lazarus/languages/lazaruside.cs.po
2011-06-11 14:44:31 +00:00

17309 lines
539 KiB
Plaintext

# , 2010.
msgid ""
msgstr ""
"Project-Id-Version: Lazarus\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2011-01-05 16:32+0300\n"
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Language-Team: Czech <kde-i18n-doc@kde.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-Language: Czech\n"
"X-Poedit-Country: CZECH REPUBLIC\n"
"X-Poedit-SourceCharset: utf-8\n"
"X-Generator: Lokalize 1.0\n"
"Plural-Forms: nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Použít přednastavené schéma"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Nulovat všechna nastavení"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Nulovat všechna nastavení žlábku"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Nulovat všechna nastavení textu"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Tato stránka nezobrazuje aktuální nastavení. Viz stránka Rozšířené. Zde můžete nastavit výchozí hodnoty"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Obecné"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr "Standardní, všechny akce (body přerušení, složení) při stisknutí tlačítka myši"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr "Rozšířené, akce (body přerušení, složení) při uvolnění tlačítka myši. Výběr při současném stisknutí tlačítka myši a pohybu"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Žlábek"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Pravé tlačítko myši přesune kurzor"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "Klávesa Alt aktivuje sloupcový mód"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr "Levé tlačítko Ctrl"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr "skoč na provedení"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr "skoč na provedení / konec dalšího bloku"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr "nic"
#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr "Dvojklik vybere řádek"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr "Tažení výběru (kopírovat/vložit)"
#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr "skoč na provedení"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Prostřední tlačítko"
#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr "nic"
#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr "vložit výběr"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Máte neuložené změny. Použitím této stránky vrátíte zpět změny provedené na pokročilé stránce"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Žádné >"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Pouze pro čtení"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Malé písmena, první písmeno velké"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Přidat operátor přiřazení :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Zvýraznění závorky"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Strom složení kódu"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Přednastavený text"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Zakázané body přerušení"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Povolit body přerušení"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Chybový řádek"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Bod vykonávání"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Popisovač složení kódu"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Celkový"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Žlábek"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Řádek"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Editor Syncron"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Editor šablon"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Oddělovač žlábku"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Vzestupně další"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Zvýraznit aktuální slovo"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Postupné hledání"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Chybný bod přerušení"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Zvýraznění aktuálního řádku"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Číslo řádku"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Změněný řádek"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Odkaz myši"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Vybraná oblast"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Aktivní buňka"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Jiné buňky"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Synchronizované buňky"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Aktivní buňka"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Jiné buňky"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Synchronizované buňky"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Textový blok"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Neznámý bod přerušení"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Slovní závorky"
#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Doplňující zdrojové prohledávací cesty pro všechny projekty(.pp;.pas)"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Přidat středník"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Přizpůsobit vrchní linku kvůli komentářů vpředu"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Všechny soubory"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Abecedně"
#: lazarusidestrconsts.dlgalreadyusesallotherunits
msgid "\"%s\" already uses all the units in this project"
msgstr "\"%s\" již používá všechny jednotky v tomto projektu"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Kurzor vždy viditelný"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nejednoznačná akce souboru:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Varování při překládání"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Nastavení aplikace"
#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Výchozí"
#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Zahrnout kontrolní kód"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaticky vytvořené formuláře:"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Při vytváření nových forem je přidej do automaticky vytvářených forem."
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Automaticky smazat soubor"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Skrýt myš při psaní"
#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "Automatické odsazení"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr "(Nastavení chytrého odsazení)"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Automaticky odstranit prázdné metody"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automaticky nastav malá písmena v názvu souboru"
#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automaticky ukládat"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Dostupné formuláře:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Pozadí"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(podadresáře ne)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Stejné jméno (v podadresáři)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Za metodami"
#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr "Výběr:"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Odsazení bloku"
#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr "Metoda odsazení"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Mezery/tabulátor podle předchozího řádku"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Pouze pozice"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Mezery"
#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Kompatibilní s TP/BP 7.0"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Zvýraznění závorky"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Odpovídající závorkový pár"
#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "Soubor zpráv překladače Free Pascal (*.msg)|*.msg|Jakýkoliv soubor (*.*)|*.*"
#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Použít"
#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "&Rozlišovat velikost znaků"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Kontrolování voleb překladače"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Výsledky"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Kontrola překladače..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Kontrola nastavení překladače..."
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Test: Kontrola nastavení fpc..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Kontrola data překladače..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Překládání prázdného souboru..."
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Kontrola chybějících fpc ppu..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Překládání prázdného souboru."
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Pořadí tříd"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Poslední"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "malá písmena"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Náhled (max. délka řádku = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefix čtení"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Prefix uložení"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "VELKÁ PÍSMENA"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefix proměnné"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefix nastavení"
#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Vystředit řádek ukazatele"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Uložit jako - automaticky přejmenovat pascalovské soubory na malé znaky"
#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Zkontrolovat konzistenci"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Kontrolovat balíčky při vytváření formuláře"
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Vyberte šablonu kódu (*.dci)"
#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Politika vkládání části tříd"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Ukázat tlačítka pro zavření v zápisníku"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Barevné schéma"
#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Makra ve stylu C (globální)"
#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Použít Ansi řetězce"
#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "As-Is"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Styl assembleru:"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Zprávy"
#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Kontroly:"
#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Sestavení"
#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr "Podmínky"
#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operátory ve stylu C (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "Vytvořit uzel potomka"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Vytvořit Makefile"
#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "Vytvořit uzel nad"
#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "Vytvořit uzel níže"
#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Generovat ladící informace pro DBX (pomalé překládání)"
#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Ladění:"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Přídavná cesta ladícího nástroje (žádná):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Vytvoření kódu"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Oba"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Svinout"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Skrýt"
#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Myš"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Opačné pořadí svinutí v Popup"
#: lazarusidestrconsts.dlgcodegeneration
#| msgid "Code"
msgid "Code generation"
msgstr "Generování kódu"
#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Nastavení CodeTools"
#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Rychlejší kód"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Vytvářet ladící informace pro GDB (pomalé překládání)"
#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Generovat:"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Použít jednotku Heaptrc"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Zahrnout soubory (-Fi):"
#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Zděděný"
#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Udržovat některé proměnné v registrech"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Knihovny (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Spojování"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Načíst/Uložit"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Barva"
#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Exportovat"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Barva editoru)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Nezměněn"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Barvy"
#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Parametry příkazové řádky"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametry příkazové řádky (bez jména aplikace)"
#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr "Přesunout dolů"
#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr "Přesunout o úroveň níže"
#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr "Přesunout o úroveň výše"
#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr "Přesunout nahoru"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr "Zprávy překladače"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "Jazykový soubor zpráv překladače"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Volby překladače"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Vlastnosti dokončení"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Konfigurační soubory:"
#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Obyčejný kód"
#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Nastavení: "
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Jiné"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Přetečení"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analyzování"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Kopírovat/Vložit s informací složení"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Kopírovat slovo při kopírování žádného"
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Rozsah"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Ukázat chyby"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "&Zobrazit Volby"
#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Menší kód"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Chytré spojování"
#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Jiné zdroje (soubory .pp/.pas, použitou pouze IDE ne překladačem)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Zásobník"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Odstranit symboly ze spustitelného"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Styl jednotky:"
#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr "Použít tyto volby překladače jako výchozí pro nové projekty"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Vytvářet kód pro valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Výřečnost"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE ve stylu C++"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Ctrl-prostřední-klik na záložku zavře všechny ostatní"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Ukazatel za koncem řádku"
#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr "Kurzor:"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Kurzor přeskakuje výběr"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Kurzor přeskakuje tabulátory"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Uživatelsky definované rozšíření (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor cest"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Typ a cesta ladiče"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Výchozí písmo editoru"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Výchozí hodnota"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Odstranit šablonu "
#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Kompatibilní s Delphi"
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Plocha"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Tlačítka - "
#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Soubory na ploše"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Pokyny"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Nabídky - "
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Různé volby"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Směr"
#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Složka neexistuje"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Zakázat vyhlazování grafiky"
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Použít barvu pravého okraje"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Kreslit úroveň oddělovače"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Barva zanořené řádky"
#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr "Kreslit oddělovač"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Barva řádky"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (místní)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Sekce jednotka"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Odstavec uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (místní)"
#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Dolů"
#: lazarusidestrconsts.dlgedadd
#, fuzzy
#| msgid "Add..."
msgid "Add ..."
msgstr "Přidat..."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Zpět"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tučné"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Podadresář"
#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Šablony kódu"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for pascal blocks"
msgstr "Doplnit ukončovací příkaz pascalového bloku"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Uživatelsky definované rozšíření"
#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Prodleva"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(%s sec prodleva)"
#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Odstranit"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Zobrazení"
#: lazarusidestrconsts.dlgededit
#, fuzzy
#| msgid "Edit..."
msgid "Edit ..."
msgstr "Upravit..."
#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Soubory editoru"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Dokončení identifikátorů"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Převrácené"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorovat zámky, použít nejdelší nepoužitý editor"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorovat zámky pokud je editor aktuální"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorovat zámky pokud je editor v aktuálním okně"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Zamčeno pokud je text zobrazen"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Odemknuté"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Odemčeno pokud je text vystředěný"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nová záložka, existující nebo nové okno"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nová záložka v novém okně"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nová záložka v existujícím okně"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Tato volba použije nejdelší nepoužitý editor pro soubor i v případě, že je zamčen a/nebo vyžaduje rolování. Určení nejdelšího nepoužitého editoru nezohledňuje pořadí, v němž byla okna zobrazena i pokud je toto nastaveno pro \"stejná kritéria pořadí\". Tato volba bude vždy úspěšná, další volby nikdy testovány."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Tato volba zjistí, zda aktuální aktivní editor má cílový soubor a pokud ano, tak použije aktuální editor i pokud je zamčený a/nebo vyžaduje rolování."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Tato volba zjistí, zda existuje editor pro cílový soubor v aktuálním okně a pokud ano, tak použije tento editor i pokud je zamčený a/nebo vyžaduje rolování."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Tato volba použije zamčený (pouze zamčený) editor, který nevyžaduje rolování k zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné části obrazovky)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Tato volba použije libovolný nezamčený editor."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Tato volba použije nezamčený editor, který nevyžaduje rolování pro zobrazení cílového bodu skoku (cílový bod skoku je již ve viditelné vystředěné části obrazovky, kromě 2-5 řádek nahoře/dole)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Tato volba otevře novou záložku v existujícím nebo novém okně pokud není nalezena nezamčená záložka. Tato volba vždy uspěje, další volby už nejsou testovány."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v novém okně (i pokud by jiná existující okna mohla být použita pro novou záložku). Tato volba vždy uspěje, další volby již nejsou testovány."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Pokud není nalezena odemčená záložka, pak tato volba otevře novou záložku v existujícím (pouze existujícím) okně. Záložka je otevřena pouze pokud existující okno dosud nemá editor pto cílový soubor."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Kurzíva"
#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Písmo editoru"
#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Výška písma editoru"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Volby editoru"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Globální nastavení schéma"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Různé"
#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "V mapování kláves nebyla nalezena žádná chyba."
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Vypnuto"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Zapnuto"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Podtržené"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Vlastnosti prvku"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Klávesa End skočí k nejbližšímu konci"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Zeptat"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Poznámky: Soubory projektu jsou všechny soubory v adresáři projektu"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Záloha"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Soubory"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Mřížka"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Jazyk"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Vodící čáry"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Různé"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Žádné"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Jiné soubory"
#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projekt"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Po překladu zaměřit okno zpráv"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Dodatečné mezery znaku"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dodatečné mezery řádku"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Používat externí soubor ladících symbolů GDB."
