#: lazarusidestrconsts.uepins
|
|
msgid "INS"
|
|
msgstr "Lisää"
|
|
|
|
#: lazarusidestrconsts.uepovr
|
|
msgid "OVR"
|
|
msgstr "Korvaa"
|
|
|
|
#: lazarusidestrconsts.uepreadonly
|
|
msgid "Readonly"
|
|
msgstr "Vain luettavissa"
|
|
|
|
#: lazarusidestrconsts.versioninfotitle
|
|
msgid "Version Info"
|
|
msgstr "Versiotiedot"
|
|
|