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Přípony souboru"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Najít text od kurzoru"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Díl"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Sekce chunk"
#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Soubor"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Komentář"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Uzel"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Položka"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Seznam <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objekt (zděděný, vkládaný)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (místní)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Komentář (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (vnořené)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Komentář { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Vnořené komentáře"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedura)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedura"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Komentář //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Jednotka"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Sekce Unit"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Oblast}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Použití"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (globální)"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Komentář"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Uzel"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Zpracování instrukcí"
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Popředí"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Politika vkládání procedur"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Udržovat pořadí procedur"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Cesta překladače (např. %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Zdrojový adresář FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Textová značka"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor formuláře"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From &Beginning"
msgstr ""
#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "&Od kurzoru"
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Volby"
#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr "Generovat ladící informace dwarf"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Získat pozici"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Celkový"
#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Kompatibilní s GPC (GNU Pascal Compiler)"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Vytvářet kód pro gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Barva zachytávače"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Barva mřížky"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rozměr mřížky X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Velikost horizontálního kroku mřížky"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rozměr mřížky Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Velikost svislého kroku mřížky"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Kódové nástroje"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Ladič"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Prostředí"
#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Nápověda"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Vrátit zpět skupinu"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Ukázat vodící čáry"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Žlábek"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Složeno"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Barva žlábku"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Barva okraje žlábku"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Index oddělovače žlábku"
#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Šířka žlábku"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Poloviční posouvání stránky"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Velikost haldy"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Výška:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Skrýt okna IDE při spuštění"
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Skrýt ikony zpráv"
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Skrýt záložky v jednostránkových oknech"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Barva zvýraznění"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Barva zvýraznění písma"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Nalevo od kurzoru"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Napravo od kurzoru"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Zobrazení pokynů pro parametr \"Sender\" nepoužito"
#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Zobrazení pokynů k nepoužitým jednotkám v hlavním zdrojovém kódu"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Klávesa Home skočí k nejbližšímu startu"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Hostitelská aplikace"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Dokončení identifikátoru"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Politika identifikátorů"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Volby IDE"
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignorovat"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Zahrnout systémové proměnné"
#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Odsadit kód na"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr "Odsazení a tabulátory:"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Před metodami"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Jméno konstruktoru musí být 'init' (destruktor musí být 'done')"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementace"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Rozhraní"
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Vložit do sekce použitých jednotek"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Vložit mezeru po"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Vložit mezeru před"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval v sekundách"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skákání (např. metoda skákání)"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Udržovat x-ovou pozici kurzoru"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mapování kláves"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Chyba mapování kláves"
#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Schéma mapování kláves"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Politika klíčových slov"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Povolit LABEL a GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Jazyk"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Poslední (např. na konci zdrojového kódu)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Adresář Lazarusu (výchozí pro všechny projekty)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Vlevo:"
#: lazarusidestrconsts.dlglefttopclr
msgid "Guid lines Left,Top"
msgstr "Vodící čáry Vlevo, Nahoře"
#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Úroveň 1 (rychlé a přátelské k ladění)"
#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Úroveň 2 (Úroveň 1 + rychlá optimalizace)"
#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Úroveň 3 (Úroveň 2 + pomalá optimalizace)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Úroveň 0 (bez zvláštní optimalizace)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Dělení řádků"
#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Styl spojování:"
#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Chytré spojování"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Načíst nastavení plochy ze souboru"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hlavní menu"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Zobrazit formuláře projektu"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Zobrazit rámce projektů"
#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Zobrazit jednotky projektu"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Vytvořit cestu"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Okraj a žlábek"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Barva značkovače"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr "Zvýraznění slova pod kurzorem"
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "Ztotožnit hranice u slov do délky:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr "Ignorovat klíčová slova"
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr "Vypnout časovač pro označení aktuálního slova"
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr "Oříznout mezery (při zvýraznění aktuálního výběru)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum čítače"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Max. délka řádku:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum nedávných souborů"
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum nedávných souborů projektů"
#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Způsob vkládání metod"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Slučovat metody a vlastnosti"
#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Tlačítko"
#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Vlevo"
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Uprostřed"
#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "Svinout vše (Některé zborcené)"
#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "Svinout jedno (Některé zhroucené)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "Rozvinout vše (Některé zhroucené)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "Rozvinout jedno (některé zhroucené)"
#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Povoleno"
#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "Svinout všechny (Všechny roztažené)"
#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "Svinout jedno (Všechny roztažené)"
#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Nastavení 1"
#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr "Nastavení 2"
#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr "Myš:"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Jednoduchý"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr "Dvojitý"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr "Trojitý"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr "Čtyřnásobný"
#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Přidat"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Jakékoliv"
#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Odstranit"
#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Dolů"
#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Exportovat"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "Import"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Vlevo"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Uprostřed"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Předat řízení"
#: lazarusidestrconsts.dlgmouseoptbtnok
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Změnit"
#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Nahoru"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Zachytit"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Přesunout kurzor (extra)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Reaguj při uvolnění tlačítka myši"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Akce"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Klik"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Úpravy myši"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Zdvojená položka"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Tento záznam je v konfliktu s existujícím záznamem"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Tlačítko"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Kurzor"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Obsah"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Klik"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Akce"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Nahoru/dolů"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Volba"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Řadit"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorita"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Myš"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Pokročilé"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Příkaz-IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "A"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "A"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Žlábek"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Svinout strom"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Zasunuto [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Roztaženo [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Čísla řádek"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Výběr"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Jiné akce použitím stejného tlačítka"
#: lazarusidestrconsts.dlgmouseoptotheracthint
#, fuzzy
#| msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Můžou být spouštěny v závislosti na modifikační klávese, nastavení předání řízení, jednoduché/dvojité, stisknuto/povoleno, ..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtrovat modifikační klávesy"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorita"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Zprávy"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Vícenásobný výběr"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr "Najít editor pro cílové skoky:"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Pořadí použití kritérií pro nalezení vhodného editoru"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Posledně aktivní editor pro tento soubor"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (souboru) v posledně aktivním okně"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Seznam priorit kritérií pro výběr editoru:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Stránky a okna"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr "Záložky zápisníku:"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Pojmenování"
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Automaticky nepřejmenovávat"
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Bez zvýrazňování"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Umístění záložky zdrojového zápisníku"
#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "Dole"
#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Vlevo"
#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "Nahoře"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Nerozdělovat řádek po:"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Nerozdělovat řádek před:"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspektor objektů"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Výška položky"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Různé"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Volby"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Nastavení rychlosti"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Použít výchozí nastavení Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Použít výchozí nastavení Lazarusu"
#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimalizace:"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Jiné soubory jednotek (-Fu) (středník je oddělovač)"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr "Přepsání bloku"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Popisky pro paletu komponent"
#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Výchozí přípona pascalu"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Zvýraznit ovládací příkazy jako klíčová slova"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr "Volby rozšířených klíčových slov Pascalu"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Předat nastavení spojovači (mezera je oddělovač)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr "Zvýraznit klíčové slovo String"
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Výchozí"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Žádné"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Pouze \"String\""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr "Trvalý blok"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Trvalý ukazatel"
#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Skupina balíčků"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikace"
#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Vyčistit ikonu"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Vytvořit aplikační balík"
#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr "Aplikace zohledňující DPI (pro Vista+)"
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formuláře"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ikona:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(velikost: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(žádné)"
#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Načíst ikonu"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Různé"
#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Nastavení výstupu"
#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Uložit ikonu"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sezení"
#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Cílové jméno souboru:"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Nadpis:"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Použít aplikační balík pro spuštění a ladění (pouze darwin)"
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Použít soubor manifest k povolení grafických stylů (pouze Windows)"
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Volby projektu"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Volby pro projekt %s"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Soubory projektu"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "&Dotázat se při nahrazení"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Dokončení vlastnosti"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Jméno vlastnosti"
#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Automaticky zavřít překladový dialog"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Otevřít poslední projekt při startu"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Ukázat mezery od okrajů"
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Zobrazit dialog překladače"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Zobrazit mřížku"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Přichytit k mřížce"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Odkazy"
#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Regulární výrazy"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Nahradit &vše"
#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Nahradit s"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Hlášení"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Vodící čáry Vpravo, Dole"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Pravý klik provede výběr"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Pravý okraj"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Pracovní složka:"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Pravý klik provede výběr"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Vytváření vodících linek"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Výběr vodících linek"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Prostředí"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Místní"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systémové proměnné"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Použít zobrazení"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Uživatelské předefinování"
#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Proměnná"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Spustit s parametry"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Uložit nastavení plochy do souboru"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Uložený řádek"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Ukládat informace editoru k zavřených souborech"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Ukládat informace editoru k souborům projektu"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Rozsah"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Posunout o jedno méně"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr "Posouvání:"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Ukázat pokyny posuvníku"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Posouvání za konec souboru"
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "Kurzor za koncem řádku"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Vyhledávací adresář \"%s\" nenalezen."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Hledání přerušeno uživatelem."
#: lazarusidestrconsts.dlgsearchcaption
#, fuzzy
#| msgid "Searching..."
msgid "Searching ..."
msgstr "Hledání..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Cesty"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "&Vybraný text"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Nastavit všechny prvky na výchozí"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Nastavit prvek na výchozí"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Nastavit hodnotu vlastnosti"
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Ukázat titulky komponent"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Ukázat kompilované procedury"
#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Zobrazit nastavení překladače"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Ukázat čísla řádků"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Ukázat podmínky"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Ukázat ladící informace"
#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Ukázat definované makra"
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Ukázat pokyny editoru"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Ukázat vše"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Ukázat spustitelné informace (pouze Win32)"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Ukázat obecné informace"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Ukázat pokyny žlábku"
#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Ukázat pokyny"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Ukázat čísla řádků"
#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Ukázat poznámky"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Neukázat nic (pouze chyby)"
#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Zobrazit všechny procedury při chybě"
#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Ukázat pokyny posuvníku"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Ukázat přehled"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Ukázat zkoušené soubory"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Ukázat použité soubory"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Ukázat varování"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Ukázat jedno tlačítko v Panelu úloh"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Přeskočit dopředné deklarace tříd"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Chytré záložky"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol za (.~pp)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Čítač (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol ve předu (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Přichycovat k vodícím čarám"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Mezery"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Tipy pro hlavní tlačítka (Otevřít, Uložit, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Původ"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Statická klíčová slova v objektech"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zastavit po počtu chyb:"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Podvlastnosti"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Nastavení syntaxe"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab odsazuje bloky"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Ukázat čísla záložek v zápisníku"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátor k mezerám"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Šířka záložek"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Cílová rodina CPU"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Cílový OS"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Cílová platforma:"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Cílový procesor"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Složka pro sestavení pokusných projektů"
#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Text k nalezení"
#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Adresář \""
#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "sekund"
#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Výraz pro vyhodnocení nástrojových tipů."
#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Tipy v symbolech Nástrojů"
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Nahoře:"
#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Jméno souboru šablony"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr "Styl ořezání mezer"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Ukazatel nebo editace"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Řádek upravený"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Nechat řádek"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Pouze pozice"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Odstranit okrajové mezery"
#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Neurčitá optimalizace"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Navrátit zpět po uložení"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr "Vrátit zpět / Znovu opakovat:"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Omezení vrátitelných akcí"
#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "Otevřít"
#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Závislosti jednotky"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Obnovit"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Výstupní adresář jednotky (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Neuložený řádek"
#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Nahoru"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Zabalování kódu"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr "Použít přídavný Konfigurační soubor překladače"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr "Kreslení oddělovače"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Použít spouštěcí aplikaci"
#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "Použít soubor zpráv"
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Chyba při nahrávání uživatelského schéma ze souboru %s"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Použít (a upravit) nastavení globálního schéma"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Použít nastavení lokálního schéma"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Použít zvýraznění syntaxe"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Použít historii záložek při zavření záložky"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Use a unit from this project"
msgstr "Použít jednotku z tohoto projektu"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Užvaněnost během překládání:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Viditelný žlábek"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Viditelný pravý okraj"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&Pouze celková slova"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Šířka:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Win32 GUI aplikace"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Okno"
#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Poloha okna"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Slova"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Náhled"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Zapsat FPC logo"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Hromadně vybrané komponenty musí být z jednoho formuláře."
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr ""
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Smazat sekci"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Zrcadlit vodorovně"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Zrcadlit svisle"
#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Řadit"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Zpět o jeden"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Dopředu o jedno"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Přesunout dozadu"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Přesunout dopředu"
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save form as XML"
msgstr "Uložit formulář jako XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr ""
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Měřítko"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Vybrat vše"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr ""
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Velikost"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Volba: Přitáhnout k mřížce"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Volba: Přitáhnout k vodícím čarám"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-pořadí"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Na obou stranách"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr ""
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr ""
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr ""
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr ""
#: lazarusidestrconsts.histdlgcolumnloc
msgid "Location"
msgstr ""
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr ""
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = nic, 1 = vykreslit dělící linky pouze pro nejvyšší úroveň, 2 = vykreslit linky pro první dvě nejvyšší úrovně, ..."
#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Přidat soubor"
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Přidat soubory"
#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Přidat soubory do balíčku"
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Přidat soubory LFM a LRS pokud existují."
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Přidat do balíčku"
#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Přidat jednotku"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nejednoznačný typ předka"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Víceznačné jméno třídy"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Víceznačné jméno jednotky"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ předka"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Porušená závislost"
#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<vybrat existující soubor>"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Jméno třídy již existuje"
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Vytvořit nový soubor"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Závislost"
#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sExistující soubor: %s%s%s"
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Soubor již existuje"
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Soubor %s%s%s již existuje v projektu"
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Soubor je již obsažen v balíčku"
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Soubor je použit"
#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Jméno souboru:"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Jméno souboru"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Soubor není jednotka"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Neplatný typ předka"
#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Neplatný kruh"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Neplatné jméno třídy"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Neplatný soubor"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Neplatné jméno souboru"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Neplatné jméno jednotky"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s není platné jméno jednotky."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nové jméno třídy:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Nová komponenta"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nový soubor"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Pro závislost %s%s%s nebyl nalezen balíček.%sProsím vyberte existující balíček."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Jméno stránky je příliš dlouhé"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Stránka sady:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascalovské jednotky musí mít příponu .pp nebo .pas"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Dialog uložení souboru"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Zkrátit nebo rozšířit jméno souboru"
#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Ukázat vše"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Přepnout cesty"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Typ předka %s%s%S má stejné jméno jako %sjednotka %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Typ předka %s%s%s není platný paskalovský identifikátor."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Jméno třídy %s%s%s a typ předka %s%s%s jsou totožné."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Jméno třídy %s%s%s již existuje v%sBalíčku %s%sSoubor: %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Jméno třídy %s%s%s má stejné jméno jako %sjednotka %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Jméno třídy %s%s%s není platný identifikátor pascalu."
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Soubor %s%s%s už je v balíčku."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Soubor %s%s%s je částí aktuálního projektu.%sSdílet soubory mezi projekty a balíčky je špatný nápad."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Jméno souboru %s%s%s je neplatné, protože balíček zatím nemá předvolený adresář.%sProsím zadejte jméno souboru s úplnou cestou."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximální verze %s%s%s je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximální verze je nižší než Minimální verze."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimální verze %s%s%s je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Balíček již má závislost na balíčku %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Jméno balíčku %s%s%s není platné.%sProsím vyberte existující balíček."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Jméno stránky %s%s%s je příliš dlouhé (max. 100 znaků)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Jméno jednotky %s%s%s již v balíčku existuje:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Jméno jednotky %s%s%s již existuje v tomto balíčku."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Jméno jednotky %s%s%s%sa jméno souboru %s%s%s se liší."
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Jméno jednotky %s%s%s nesouhlasí s názvem souboru."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Jméno jednotky %s%s%s je stejné jako má registrované komponenta.%sToto použití může způsobit podivná"
#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Jméno souboru jednotky:"
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Jméno souboru jednotky:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Jméno jednotky:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Jméno jednotky už existuje"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Neplatné jméno jednotky"
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Prohlédnout jednotku pro jméno jednotky a registrační proceduru"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Zrušit změny?"
#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Nastala chyba během vytváření balíku aplikace: "
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Přerušit vše"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Přerušit celé načítání"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Přerušit načítání projektu"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Přerušit celé načítání"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentace:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "O IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "O Lazarusu"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licence: GPL/LGPL%sLazarus je IDE pro tvorbu (grafických a konzolových) aplikací s Free Pascalem. Free Pascal je (L)GPL Pascal a Object Pascal překladač, který beží ve Windows, Linuxu, Mac OS X, FreeBSD a jiných.%sLazarus je chybějící částí skládačky, která umožní vytvářet programy pro všechny výše uvedené platformy v prostředí podobném Delphi. IDE je RAD nástroj, který zahrnuje návrháře formulářů.%sVzhledem k tomu, že Lazarus roste, potřebujeme více vývojářů."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Nelze nalézt seznam přispěvatelů."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficiální:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze negrafické komponenty."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Poděkování"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Akce:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Akce:"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktivní"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktivní filtr"
#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "Přidat adresář"
#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Přidat soubory nebo z adresáře"
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Přídavné volby překladače zděděné z balíčků."
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Přidat nové sestavovací makro, kopírovat nastavení z \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Přidat nové makro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Přidat novou sadu"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Přidat požadavky balíčku?"
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Přidat balíček %s do projektu?"
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Přidat balíček do projektu"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Přidat závorky parametru"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr ""
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr ""
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Přidat do cesty zahrnutí?"
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Přidat %s do projektu?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Přidat do vyhledávací cesty jednotek"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Přidat rozhraní jednotky"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Přidat jednotku (nedoporučeno)"
#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "Přidat hodnotu:"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Přidat hodnotu do makra %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Přidat soubor do balíčku"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Cílový balíček"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Typ souboru"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Má registrační proceduru"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Neplatný balíček"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Neplatné ID balíčku: %s%s%s"
#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuální jednotka (zdrojové soubory nejsou v balíčku)"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Balíček je pouze pro čtení"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Balíček %s%s%s nenalezen."
#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Ukázat vše"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Soubor %s%s%s%s již je v balíčku %s."
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Balíček %s je pouze pro čtení."
#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Jméno jednotky: "
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Soubor %s%s%s už existuje.%sNahradit?"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Zarovnání"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Všechny bloky vypadají dobře."
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Všechny soubory"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Všechny zděděné volby"
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Povolit volání funkcí"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Povolit vyhledávání více řádků"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr ""
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Všechny vaše úpravy v %s%s%s%s budou ztraceny a soubor bude otevřen znovu."
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternativní klávesa"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternativní klávesa (nebo sekvence dvou kláves)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Vždy"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Vždy ignorovat"
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Nalezen nejasný soubor"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Nalezen víceznačný soubor: %s%s%s%sTento soubor může být chybě zaměněn za %s%s%s%s%sSmazat víceznačný soubor?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Víceznačné soubory nalezeny"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Víceznačná jednotka nalezena"
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Víceznačná jednotka nalezena"
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor ukotvení - nevybrán žádný ovládací prvek"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Povolený = Včetně %s v kotvách"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ukotvení vybraného ovládacího prvku"
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Ukotvit k dolní straně sourozence, udržovat okrajový prostor"
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Ukotvit k levé straně sourozence, udržovat okrajový prostor"
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Ukotvit k pravý straně sourozence, udržovat okrajový prostor"
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Ukotvit k horní straně sourozence, udržovat okrajový prostor"
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Při posledním startu došlo k chybě při načítání %s!%s%sNačíst znovu tento projekt?"
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "Přidat krátký popis k dlouhému popisu"
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Aplikace%sGrafický program LCL/FreePascal. Zdroj programu je automaticky spravován Lazarusem."
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Jméno třídy aplikace"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "příznaky sestavení (-B) použít také pro závislosti"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Použít konvence"
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Jednotka projektu nemůže být použita jinými balíčky/projekty"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Okrajový prostor kolem ovládacího prvku. Další čtyři okrajové prostory jsou přidány k této hodnotě."
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Soubor jednoduchého pascalovkého programu.%sLze jej použit pro rychlé a špinavé testování.%sLepší je vytvořit nový projekt."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Zeptat před nahrazením každého nalezeného textu"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Dotázat se na jméno komponenty po jejím umístění na návrhový formulář"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Zeptat se na jméno souboru při novém souboru"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Zeptat se na jméno při vytvoření"
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Automatické dokončení: vypnuto"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Automatické dokončení: zapnuto"
#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "Automaticky pokračovat"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Automaticky pokračovat po:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Značky a párování"
#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr "Automaticky"
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "Automaticky převést .lfm soubor na .lrs zahrnuté soubory"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Automaticky vyvolat po bodu"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "odsazení řádku"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "mezera"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "konec slova"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "nepřidávat znak"
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Doplňování a Tipy"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Automaticky ukázat"
#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Dostupné balíčky"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Vytvářet zálohy změněných souborů"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Zálohování souboru selhalo"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Vytvořit záložní adresář pod adresářem projektu"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Změna jména nebo verze balíčku naruší závislosti. Měly by být změněny také tyto závislosti?%sVyberte Ano ke změně všech uvedených závislostí.%sVyberte Ignorovat k porušení závislostí a pokračování."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "začátky"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Za vztaženými"
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Vždy sestavit před spuštěním"
#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Sestavit"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Sestavit povel"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Při sestavení projektu vykonej příkaz Souboru sestavení"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Pro spuštění projektu spusťte příkaz Spustit soubor"
#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Spustit"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Spustit příkaz"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Když tento soubor je aktivní v editoru ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Pracovní složka (nechejte prázné pro cestu souboru)"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Pracovní složka (nechejte prázdné pro cestu souboru)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Tlustě nevýchozí hodnoty"
#: lazarusidestrconsts.lisborderspace
#, fuzzy
#| msgid "BorderSpace"
msgid "Border space"
msgstr "Okrajový prostor"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Dolní"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Dolní okrajový prostor. Tato hodnota je přidána k základnímu okraji a je použita pro místo pod prvkem."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Dolní ukotvení"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Spodní části"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož spodní straně je ukotvený. Nechte prázdné pro rodiče."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Dolní prostor stejnoměrně"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Přerušit"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Vlastnosti bodů zastavení"
#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Procházet pro překladač"
#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Přerušit"
#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Pokračovat"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Najít"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Nahradit"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "sestavit všechny soubory projektu/balíčku/IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "sestavit IDE s balíčky"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Sestavení Lazarusu selhalo"
#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr "Sestavovací makra"
#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr "Sestavovací makra:"
#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "Režim sestavení"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Rozdíly mezi sestavovacími módy"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr "Rozdíly s ostatními sestavovacími módy"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Mód:"
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Režimy sestavení"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Sestavit nový projekt"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Číslo sestavení"
#: lazarusidestrconsts.lisbuildproject
msgid "Build project"
msgstr ""
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Volání %s k vytvoření Makefile z %s selhalo."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr ""
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Zrušit načítání této komponenty"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Zrušit načítání jednotky"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Zrušit přejmenování"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Nelze přeložit projekt"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Nelze zkopírovat komponentu na nejvyšší úrovni."
#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Nelze vytvořit soubor %s%s%s"
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Nelze nalézt spouštěč lazarusu:%s%s"
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Změnit lze pouze třídu dědící TComponent."
#: lazarusidestrconsts.liscaptiondiff
msgctxt "lazarusidestrconsts.liscaptiondiff"
msgid "Diff"
msgstr "Rozdíl"
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr ""
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr ""
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Změnit třídu %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "žádná třída"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Víceznačný překladač"
#: lazarusidestrconsts.lisccochecktestdir
#, fuzzy
#| msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Prosím zkontrolujte adresář Test v %sProstředí -> Nastavení prostředí -> Soubory -> Adresář pro sestavení"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Překladač \"%s\" není spustitelný soubor.%sPodrobnosti: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "obsahuje "
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Zkopírovat výstup do schránky"
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Datumy .ppu souborů FPC se liší o víc než hodinu.%sTo může znamenat, že jsou z různých instalací.%sSoubor1: %s%sSoubor2: %s"
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "chybí soubor anglických hlášení pro fpc:components/codetools/fpc.errore.msg"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "CHYBA: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Cesta jednotky FPC obsahuje zdrojový kód: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "nové řádkové symboly"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "POKYN: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Neplatný překladač"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Neplatná hledací cesta"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Neplatný testovací adresář"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Chybějící jednotka"
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "nenalezena přeložená FPC jednotka: %s.ppu"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "nalezeno více konfigurací překladače: "
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "nenalezen žádný fpc.cfg"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "ne ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu existuje dvakrát: %s, %s"
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Přeložená jednotka FPC %s.ppu nebyla nalezena.%sTo zpravidla znamená, že fpc.cfg obsahuje chybu nebo je instalace FPC poškozená."
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Existující soubor .ppu je starší než překladač samotný:%s%s"
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "nalezena relativní cesta jednotky v fpc cfg: %s"
#: lazarusidestrconsts.lisccoseveralcompilers
#, fuzzy
#| msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Ve vaší cestě je několik překladačů Free Pascalu.%s%s%sMožná jste zapomněli smazat starý překladač?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Přeskočit"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "speciální znaky"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Všechny testy se zdařily."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Nelze vytvořit testovací soubor"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Nelze vytvořit testovací pascalovský soubor \"%s\"."
#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Nelze získat datum souboru %s."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "neobvyklé znaky"
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Varování"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "VAROVÁNÍ: "
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "špatný oddělovač cest"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Skupiny"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Složitost"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konstanty"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Prázdné bloky"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Prázdné sekce tříd"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Prázdné konstruktory"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Prázdné procedury"
#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filtr)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Následovat kurzor"
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s v %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Je kořenový ovládací prvek"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr "Počet parametrů považován za \"příliš\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Dlouhé procedury"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Počet řádků procedury považován za \"dlouhý\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Mnoho vnořených procedur"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Mnoho parametrů"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Ukázat kategorie"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Ukázat uzly zdroje"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr "Počet vnořených procedur považován za \"příliš\""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Vystředit prvky vodorovně, relativně k daným sourozencům"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Vystředit prvky svisle, relativně k daným sourozencům"
#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr "Vystředit formulář"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Vystředit v okně"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Vystředit"
#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Upřednostněný prezentační režim"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Skupina"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Zdroj"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nikdy, pouze ručně"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Použito pouze v režimu kategorie"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Při nečinnosti"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Obnovit automaticky"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Jiné"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aktualizovat"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Když přepínání souboru v zdrojovém editoru"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedury"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Vlastnosti"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Zveřejněné vlastnosti bez výchozích hodnot"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "Ukázat pozorování o"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Styl"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr ""
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "K dokončení"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Typy"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Nepojmenované konstanty"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Nesetřídění členové"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Nesetříděná viditelnost"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Použití"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Proměnné"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Nesprávné odsazení"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occured during deletion of%s\"%s:%s\"%s%s"
msgstr "Došlo k výjimce během mazání%s\"%s:%s\"%s%s"
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Zrušit načítání tohoto zdroje"
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sTřída \"%s\" nenalezena."
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr "%s%sKomponenta: %s:%s"
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr "%s%sTřída komponenty: %s"
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Pokračovat v nahrávání"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Není známo, jak kopírovat upravovací výběr tohoto formuláře"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Není známo, jak vyjmout upravovací výběr tohoto formuláře"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Není známo, jak smazat upravovací výběr tohoto formuláře"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Chyba při vytváření komponenty"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Chyba při vytváření komponenty: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Chyba při rušení komponenty"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Chyba při rušení komponenty typu %s jednotky %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Chyba při rušení prostředníka"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Chyba při rušení prostředníka %s jednotky %s:%s%s"
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "Chyba čtení %s"
#: lazarusidestrconsts.liscfeinfile
msgid "%sIn file %s%s"
msgstr "%sV souboru %s%s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Neplatný vlastník komponenty"
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr "%sKořen=%s:%s"
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Zastavit všechna nahrávání"
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr "%sProud=%s"
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr "%s%sPozice proudu: %s"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm již existuje"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Neznámý typ %s"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Kde je TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator již existuje: %s"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "Editor komponenty třídy \"%s\" vytvořil chybu: %s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Komponentě typu %s se nepodařilo nastavit vlastníka na %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr "Nelze vyčistit upravovací výběr formuláře%s%s"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Změnit sestavovací mód"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Změnit třídu"
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Změnit kódování"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Změnit soubor"
#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change Parent..."
msgid "Change Parent"
msgstr "Změnit rodiče..."
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr ""
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr ""
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Znak"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa znaků"
#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Zkontrolovat změny na disku s načtením"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "zkontrolovat zda další element ve zdrojovém kódu je \"end\". Pokud ne, zapiš konec řádku + \"end;\" + konec řádku"
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Zkontrolovat nastavení"
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Ověřte cíl (OS, CPU, typ LCL widgetu). Možná musíte přeložit balíček pro tento cíl, nebo nastavit jiný cíl pro tento projekt."
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Vyberte jiné jméno"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Vyberte odkaz FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Vyberte klávesu..."
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Vyberte jméno pro novou komponentu"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "Vyberte pascalovských soubor pro ukázku odsazení"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Změnit soubor zpráv překladače"
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Vyberte jméno souboru překladače (%s)"
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Vyberte jméno souboru ladiče"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Vyberte balíček Delphi (.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Vyberte projekt Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Vyberte jednotku Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Vyberte adresář"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Vyberte zdrojový adresář FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Vyberte adresář Lazarusu"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Vyberte cestu k make"
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Vyberte jméno"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "K vytvoření nového souboru vyberte jednu z položek"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Vyberte jednu z těchto položek k vytvoření Balíčku"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Vyberte jednu z těchto položek k vytvoření Projektu"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Vyberte jednu z těchto položek k zdědění z existujícího"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Vyberte zdrojový soubor programu (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Vyberte strukturu k obklopení výběru"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Vyberte adresář na zkoušky"
#: lazarusidestrconsts.liscircleinmacros
msgid "Circle in macros"
msgstr "Kruh v makrech"
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Dokončení třídy"
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Konflikt třídy se souborem .lfm:%sJednotka %s%spoužívá jednotku %s%s, která obsahuje třídu %s,%s, ale soubor .lfm už obsahuje jinou třídu.%sMůže být jen jeden návrh třídy na jednotku.%sPřesuňte %s do jiné jednotky."
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Třídy a vlastnosti existují. Hodnoty nebyly zkontrolovány."
#: lazarusidestrconsts.lisclassesppunotfoundcheckyourfpccfg
msgid "classes.ppu not found. Check your fpc.cfg."
msgstr "classes.ppu nenalezen. Zkontrolujte Váš fpc.cfg."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Třída %s%s%s není třídou registrované komponenty.%sNelze vložit."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Třída nenalezena"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Třída %s%s%s metody %s%s%s nenalezena."
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Vyčistit adresář"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Vyčistit podadresáře"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Udržovat všechny textové soubory"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Nechat soubory odpovídající filtru"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Odstranit soubory odpovídající filtru"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Jednoduchá syntaxe (např. * namísto .*)"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Vyčistit zdrojové soubory Lazarusu"
#: lazarusidestrconsts.liscleanupandbuild
msgid "Clean up and build"
msgstr ""
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr ""
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Vyčistit cestu jednotky?"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Vyprázdnit adresář?"
#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr "Vymazat mapování klávesy"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "K procházení souboru klikněte zde"
#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Klikněte pro zobrazení možných použití"
#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Zavřít"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Zavřít soubory"
#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Skrýt okno"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Zavření okna editoru zdrojových kódů. Chcete zavřít všechny soubory nebo schovat okno?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Zavřít okno zdrojového editoru"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Volby rozhraní LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parametr"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponenty"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Dědičnost"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Seznam"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Víceznačný přídavný konfigurační soubor překladače"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Volat při:"
#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Sestavit"
#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Přeložit"
#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Spustit"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Příkaz:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Kód"
#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Prohlížeč kódu"
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"
#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "výchozí (%s)"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Nastavení vytváření kódu"
#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Přidat odkaz"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Přidat cestu"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Procházet"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Potvrdit nahrazení"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Vytvořit položku nápovědy"
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Odstranit vazbu"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Odstranit cestu"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Popis"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Chyby"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Příklad"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Vložit tučnou formátovanou značku"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Vložit formátovací značku kódu"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Vložit značku pro kurzívu"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Vložit značku poznámky"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Vložit značku pro podtržené písmo"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Vložit značku formátování proměnné"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Zděděný"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Vložit odkaz..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Vložit značku formátování odstavce"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(žádné)"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenalezen zděděný popis)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<ŽÁDNÝ>"
#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "Cesta souborů FPDoc"
#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "Nahradit"
#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "Uložit"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Související informace"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Krátky popis"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Krátký"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorovat konstanty v další funkci"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Hledat bezejmennou znakovou konstantu"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Pozorovatel kódu"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorovat další bezejmennou konstantu"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Přidat"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Přidat šablonu kódu"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Symbol %s%s%s již existuje! "
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Automatické dokončení na ..."
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Změnit"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentář:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Upravit šablonu kódu"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akce: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůže mít neautomaticky vytvořené uzly potomků."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automaticky generováno"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automaticky generované uzly nelze editovat."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor definic CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Náhled definic CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
#, fuzzy
#| msgid "compiler path"
msgid "Compiler path"
msgstr "Cesta překladače"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Převést uzel"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Vytvořit definice pro adresář %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Vytvořit definice pro překladač Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Vytvořit definice pro SVN zdroje Free Pascalu"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Vytvořit definice pro složku Lazarusu"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Vytvořit definice pro projekt %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Vytvořit FPC makra a cesty pro adresář projektu fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definovat"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definovat rekurentně"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Odstranit uzel"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: C:/Programy/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: C:/Programy/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Popis:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s složka"
#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Upravit"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Jinak"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "JinakPokud"
#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Chyba čtení %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Chyba čtení informací o projektu ze souboru %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Chyba během zapisování %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Chyba během zapisování informačního souboru projektu %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Ukončit"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Ukončit bez uložení"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "SVN zdrojový adresář FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "Pokud"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "PokudDefinováno"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "PokudNedefinováno"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Složka"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Vložit šablonu projektu Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Vložit šablonu projektu Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Vložit šablonu překladače Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Vložit šablonu adresáře Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Vložit šablonu projektu Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Vložit šablonu překladače Free Pascalu"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Vložit šablonu projektu Free Pascalu"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Vložit šablonu zdrojového kódu SVN Free Pascalu"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Vložit šablonu překladače Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Vložit šablonu adresáře Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Vložit šablonu projektu Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Vložit Adresářovou šablonu Lazarusu"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Vložit uzel jako potomka"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Vložit uzel pod"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vložit šablonu"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "neplatný rodič"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Neplatný rodičovský uzel"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Neplatný předchozí uzel"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy.%sNapříklad: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s základní adresář,%sv němž má Borland nainstalované všechny %s zdrojové kódy %spoužité tímto %sprojektem.%sNapříklad: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Adresář Lazarusu"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Přesunout uzel dolů"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Přesunout uzel o jednu úroveň dolů"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Přesunout uzel o jednu úroveň nahoru"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Přesunout uzel nahoru"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Jméno:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nový uzel"
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Uzel a jeho děti jsou platné pouze pro tento projekt"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Uzel je pouze pro čtení"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "žádné vybrané"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Rodičovský uzel nemůže obsahovat dětské uzly."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Předchozí uzel nemůže obsahovat uzly potomků."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Adresář projektu"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s složka projektu"
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, údaje projektu"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Chyba čtení"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Uložit a ukončit"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Vybrat uzel:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Zdrojový adresář Free Pascal SVN. Nevyžadované, ale zlepšuje hledání deklarací a ladění."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Adresář projektu Free Pascalu."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Zdrojový adresář SVN Free Pascalu"
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Hlavní adresář Lazarusu"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy
#| msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Cesta k překladači Free Pascal.%s Například %s/usr/bin/%s -n%s nebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Cesta překladače Free Pascal pro tento projekt. Vyžadováno jen pokud je nastaven FPC SVN zdroj níže. Použité pro automatické vytvoření maker."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Adresář projektu %s,%skterý obsahuje soubor .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Nedefinovat"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Nedefinovat vše"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Nedefinovat rekurentně"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Hodnota jako cesty souboru"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Hodnota jako text"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr ""
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Proměnná:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Chyba zápisu"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Zavináč"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Závorka"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dvojtečka"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Čárka"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Klíčové slovo"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nový řádek"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Žádné"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Číslo"
#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Tečka"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Středník"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Mezera"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Konstantní řetězec"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Spustit pak"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Spustit před"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Sesunout všechny třídy"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Sesunout všechny balíčky"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Sesunout všechny jednotky"
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Příkaz po"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Příkaz po neplatném"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Příkaz po publikování modulu"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametry příkazového řádku programu"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Překladač"
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Překladač \"%s\" nepodporuje cíl %s-%s"
#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Chyba překladače"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Chyba: neplatný kompilátor: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Jméno souboru překladače"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
#, fuzzy
#| msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Tip: cestu překladače můžete nastavit v Prostředí->Volby prostředí->Soubory->Cesta překaldače"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Poznámka: Nenalezen konfigurační soubor Nástrojů Kódu - použité výchozí"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Poznámka: načítání starého souboru voleb Nástrojů Kódu: "
#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Volby překladače pro projekt %s"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (kompilování ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Zobrazit dlouho řádkové tipy"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Rozšířit zcela vlevo"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Rozšířit o něco vlevo"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nikdy"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Rozšířit pouze vpravo"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr "Jméno komponenty \"%s\" je klíčovým slovem Pascalu."
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Jméno komponenty je klíčové slovo"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Jméno komponenty není platný identifikátor"
#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Najít komponentu"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Otevřít balíček"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Otevřít jednotku"
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Podmínka"
#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr "Podmíněné:"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Konfigurační adresář Lazarusu"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Nastavit sestavení %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Nastavení %sSestavení Lazarusu%s"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Nastavit Lazarus IDE"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus se znovu sestaví s těmito profily:%sPokračovat?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Potvrdit změny"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Potvrzení smazání"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Chcete znovu sestavit Lazarus s profilem: %s ?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Potvrdit novou sadu balíčků pro IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Akce"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nová sada balíčků"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Stará sada balíčků"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konzolová aplikace"
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Kód konstruktoru"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "obsahuje"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Kontextová"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Pokračovat"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Pokračovat a již se znovu neptat"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Pokračovat bez načtení formuláře"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Přispěvatelé"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Prvek potřebuje rodiče"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Přidá posunutí k hornímu okraji prvků uvnitř vizuálních kontejnerů"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Posunutí okrajů"
#: lazarusidestrconsts.lisconvdelphiaddedpackagerequirement
msgid "Added Package %s as a requirement."
msgstr "Balíček %s přidán jako vyžadovaný."
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Všechny podadresáře budou prohledány pna soubory jednotek"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools selhalo!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Kategorie:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Převod přerušen."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Převod připraven"
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Převod balíčku Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Převod projektu Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Převod jednotky Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfile
msgid "* Converting file %s *"
msgstr "* Převádění souboru %s *"
#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
#, fuzzy
#| msgid "*** Converting unit files... ***"
msgid "*** Converting unit files ... ***"
msgstr "*** Převádění souborů jednotek... ***"
#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr "Hlavní zdrojový soubor balíčku Delphi (.dpk) nebyl nalezen pro balířek%s%s"
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Chyba=\"%s\""
#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr "%s(%s,%s) Chyba: Nelze najít jednotku %s"
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Převod jednotky selhal"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "Selhal převod jednotky%s%s%s"
#: lazarusidestrconsts.lisconvdelphifindallunitfiles
#, fuzzy
#| msgid "*** Find all unit files... ***"
msgid "*** Find all unit files ... ***"
msgstr "*** Najít všechny soubory jednotek... ***"
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Opravena velikost znaků jednotky \"%s\" na \"%s\"."
#: lazarusidestrconsts.lisconvdelphifixingusedunits
msgid "* Fixing used units for file %s *"
msgstr "* Oprava použitých jednotek souboru %s *"
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Funkce Delphi"
#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr "Uchovat obě"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) chybějící zahrnuté soubory"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Jméno Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Jméno balíčku existuje"
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Jednotka %s vypuštěna z projektu"
#: lazarusidestrconsts.lisconvdelphiremovedunitinusessection
msgid "Removed unit \"%s\" in uses section."
msgstr "Odstraněna jednotka \"%s\" ze sekce použitých jednotek."
#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr "Odstranit první"
#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr "Odstranit druhou"
#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "* Repairing form file %s *"
msgstr "* Oprava formulářového souboru %s *"
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
#, fuzzy
#| msgid "*** Repairing form files... ***"
msgid "*** Repairing form files ... ***"
msgstr "*** Opravování formulářového souboru... ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Nahrazena jednotka \"%s\" jednotkou \"%s\" v sekci používaných jednotek."
#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr "Některé jednotky balíčku Delphi chybí:%s%s"
#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr "Existují dvě jednotky se stejným jménem jednotky:%s%s%s%s%s"
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Již existuje balíček se jménem \"%s\"%sProsím, zavřete nejdříve tento balíček."
#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr "Jméno jednotky existuje dvakrát"
#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr "Jednotky nenalezeny"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Jednotky k nahrazení v %s"
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Chyba převodu"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Převést"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Převést kódování"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Převést kódování projektů/balíčků"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Převést projekt nebo balíček"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Převaděč přidá podmíněný překlad k podpoře různých cílů"
#: lazarusidestrconsts.lisconverttargetmultiplatform
msgid "Multi-Platform"
msgstr "Multi platformní"
#: lazarusidestrconsts.lisconverttargetmultiplatformhint
msgid "Multi-Platform versus Windows-only"
msgstr "Multi platformní versus Pouze pro Windows"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Použít stejný formulářový DFM soubor"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Stejný DFM soubor pro Lazarus i Delphi místo kopírování do LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Podporovat Delphi"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Použít podmíněný překlad k podpoře Delphi"
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Nahrazování funkcí"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Některé funkce Delphi mohou být nahrazeny funkcemi LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funkce / procedury k nahrazení"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Levé posunutí"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nové jméno"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Rodičovský kontejner"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Horní posunutí"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Nahrazení typu"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Neznámé typy v souboru formuláře (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Typy k nahrazení"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Nahrazení jednotky"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Jména jednotek v sekci \"uses\" zdrojové jednotky"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Jednoty k nahrazení"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Neznámé vlastnosti"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Kopírovat vše"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr "Zkopírovat všechny položky do schránky"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Zkopírovat celý výstup do schránky"
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr "Kopírovat všechny zobrazené a skryté zprávy do schránky"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr "Kopírovat všechny zobrazené zprávy do schránky"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Zkopírovat popis do schránky"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Chyba kopírování"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Chyba kopírování"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Zkopírovat %s%s%s do schránky"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopírování celého formuláře není implementováno."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr "Zkopírovat položku do schránky"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr "Zkopírovat vybrané položky do schránky"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Zkopírovat vybraná hlášení do schránky"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Snímat pro zprávy FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Snímat pro zprávy Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Kontrolovat na zprávy:"
#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Ukázat všechna hlášení"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Přeskočit volání překladače"
#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Speciální nastavení pro cílový OS"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Nelze přidat %s{$I %s%s} do hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Nelze přidat %s{$R %s%s} do hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Nelze přidat %s%s%s do hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Nelze odstranit %s%s%s z hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Nelze odstranit %s{$I %s%s} z hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Nelze odstranit %s{$R %s%s} z hlavního zdrojového kódu!"
#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (různé)"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
#, fuzzy
#| msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá FreePascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Otevřít balíček %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Otevřít jednotku %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Vytvořte nejdříve projekt!"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Vytvořit adresář?"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Vytvořit funkci"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Vytvořit uzel nápovědy"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Vytvořit to"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Vytvořit projekt"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Vytvořit/aktualizovat soubor .po při uložení souboru lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Vytváření indexového souboru zdrojových kódů FPC %s ..."
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Vyberte adresář"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Hodnoty adresářů Nástrojů Kódu"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definovat šablony"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<žádná proměnná nevybrána>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Otevřít náhled"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Nástroje"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Proměnná: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Jméno proměnné"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Šablony"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "vyberte makro prosím"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Vybrat makro kódu"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Aktuální"
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Sloupec kurzoru v aktuálním editoru"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Řádek kurzoru v aktuálním editoru"
#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr "Vlastní sestavovací makra"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed directly to the compiler. Macros are replaced, line breaks are replaced with single spaces."
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "vlastní nastavení"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Vlastní nastavení"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Vlastní program"
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
msgid "Custom Program%sA Free Pascal program."
msgstr "Vlastní program%sFree Pascal program."
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Datový modul"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Smazat vše"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Smazat vše"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Zakázat vše"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Zakázat vše"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Povolit vše"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Povolit vše"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr "Kopírovat do schránky"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr ""
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr ""
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr ""
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr ""
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr ""
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr ""
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr ""
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr ""
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr ""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr ""
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Odstranit"
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Odstranit"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Zakázat"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Zakázat"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Povolit"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Povolit"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nebyl určen ladící nástroj"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Přesto nastavit bod přerušení"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Není zadaný ladič.%sNastavení bodu přerušení nemá význam, dokud nenastavíte ladič v dialogu Volby ladiče v menu."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Zapnout/Vypnout"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Zakázat/Povolit změny pro celé okno"
#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Chyba ladiče"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Chyba ladiče%sLadič je v chybovém stavu%sUložte svou práci!%sPoužijte Stop, a doufejte v nejlepší."
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackless
msgid "Less"
msgstr ""
#: lazarusidestrconsts.lisdebuggerfeedbackmore
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackmore"
msgid "More"
msgstr "Více"
#: lazarusidestrconsts.lisdebuggerfeedbackok
#, fuzzy
#| msgid "Ok"
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackok"
msgid "OK"
msgstr "Ok"
#: lazarusidestrconsts.lisdebuggerfeedbackstop
msgctxt "lazarusidestrconsts.lisdebuggerfeedbackstop"
msgid "Stop"
msgstr "Zastavit"
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr ""
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Neplatný ladič"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (ladění ...)"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Přidat výjimku"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Doplňující prohledávací cesty"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Bod přerušení"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Smazat záznam při spuštění"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Ladič"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Obecná nastavení ladícího nástroje"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Speciální nastavení pro ladič (záleží na typu ladiče)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Zdvojený název výjimky"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Zadejte jméno výjimky"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Záznam událostí"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Obslouženo"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Obslouženo ladícím nástrojem"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Obslouženo programem"
#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorovat tyto výjimky"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Výjimky jazyku"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
#, fuzzy
#| msgid "Limit linecount to"
msgid "Limit line count to"
msgstr "Omezit počet řádek na"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Jméno"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Upozornit při výjimce Lazarusu"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Výjimky OS"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Výstup"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Obnovit"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Obnovit jako obsloužené"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Obnovit jako neobsloužené"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Zobrazit hlášení při zastavení"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signály"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Vlákno"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr ""
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr ""
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nelze načíst soubor"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Nelze načíst soubor %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Číselný"
#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "Výchozí hodnota"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Zpoždění pro dlouho řádkové tipy v rámci dokončování"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Zpoždění pro tipy a rámec dokončování"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Smazat vše"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Smazat všechny body přerušení?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Smazat všechny body přerušení v souboru %s%s%s?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Smazat vše ve stejném zdroji"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Odebrat všechny vybrané body přerušení?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Odstranit všechny tyto soubory?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Odstranit víceznačný soubor?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Odstranit Bod přerušení"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Smazat bod přerušení na%s\"%s\"řádku %d?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr "Smazat sestavovací makro %s%s%s?"
#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr "Odstranit režim sestavení"
#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "Odstranit režim sestavení?"
#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr "Odstranit režim sestavení %s%s%s?"
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Odstranění souboru selhalo"
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr "Smazat makro %s"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Smazat mód \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Odstranit starý soubor %s%s%s?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Smazat starý soubor?"
#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "Odstranit řádek"
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Smazat vybrané soubory"
#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr "Smazat nastavení"
#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr "Smazat nastavení?"
#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr "Smazat nastavení %s%s%s?"
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Odstranit hodnotu %s%s%s"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Smazat hodnotu %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Odstranění souboru %s%s%s selhalo."
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Balíček Delphi"
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Projekt Delphi"
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Jednotka Delphi"
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Již existuje jiná komponenta se stejným jménem %s%s%s."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cílová složka"
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Cílová složka %s%s%s je neplatná.%sProsím vyberte a celou cestu."
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Kód destruktoru"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Nerozlišovat velikost znaků"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorovat prázdné řádky při přidávání a odstraňování"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorovat rozdílné konce řádků (např. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorovat množství znaků mezer"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorovat mezery (nezahrnovat znaky nových řádků)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorovat mezery na konci řádku"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorovat mezery na začátku řádku"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Pouze výběr"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Otevřít Diff v editoru"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Cifry:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Pokyny"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Pokyny pro novou jednotku"
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Adresář %s%s%s nenalezen."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "adresář %s nenalezen"
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Adresář není zapisovatelný"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Adresář, do nějž IDE dává soubory .po"
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Zakázat vše ve stejném zdroji"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Zakázat Bod přerušení"
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Zakázáno"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr ""
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Zakázat I18N pro LFM"
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr "Jít na adresu"
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr "Jít na adresu"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr "Jít na aktuální adresu"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr "Jít na aktuální adresu"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Zahodit změny"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Zahodit všechny změny"
#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Změněné soubory:..."
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Ke zobrazení rozdílu klikněte na jednu z položek nahoře"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Chyba načítání souboru: %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorovat změny na disku"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Znovu načíst z disku"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Některé soubory se na disku změnily:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Rozlišovat velká a malá písmena např. A a a"
#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editor dokumentace"
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s neexistuje: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr ""
#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Nezavírat IDE"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Nezavírat projekt"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "nepřekládat závislosti"
#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr "Neinstalovat"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Nezobrazovat úvodní obrázek při startu"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Nezobrazovat tento dialog pro tento projekt"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Neukazovat znova tuto zprávu"
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Kreslit čáry mřížky"
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Zkopírovat vybrané komponenty do schránky"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Vyjmout vybrané komponenty do schránky"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Přesunout komponentu o jedno dozadu"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Přesunout komponentu o jedno dopředu"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Přesunout komponentu dozadu"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Přesunout komponentu dopředu"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Vložit vybrané komponenty ze schránky"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Vybrat rodičovskou komponentu"
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Nalezeno zdvojení hodnoty %s%s%s."
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Zdvojené jméno: Komponenta pojmenovaná %s%s%s již existuje ve zděděné komponentě %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Duplicitní ppu soubor. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Zdvojit prohledávací cestu"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Duplicitní zdroje. Smažte jeden nebo se ujistěte, že všechny prohledávané cesty mají správné pořadí (Tip: FPC používá poslední cestu jako první)."
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Upravit kontextovou nápovědu"
#: lazarusidestrconsts.liseditorfiletypes
msgid "Editor file types"
msgstr "Typy souborů editoru"
#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Vyberte schéma"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Všechny balíčky"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuální projekt"
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Aktuální adresář projektů"
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Doplňky ke globální cestě zdrojových kódů"
#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Cesta k zahrnutí do projektu"
#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Cesta k zdrojovým kódům projektu"
#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Cesta k jednotkám projektu"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Všechny projekty"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "nastavit FPC režim na DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "nastavit FPC režim na FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "nastavit FPC režim na GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "nastavit FPC režim na MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "nastavit FPC režim na TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "nastavit IOCHECKS na"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "nastavit OVERFLOWCHECKS na"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "nastavit RANGECHECKS na"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "použít jednotku HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "použít jednotku LineInfo"
#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru."
#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Nástroj pro úpravy"
#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Skrýt hlavní formulář"
#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Vložit"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Klávesa"
#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Makra"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametry:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Jméno souboru programu:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Hledat zprávy FPC ve výstupu"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Hledat zprávy make ve výstupu"
#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Požadováno název a jméno souboru"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Pracovní složka:"
#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Všechno"
#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Prázdné metody"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Nalezeny prázdné metody:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Žádná třída"
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Žádná třída v %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Pouze zveřejněné"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Veřejný"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Zveřejněné"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Odstranit metody"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Hledat v těchto sekcích tříd:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Nelze zobrazit prázdné metody aktuální třídy, protože%s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Prázdné"
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Editovat vše"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Povolit vše ve stejném zdroji"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Povolit Bod přerušení"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Povoleno"
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr ""
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Povolit internacionalizaci a podporu překladů"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Povolit makra"
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Ohraničit"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Uzavřít do $IFDEF"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Kódování souboru %s%s%s%sna disku je %s. Nové kódování je %s."
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Kódování souboru %s%s%s%sna disku je %s. Nové kódování je %s."
#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Zadejte překladový jazyk"
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Proměnná prostředí, jméno jako parametr"
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Skoč ze zprávy do zdrojové řádky při dvojkliku (jinak jednoduchý klik)"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Složka nenalezena"
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Zdrojový adresář FPC \"%s\" nenalezen."
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Neplatný název souboru překladače"
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Soubor překladače \"%s\" není spustitelný."
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Neplatný název souboru ladiče"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Soubor ladiče \"%s\" není spustitelný."
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Adresář zdrojových kódů FPC \"%s\" vypadá poškozený. Běžně obsahuje adresáře jako rtl/inc, packages/fcl-base, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Adresář Lazarusu \"%s\" vypadá poškozený. Běžně obsahuje adresáře jako lcl, debugger, designer, components, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Neplatné jméno make"
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Soubor Make \"%s\" není spustitelný."
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Nenalezen adresář Lazarusu \"%s\"."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testovací složka \"%s\" nenalezena."
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "POZNÁMKA: nyní jsou podporovány pouze plné cesty"
#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Šířky tabelátorů"
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Nesprávná volba na pozici %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Volba na pozici %d nepovoluje argument: %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Volba na pozici %d potřebuje argument : %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Chyba: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Chyba vytváření souboru"
#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Chyba vytváření lrs"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Chyba mazání souboru"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Chyba v %s"
#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Chyba inicializace programu%s%s%s%s%sChyba: %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Chyba ve jméně souboru překladače:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Chyba ve vlastních nastaveních překladače (Ostatní):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Linking / Pass options to linker):"
msgstr "Chyba ve vlastních nastaveních spojovače (Spojování / Předat volby spojovači):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Chyba v \"Přidané cesty Ladiče\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Chyba v prohledávaných cestách pro \"Zahrnuté souboru\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Chyba v prohledávaných cestách pro \"Knihovny\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Chyba v prohledávaných cestách pro \"Soubory objektů\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Chyba v prohledávaných cestách pro \"Ostatní zdroje\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Chyba v prohledávaných cestách pro \"Ostatní soubory jednotek\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Chyba v \"výstupní adresář jednotek\":"
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Chyba načítání souboru"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Chyba načítání souboru \"%s\":%s%s"
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Chyba načítání %s z%s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Chyba přesunu komponenty"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Chyba přesunu komponenty %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Chyba pojmenování komponenty"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Chyba otevírání komponenty"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Chyba analýzy komponentového proudu lfm."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Chyba načítání seznamu balíčků ze souboru%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Chyba načítání XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Chyba čtení xml souboru %s%s%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Chyba přejmenování souboru"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Chyby"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Chyba ukládání %s do %s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Chyba nastavení jména komponenty %s na %s"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Chyba zápisu do souboru \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Chyba zápisu seznamu balíčků do souboru%s%s%s%s"
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Upravit vlastní prohledávače (%s)"
#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr "Vyhodnotit výraz"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "&Vyhodnocení"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr ""
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr ""
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr ""
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr ""
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Každé n-té číslo řádku:"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Ukázkový soubor:"
#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Příklady"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Příklady:%sIdentifikátor%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Upozornění výjimky Ladiče"
#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Filtr vyřazení"
#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "Filtr vyřazení"
#: lazarusidestrconsts.lisexecutable
msgid "Executable"
msgstr ""
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Vykonávání příkazu po"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Vykonávání příkazu před"
#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Vykonání pozastaveno"
#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s Address: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Vykonávání pozastaveno%s Adresa: $%s%s Procedura: %s%s Soubor: %s%s(Někdy tu může být okno assembleru:)%s"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Vykonání zastaveno"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programy"
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Rozevřít všechny třídy"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Rozevřít všechny balíčky"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Rozevřít všechny jednotky"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Úplné souborové jméno aktuálního souboru v editoru"
#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Exportovat..."
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportovat seznam"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Výraz:"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Rozšířit cestu jednotky?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Rozbalit"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Rozbalit proceduru"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Vnější nástroje"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Nelze spustit nástroj"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Dosažen max. počet nástrojů"
#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Dolů"
#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Nahoru"
#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Odstranit"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Toto je maximální počet nástrojů %s."
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" hotovo"
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Nelze spustit nástroj %s%s%s:%s%s"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Selhalo vytváření Aplikačního balíku pro \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Načtení stavu složení selhalo"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Redukovat vykreslování návrháře"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Vykreslovat prvky návrháře pouze při nečinnosti (snižuje zatížení u pomalých počítačů)"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Přípona souboru programu"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtr souboru"
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Soubor %s%s%s byl pozměněn. Uložit?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Soubor nemá projekt"
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Soubor není spustitelný"
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Soubor není zapisovatelný"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Soubor je symbolický odkaz"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Soubor %s%s%s je virtuální."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Chyba vazby souboru"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Jméno souboru/Adresa"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Soubor nenalezen"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Soubor %s%s%s nenalezen.%s"
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "soubor %s nenalezen"
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "soubor nenalezen"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Soubor %s%s%s nenalezen.%sChcete jej vytvořit?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Soubor není s malými písmeny"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Soubor není textový"
#: lazarusidestrconsts.lisfilesettings
#, fuzzy
#| msgid "File Settings ..."
msgid "File Settings"
msgstr "Nastavení souboru..."
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr ""
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Soubory v ASCII nebo v kódování UTF-8"
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Soubor, které nejsou v ASCII ani kódování UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "soubor, kam je zapisován ladící výstup. Pokud není uveden, ladící výstup je vypisován do konzoly."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtr"
#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(filtr)"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtr: %s"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Sady filtrů"
#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Rozlišovat velikost znaků"
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Nastavení složky"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "File mask"
msgstr ""
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Zahrnout podadresáře"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Víceřádkový vzor"
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Pouze textové soubory"
#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Regulární výrazy"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "hledat všechny soubory v &projektu"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "hledat všechny &otevřené soubory"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "hledat v &adresářích"
#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Text k nalezení:"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Kde"
#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "&Pouze celková slova"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Najít kombinaci kláves"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Hledat scházející jednotku"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "První"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Opravit LFM soubor"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Plovoucí čárka"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Vynutit přejmenování"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Formulář"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Chyba formátování"
#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Chyba načtení formuláře"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Nalezena verze %s, očekávána %s"
#: lazarusidestrconsts.lisfpccfgismissing
msgid "fpc.cfg is missing."
msgstr "chybí fpc.cfg"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake selhal"
#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Komponenty"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Zdroje FPC"
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Chyba zdrojového adresáře FPC"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Zdroje FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "Příliš staré FPC"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Verze FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Verze FPC (např. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Chyba zápisu \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Syntaktická chyba FPDoc"
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Syntaktická chyba v fpdoc elementu \"%s\":%s%s"
#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Nalézt paletu komponent"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Rámec"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Hledat pozpátku"
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"
#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Nenalezen Free Pascal Compiler"
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Program FreePascal používající TCustomApplication pro snadnější zjišťování voleb příkazového řádku, obsluhu výjimek, atd. Zdrojový program je automaticky spravovaný Lazarusem."
#: lazarusidestrconsts.lisfreepascalsourcedirectory
#, fuzzy
#| msgid "Freepascal source directory"
msgid "Free Pascal source directory"
msgstr "Zdrojová složka Freepascalu"
#: lazarusidestrconsts.lisfreepascalsourcefile
#, fuzzy
#| msgid "FreePascal source file"
msgid "Free Pascal source file"
msgstr "Zdrojový soubor Free Pascalu"
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Zdrojové kódy Free Pascalu nenalezeny"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Hleda&t dopředu"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Doplňující soubory k vyhledání (např. /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Najít nebo přejmenovat identifikátor"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Najít odkazy"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifikátor: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "ve všech otevřených balíčcích a projektech"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "v aktuální jednotce"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "v hlavním projektu"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "v projektu/balíčku vlastnícím aktuální jednotku"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Neplatný identifikátor"
#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Přejmenování"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Přejmenovat všechny výskyty"
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Přejmenovat na"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Hledat také v příkazech"
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Kde hledat"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Funkce"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Obecné"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "získat slovo na aktuální pozici"
#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr "Přejít na řádek"
#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Přejít na vybraný zdrojový řádek"
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <rok> <jméno autora> <kontakt>%sTento zdrojový kód je svobodný program; můžete ho rozšiřovat a/nebo upravovat podle podmínek GNU Všeobecné veřejné licence, tak jak je zveřejněná Nadací Free Software; verze 2 licence nebo (podle svého rozhodnutí) jakékoliv pozdější verze. %sTento zdrojový kód je šířen v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez zahrnuté záruky PRODEJNOSTI nebo VHODNOSTI NA PŘÍSLUŠNÝ ÚČEL. Další detaily získáte v GNU Všeobecné veřejné licenci. %sKopie GNU Všeobecné Veřejné Licence je dostupná přes World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Můžete ji získat také napsáním do Nadace Free Software, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Skupina"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Narůst na největší"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Má nápovědu"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Hlavičkový komentář pro třídu"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Položky nápovědy"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Výběr nápovědy"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Šestnáctkový"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
#, fuzzy
#| msgid "Help for FreePascal Compiler message"
msgid "Help for Free Pascal Compiler message"
msgstr "Nápověda pro zprávy překladače FreePascalu"
#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "Skrýt zprávy pomocí direktivy"
#: lazarusidestrconsts.lishint
msgid "Hint"
msgstr "Tip"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Tip: přednastavená hodnota může být definována v podmíněných."
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Tip: Zkontrolujte, zda dva balíčky neobsahují jednotku se stejným jménem."
#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "Pokyn: Klikněte na příkaz, který chcete editovat"
#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Otevřít"
#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "Pozastavit"
#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Spustit"
#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "Uložit"
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Uložit vše"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Vejít do"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Spustit do návratu z funkce"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Přejít přes"
#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Zastavit"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Tip: Funkce \"Vytvořit Řetězec Zdrojů\" očekává řetězcovou konstantu.%sProsím vyberte výraz a zkuste znova."
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Tip: Funkce \"Vytvořit Řetězec Zdrojů\" očekává řetězcovou konstantu.%sProsím vyberte jen řetězcový výraz a zkuste znova."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Přepni Formulář/Jednotka"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Zobrazit formuláře"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Zobrazit jednotky"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Čítač"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databáze"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Volby nápovědy"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Vlastnosti:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Zobrazovače"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Cesta FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontální"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Volby sestavení IDE"
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Vytvořit Makefile pro balíček %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Chyba: spuštění nástroje 'přeložit po' selhalo pro balíček %s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informace o IDE"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "VAROVÁNÍ: neplatné jméno jednotky %s, balíček=%s"
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identifikátor začíná s..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identifikátor obsahuje..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Volby IDE:"
#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "Ukázat adresář projektu v titulku IDE"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Titulek IDE začíná názvem projektu"
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Chyba přistupování k xml"
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Chyba přístupu k xml souboru %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Chyba načítání xml"
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Chyba načítání xml souboru %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Exportovaný soubor existuje"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Exportovaný soubor %s%s%s existuje.%sOtevřít soubor a nahradit jen volby překladače?%s(Ostatní nastavení zůstanou zachována.)"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Načíst ze souboru"
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Otevřít nebo načíst nastavení překladače"
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Otevřít nedávný"
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Nedávné soubory"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Uložit soubor"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Uložit do nedávných"
#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorovat vše"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorovat a pokračovat"
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorovat binární"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorovat tento typ výjimky"
#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Ignorovat chybějící soubor"
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorovat, použít TForm jako předka"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Přizpůsobit odsazení aktuální jednotce, projektu nebo balíčku"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Komentář provedení pro třídu"
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importovat seznam"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Nemožné"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "Ve zdrojovém adresáři balíčku \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "Ve zdrojovém adresáři projektu. Ověřte duplicity."
#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Filtr zahrnutí"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "Cesta zahrnutí"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Cesty pro začleněné soubory"
#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "Odsazení"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "Odsazení pro zdrojové texty pascalu"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Index"
#: lazarusidestrconsts.lisinfobuildabort
#, fuzzy
#| msgid "Aborted..."
msgid "Aborted ..."
msgstr "Přerušeno..."
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Kompilovat projekt"
#: lazarusidestrconsts.lisinfobuildcomplile
#, fuzzy
#| msgid "Compiling..."
msgid "Compiling ..."
msgstr "Překládání..."
#: lazarusidestrconsts.lisinfobuilderror
#, fuzzy
#| msgid "Error..."
msgid "Error ..."
msgstr "Chyba..."
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Chyby:"
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Pokyny:"
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Řádky:"
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Přerušit"
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Poznámky:"
#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Projekt:"
#: lazarusidestrconsts.lisinfobuildsuccess
#, fuzzy
#| msgid "Success..."
msgid "Success ..."
msgstr "Úspěch..."
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Varování:"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informace"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informace o %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informace o použitém FPC"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "V prohledávané cestě jednotek FPC. Zřejmě instalováno balíčkem FPC. Ověřte, zda překladač a soubory ppu jsou ze stejné instalace."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Před související"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Zděděná položka"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Zděděné komponenty projektu"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Před vytvořením čisté kopie projektu/balíčku budou smazané všechny soubory v následujícím adresáři a veškerý jejich obsah bude ztracen.%s%sSmazat všechny soubory v %s%s%s?"
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "vložit datum"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "vložit datum a čas"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Vložit datum a čas. Volitelně: formátovací řetězec"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Vložit datum. Volitelně: formátovací řetězec"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "vložit konec pokud je třeba"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Vložit makro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Vložit jméno aktuální procedury"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Vložit značku PrintShort"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Vložit značku printshort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "vložit hlavičku procedury"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "vložit jméno procedury"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "vložit čas"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Vložit čas, Volitelné: formátovaný řetězec"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Vložit značku url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "V sezení"
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Zkoumat"
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Data"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Prohlížeč ladění"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Metody"
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Vlastnosti"
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Instalace selhala"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Nainstalovat jej, mám to rád tučné"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Instalovat výběr"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr "Instalovat/Odinstalovat balíčky"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Místo překladu balíčku vytvořte jednoduchý Makefile."
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interaktivní"
#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr "Neplatné sestavovací makro %s%s%s. Sestavovací makro musí být identifikátor Pascalu."
#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr "Neplatné sestavovací makro \"%s\". Jméno je klíčovým slovem."
#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "Neplatný kruh"
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Neplatný povel"
#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Neplatný název souboru Překladače"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Neplatné odebrání"
#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Neplatný cílový adresář"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Neplatný výraz:%s%s%s%s"
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Neplatný výraz.%sTip: Funkce \"Vytvořit Řetězce Zdrojů\" očekává řetězcovou konstantu v jediném souboru. Prosím vyberte výraz a zkuste znova."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Neplatný filtr"
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Neplatný adresář zdrojových kódů FreePascalu"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Chybný řádek, sloupec ve zprávě%s%s"
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Neplatný mód %s"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Neplatný vícenásobný výběr"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Neplatný (Vypnuto)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Neplatný (Zapnuto)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Neplatný Pascalovský identifikátor"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Jméno \"%s\" není platný pascalovský identifikátor."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Neplatný název procedury"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Neplatné jméno projektu"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Neplatný adresář pro zveřejňování"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Neplatný výběr"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr "Neplatná verze v %s"
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr "%s je skupinou. Nastavení může být přidáno pouze k normálním sestavovacím módům."
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s už je částí projektu."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s je chybné jméno projektu.%sProsím vyberte jiné (např. project1.lpi)"
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s je %s.%sTaková cyklická závislost není povolená."
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "adresář nenalezen"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Jak se to mohlo stát? Chyba v %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Jak se to mohlo stát? Chyba v hlavním adresáři:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Historie skoků"
#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "udržovat"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Uchovat"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Uchovat převedené soubory otevřené v editoru"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Všechny soubory projektu budou po převodu otevřeny v editoru"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Uchovat v seznamu instalovaných"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Zachovat jméno"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Zachovat relativní odsazení víceřádkové šablony"
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Zachovat odsazení"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ponechat je a pokračovat"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Vlastní příkazy"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Povely návrháře"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Příkazy inspektoru objektů"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Klávesa (nebo pořadí dvou kláves)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Přerušit sestavování"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add address breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add source breakpoint"
msgstr ""
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Přidat sledování"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Sestavit projekt/program"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Vyberte schéma mapování kláves"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Vzor"
#: lazarusidestrconsts.liskmcleanupcompiled
msgid "Clean up build files"
msgstr ""
#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Zavřít vše"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Zavřít projekt"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor definic CodeTools"
#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Nastavení CodeTools"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Přeložit projekt/program"
#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Volby překladače"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Konfigurace %sSoubor sestavení %s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Konfigurovat vlastní komponenty"
#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Nastavit nápovědu"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextová nápověda"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Převést Delphi balíček na Lazarus balíček"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Převést Delphi projekt na Lazarus projekt"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Převést Delphi jednotku na Lazarus jednotku"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Převést DFM soubor na LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Zkopírovat vybrané komponenty do schránky"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Vyjmout vybrané komponenty do schránky"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Odstranit poslední znak"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Rozdíl editovaných souborů"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Upravit šablony kódů"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Upravit kontextově citlivou nápovědu"
#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Volby editoru"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Obklopit výběr"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Vyhodnocení/Upravení"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Nastavení vnějších nástrojů"
#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Dopředné hledání"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Jít na značku 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Jít na značku 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Jít na značku 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Jít na značku 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Jít na značku 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Jít na značku 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Jít na značku 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Jít na značku 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Jít na značku 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Jít na značku 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Jít na editor zdroje 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Přejít na zdrojový editor 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Jít na editor zdroje 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Jít na editor zdroje 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Jít na editor zdroje 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Jít na editor zdroje 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Jít na editor zdroje 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Jít na editor zdroje 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Jít na editor zdroje 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Jít na editor zdroje 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Vložit datum a čas"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Vložte uživatelské jméno"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Zkoumat"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schéma mapování kláves"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (výchozí)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Max OS X(styl Apple)"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Max OS X (styl Lazarus)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nový balíček"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nový projekt"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nový projekt ze souboru"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nová jednotka"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Poznámka: Všechny klávesy budou nastaveny na hodnoty vybraného schéma."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Otevřít soubor balíčku"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Vložit komponenty ze schránky"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pozastavit program"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Zveřejnit projekt"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Rychlý překlad, bez spojování"
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Odstranit aktivní jednotku z projektu"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Spustit program"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "UložitVše"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "UložitJako"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Uložit projekt"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Uložit projekt jako"
#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Vybrat ke konci řádku"
#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Vybrat k začátku řádku"
#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Vybrat po konec stránky"
#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Vybrat po začátek stránky"
#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Vybrat slovo nalevo"
#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Vybrat slovo napravo"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Nastavit volnou záložku"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Nastavit značku 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Nastavit značku 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Nastavit značku 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Nastavit značku 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Nastavit značku 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Nastavit značku 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Nastavit značku 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Nastavit značku 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Nastavit značku 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Nastavit značku 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Zastavit program"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Přepnout mezi Jednotkou a Formulářem"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Přepnout značkovač 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Přepnout značkovač 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Přepnout značkovač 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Přepnout značkovač 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Přepnout značkovač 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Přepnout značkovač 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Přepnout značkovač 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Přepnout značkovač 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Přepnout značkovač 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Přepnout značkovač 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr "Přepnout zobrazení Assembleru"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Prohodit zobrazení bodů přerušení"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Přepnout zobrazení Zásobníku volání"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Přepnout zobrazení Průzkumníku kódu"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Přepnout zobrazení palety komponent"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr "Přepnout zobrazení Záznamu událostí ladiče"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Přepnout zobrazení Ladícího výstupu"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Přepnout zobrazení Editoru dokumentace"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgid "Toggle view History"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Přepnout zobrazení Rychlých tlačítek IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Přepnout zobrazení Místních proměnných"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Přepnout zobrazení Zpráv"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Přepnout zobrazení Inspektoru objektů"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgid "Toggle view Terminal Output"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr "Přepnout zobrazení Registrů"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Přepnout zobrazení Výsledků hledání"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Přepnout zobrazení Zdrojového editoru"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgid "Toggle view Threads"
msgstr ""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Přepnout zobrazení Sledování"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Zobrazit historii skoků"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Zobrazit nastavení projektu"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Zobrazit zdroj projektu"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Zobrazit informace o jednotce"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Neplatné spouštění aplikace"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Spouštění cílové příkazové řádky"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Nastavení plochy Lazarusu"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Složka Lazarusu"
#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Adresář Lazarusu nenalezen"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "adresář, který bude použit jako základový"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"
#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus file"
msgstr "Soubor Lazarusu"
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Formulář Lazarusu"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Zahrnutý soubor Lazarusu"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID jazyka Lazarusu (např. en, de, br, cz)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Jméno jazyka Lazarusu (např. angličtina, čeština)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [volby] <jméno-projektu>"
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Balíček Lazarusu"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Projekt Lazarusu"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Informační soubor projektu Lazarusu"
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Zdrojový soubor Lazarusu"
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Jednotka Lazarusu"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Akce"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Vybrat výstupní adresář spustitelných souborů IDE "
#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "Část"
#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Přidat"
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Pokročilé volby sestavení"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Jste si jisti smazáním tohoto sestavovacího profilu?"
#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Sestavit"
#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr "Rozšířené sestavení"
#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Sestavit kódové nástroje"
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Sestavit komponenty (SynEdit, CodeTools)"
#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "Sestavit příklady"
#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Sestavit IDE"
#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Sestavit JITForm"
#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Sestavit SynEdit"
#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Vyčistit vše"
#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Vyčistit + Sestavit"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Společná nastavení"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Potvrdit před sestavením"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Potvrdit smazání"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Ladit IDE"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definice"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definice bez -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Upravit definice"
#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr "Úprava definic"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Upravit seznam definic použitelných libovolným profilem"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisování souboru"
#: lazarusidestrconsts.lislazbuildidewithoutpackages
msgid "IDE without Packages"
msgstr "IDE bez balíčků"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild není interaktivní, nyní přerušuji."
#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr "Jako \"make clean\" na příkazovém řádku"
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Úprava sestavovacích profilů"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Upravit profily"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Jméno aktivního profilu"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Přidat nový profil"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Současné sestavovací volby budou spojeny s:"
#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Žádné"
#: lazarusidestrconsts.lislazbuildok
#, fuzzy
#| msgid "Ok"
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "OK"
msgstr "Ok"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Optimalizované IDE"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Nastavení:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Volby předané překladači"
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr "Profil k sestavení"
#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Obnovit"
#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Odstranit"
#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Přejmenování"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Přejmenovat profil"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nové jméno profilu:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Restartovat po sestavení IDE"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Automaticky restartovat Lazarus po sestavení IDE (nemá vliv na sestavení jiných částí)"
#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Uložit nastavení"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Vybrat profily k sestavení"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Zobrazit potvrzovací dialog při sestavování přímo z menu Nástroje"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cílové CPU"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cílový adresář:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Cílový OS:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Nelze zapisovat do souboru \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aktualizovat revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Aktualizovat informace o revizi v dialogu \"O Lazarusu\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Vyčistit + Sestavit vše"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Typ LCL Widgetu"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Přidat odkaz ke zděděnému"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Kopírovat ze zděděného"
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s nemá žádnou platnou LazDoc cestu.%sNelze vytvořit soubor fpdoc pro %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Přesunout položky do zděděného"
#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Žádná platná cesta LazDoc"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Jednotka %s není vlastněna žádným balíčkem nebo projektem.%sProsím přidejte jednotku do balíčku nebo projektu.%sNelze vytvořit soubor fpdoc."
#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Nechejte prázdné pro výchozí soubor .po"
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Vlevo"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Levý okraj. Tato hodnota je přidaná k základnímu okraji a použitá pro mezeru vlevo od prvku."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Levé ukotvení"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož levé straně je ukotvený. Ponechte prázdné pro rodiče."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Levé strany"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Shodná levá vzdálenost"
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Úrovně"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Soubor LFM"
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Poškozený soubor LFM"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM je v pořádku"
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<popis>%sCopyright (C) <rok> <jméno autora> <kontakt>%sTato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat za podmínek GNU Library General Public License, tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze. %sTento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOIV ZÁRUKY; dokonce i bez záruky MERCHANTABILITY anebo FITNESS FOR A PARTICULAR PURPOSE. Další podrobnosti najdete v GNU Library General Public License. %sKopii GNU Library General Public License jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Knihovna%sKnihovna Free Pascal (.dll ve Windows, .so v Linuxu, .dylib v MacOS X). Soubor zdrojového kódu knihovny je automaticky spravovaný Lazarusem."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "cesta knihovny"
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Řádek:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Řádek/Délka"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Odkaz:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "volby spojovače"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Cíl odkazu"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "seznam všech případných hodnot"
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Načítání %s selhalo."
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Místní"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr ""
#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Jméno"
#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr ""
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr ""
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr ""
#: lazarusidestrconsts.lislogmessage
#, fuzzy
#| msgid "Log message"
msgid "Log Message"
msgstr "Zpráva záznamu"
#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Logo"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "řetězec malými písmeny"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Řetězec malými písmeny daný jako parametr"
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "zahrnuté soubory lrs"
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Makro %s"
#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr "Jméno makra"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Zadejte údaje"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Zadejte spouštěcí parametry"
#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr "Hodnota makra"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Hlavní jednotka obsahuje Application.CreateForm"
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Hlavní jednotka obsahuje Application.Title"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Hlavní jednotka má v sekci Uses všechny jednotky projektu"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Hlavní jednotka je Zdrojový kód Pascalu"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Vytvořit spustitelný"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Nenalezen Make"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Vytvořit ResourceString"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Doplnit k sekci"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s již existuje.%sProsím vyberte jiný název.%sPoužijte Ignorovat pokud chcete i tak přidat."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Volby převodu"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Vlastní identifikátor"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifikátor"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Délka identifikátoru:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Předpona identifikátoru:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Vlož podle abecedy"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Vložit závislé na kontextu"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Neplatná sekce Resourcestring"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Prosím vyberte sekci resourcestring ze seznamu."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring již existuje"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Sekce zdrojových řetězců:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Náhled zdroje"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Konstantní řetězec ve zdroji"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Řetězec se stejnou hodnotou:"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Max %d"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Možná musíte znovu přeložit balíček."
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Výpis paměti"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Přerušit sestavení"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "O FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
#, fuzzy
#| msgid "Add breakpoint"
msgid "Add &Breakpoint"
msgstr "Přidat bod přerušení"
#: lazarusidestrconsts.lismenuaddcurunittopkg
#, fuzzy
#| msgid "Add active unit to a package"
msgid "Add active unit to a package ..."
msgstr "Přidat aktivní jednotku do balíčku"
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Přidat bod skoku do historie"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Přidat editovaný soubor do projektu"
#: lazarusidestrconsts.lismenuaddwatch
#, fuzzy
#| msgid "Add watch ..."
msgid "Add &Watch ..."
msgstr "Přidat sledování ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Ukončit řádky ve výběru"
#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Sestavit"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Sestavit soubor"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with current profile"
msgstr "Sestavit Lazarus s aktuálním profilem"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr "Sestavit Lazarus s profilem: %s"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Zkontrolovat soubor LFM v editoru"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Vyčistit adresář..."
#: lazarusidestrconsts.lismenucleanupcompiled
msgid "Clean up build files ..."
msgstr ""
#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Zavřít"
#: lazarusidestrconsts.lismenucloseall
msgid "Close a&ll editor files"
msgstr "Zavřít &všechny soubory editoru"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Zavřít projekt"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Editor definic pro CodeTools..."
#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Sbírat soubory .po"
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Zakomentovat výběr"
#: lazarusidestrconsts.lismenucompile
msgctxt "lazarusidestrconsts.lismenucompile"
msgid "Compile"
msgstr "Přeložit"
#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Volby překladače ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Dokončení kódu"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Nastavit soubor pro Sestavení+Spuštění..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfigurovat vlastní komponenty..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Nastavit vnější nástroje..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Nastavení \"Sestavení Lazarusu\" ..."
#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Nastavit nápovědu..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextová nápověda"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Převést Delphi balíček na Lazarus balíček ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Převést Delphi projekt na Lazarus projekt ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Převést Delphi jednotku na Lazarus jednotku ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert binary DFM to text LFM + check syntax ..."
msgstr "Převést binární DFM na textový LFM + zkontrolovat syntaxi..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Převést kódování projektů/balíčků..."
#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopírovat"
#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Vytvořit soubory FPDoc"
#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Vytvořit soubory .po"
#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Vyjmout"
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Ladící okna"
#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff ..."
msgstr "Rozdíl ..."
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editace"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Šablony kódu..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Upravit kontextově citlivou nápovědu"
#: lazarusidestrconsts.lismenueditinstallpkgs
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Instalovat/Odinstalovat balíčky..."
#: lazarusidestrconsts.lismenueditor
#, fuzzy
#| msgid "Menu Editor..."
msgid "Menu Editor ..."
msgstr "Editor menu..."
#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Vytvořit podmenu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
#, fuzzy
#| msgid "Delete From Template..."
msgid "Delete From Template ..."
msgstr "Odstranit ze šablony..."
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Odstranit položku"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Obsloužit událost OnClick"
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
#, fuzzy
#| msgid "Insert From Template..."
msgid "Insert From Template ..."
msgstr "Vložit z šablony..."
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Vložit novou položku (za)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Vložit novou položku (před)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Posunout dolů (nebo vpravo)"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Posunout nahoru (nebo vlevo)"
#: lazarusidestrconsts.lismenueditornewtemplatedescription
#, fuzzy
#| msgid "New Template Description..."
msgid "New Template Description ..."
msgstr "Nový popis šablony..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
#, fuzzy
#| msgid "Save As Template..."
msgid "Save As Template ..."
msgstr "Uložit jako šablonu..."
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Vyberte menu:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Vyberte šablonu:"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Náhled šablony"
#: lazarusidestrconsts.lismenuencloseinifdef
#, fuzzy
#| msgid "Enclose in $IFDEF..."
msgid "Enclose in $IFDEF ..."
msgstr "Uzavřít v $IFDEF..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Obklopit výběr"
#: lazarusidestrconsts.lismenuevaluate
#, fuzzy
#| msgid "Evaluate/Modify ..."
msgid "E&valuate/Modify ..."
msgstr "Vyhodnocení/Upravení..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Vyjmout proceduru..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Soubor"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Najít"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Hledat..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Najít jiný konec bloku kódu"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Najít začátek bloku kód"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Najít deklaraci na pozici kurzoru"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Najít odkazy na identifikátor"
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Najít &v souborech..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Najít &Další"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Najít &Předchozí"
#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Nastavení..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Jít na směrnici pro zahrnutí souboru"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Přejít na řádek..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Odhadnout chybně umístěný IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Odhadnout neuzavřený blok"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Nápověda"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "Vnitřek IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Přírůstkové hledání"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Odsadit výběr"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Položka Poznámek k vydání"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Vložit z mapy znaků"
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS keyword"
msgstr "Vložit klíčové slovo CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Aktuální datum a čas"
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Vložit Obecné"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Poznámka GPL"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Poznámka LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Poznámka k upravené LGPL"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Aktuální uživatelské jméno"
#: lazarusidestrconsts.lismenuinspect
#, fuzzy
#| msgid "Inspect ..."
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Zkoumat..."
#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Skočit zpět"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Skočit vpřed"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Skočit na"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to implementation"
msgstr "Skočit na implementaci"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Skočit na další značku"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Skočit na následující chybu"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Skočit na předchozí značku"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Skočit na předchozí chybu"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Změnit výběr na malá písmena"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Vytvořit zdrojový řetězec..."
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nový formulář"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nový..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Nový balíček..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nový projekt..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nový projekt ze souboru..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nová jednotka"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online nápověda"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Otevřít..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Otevřít jméno souboru na pozici kurzoru"
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Otevřít načtený balíček..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Otevřít soubor balíčku (.lpk)..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Otevřít balíček aktuální jednotky"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Otevřít projekt..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Otevřít &nedávné"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package"
msgstr "Otevřít nedávný balíček"
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Otevřít nedávný projekt"
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "&Balíček"
#: lazarusidestrconsts.lismenupackagegraph
#, fuzzy
#| msgid "Package Graph ..."
msgid "Package Graph"
msgstr "Graf balíčku..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "Odkazy balíčku..."
#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Vložit"
#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Pozastavit"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Seznam procedur..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor projektu"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Volby projektu ..."
#: lazarusidestrconsts.lismenuprojectrun
#, fuzzy
#| msgid "Run"
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Spustit"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Vydat projekt..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Rychlý překlad"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Rychlá kontrola syntaxe"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Rychlá kontrola syntaxe OK"
#: lazarusidestrconsts.lismenuquit
msgid "&Quit"
msgstr "U&končit"
#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Opakovat změnu"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Odebrat z projektu..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Přejmenovat identifikátor"
#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Nahradit"
#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "&Nahradit..."
#: lazarusidestrconsts.lismenureportingbug
#, fuzzy
#| msgid "Reporting a bug ..."
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a bug"
msgstr "Nahlásit závadu..."
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Znovu projít zdrojový adresář FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Resetovat ladící nástroj"
#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Restartovat"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Navrátit"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Spustit"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Spustit soubor"
#: lazarusidestrconsts.lismenurunparameters
#, fuzzy
#| msgid "Run Parameters ..."
msgid "Run &Parameters ..."
msgstr "Spustit s parametry..."
#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Run to cursor"
msgid "Run to &cursor"
msgstr "Spustit po ukazatel"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Uložit"
#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Uložit vše"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Uložit &jako..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Uložit projekt"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Uložit projekt jako..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Hledat"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Vybrat"
#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Vybrat vše"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Vybrat blok kódu"
#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Vybrat řádek"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Vybrat odstavec"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Vybrat po závorku"
#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Vybrat slovo"
#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Nastavit volnou záložku"
#: lazarusidestrconsts.lismenushowexecutionpoint
#, fuzzy
#| msgid "Show execution point"
msgid "S&how execution point"
msgstr "Ukázat bod vykonávání"
#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Seřadit výběr"
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "Zdroje"
#: lazarusidestrconsts.lismenustepinto
#, fuzzy
#| msgid "Step into"
msgid "Step in&to"
msgstr "Vejít do"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr "Krok dovnitř (Kontext)"
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr "Krok do instrukce"
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr "Krok do instrukce"
#: lazarusidestrconsts.lismenustepout
#, fuzzy
#| msgid "Step out"
msgid "Step o&ut"
msgstr "Vejít do"
#: lazarusidestrconsts.lismenustepover
#, fuzzy
#| msgid "Step over"
msgid "&Step over"
msgstr "Přejít přes"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr "Krok přes (Kontext)"
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr "Krok přes instrukci"
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr "Krok přes instrukci"
#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Zastavit"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap case in selection"
msgstr "Zaměnit velikost znaků ve výběru"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulátory na mezery ve výběru"
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "O aplikaci"
#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Zavřít"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Obsah"
#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopírovat"
#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Vyjmout"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Normální menu Editace"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Normální menu Soubor"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Normální menu Nápověda"
#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Úpravy"
#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Ukončit"
#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Soubor"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Najít"
#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Najít další"
#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Nápověda"
#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Nový"
#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Otevřít"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Otevřít nedávné"
#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Vložit"
#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Opakovat změnu"
#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Uložit"
#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Uložit jako"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Cvičení"
#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "Vrátit zpět"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr "Přepnout komentář"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Nástroje"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Odkomentovat výběr"
#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Vrátit zpět"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Zrušit odsazení výběru"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Změnit výběr na velká písmena"
#: lazarusidestrconsts.lismenuuseprojectunit
msgid "Add unit to uses section ..."
msgstr "Přidat jednotku do sekce uses ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Zobrazení"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Editor kotev"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Body přerušení"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Zásobník volání"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Prohlížeč kódu"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Průzkumník kódu"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Paleta komponent"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenty"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Záznam událostí"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Ladící výstup"
#: lazarusidestrconsts.lismenuviewforms
#, fuzzy
#| msgid "Forms..."
msgid "Forms ..."
msgstr "Formuláře..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr ""
#: lazarusidestrconsts.lismenuviewidespeedbuttons
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Rychlá tlačítka IDE"
#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump History ..."
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Historie skoků..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Místní proměnné"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Zprávy"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspektor objektů"
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgid "Terminal Output"
msgstr ""
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registry"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Prohlížeč omezení"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Výsledky hledání"
#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "&Zobrazení zdroje"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr ""
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Seznam úkolů"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Změnit zobrazení formulář/jednotka"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgid "Unit Dependencies"
msgstr "Závislosti jednotky"
#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "Unit Information"
msgid "Unit Information ..."
msgstr "Informace jednotky"
#: lazarusidestrconsts.lismenuviewunits
#, fuzzy
#| msgid "Units..."
msgid "Units ..."
msgstr "Jednotky..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Sledování"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Okno"
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "Zpráva neobsahuje informaci o pozici souboru:%s%s"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor zpráv"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Třída metody nenalezena"
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Chybějící události"
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Chybějící identifikátory"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Chybějící balíčky"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Vaše volby jsou:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Zakomentovat"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Pouze pro Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Zakomentovat vybrané jednotky"
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Použít jednotky pouze pro Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Vyhledat jednotky. Nalezené cesty přidat do nastavení projektu."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Nyní přerušit, instalovat balíčky nebo opravit cesty a pokusit se znova."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Cesta jednotek projektu"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Přeskočit tuto jednotku"
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<popis>%sCopyright (C) <rok> <jméno autora> <kontakt>%sTato knihovna je svobodný program; můžete ji distribuovat a/nebo upravovat podle ustanovení GNU Library General Public License tak jak ji zveřejnila Free Software Foundation; buď verze 2 Licence nebo (podle Vaší volby) jakékoliv novější verze s následujícími úpravami:%sJako speciální výjimka, vlastníci autorského práva této knihovny Vám dovolují připojit tuto knihovnu s nezávislými moduly za účelem vytvoření programů, pričemž nezávisí na licenci těchto nezávislých modulů, a kopírovat a distribuovat výsledné programy za podmínek poskytnutých podle Vašeho rozhodnutí, které se můžou líšit pro každý nezávislý modul. Nezávislý modul je modul, který není odvozený nebo založený na této knihovně. Pokud upravujete tuto knihovnu, můžete rozšířit tuto výjimku pro svojí verzi knihovny, ale není to Vaše povinnost. Pokud to nechcete udělat, smažte tuto výjimku ze své verze. %sTento program je distribuován v naději, že bude užitečný, ale BEZ JAKÉKOLIV ZÁRUKY; dokonce i bez záruky MERCHANTABILITY nebo FITNESS FOR A PARTICULAR PURPOSE. Další podrobnosti najdete v GNU Library General Public License. %sKopi GNU Library General Public License jste měli získat spolu s touto knihovnou, pokud ne, napište Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Pozměnit"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Více"
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Posunout \"%s\" o jednu pozici dolu"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Posunout \"%s\" o jednu pozici nahoru"
#: lazarusidestrconsts.lismovepage
#, fuzzy
#| msgid "Move Page ..."
msgid "Move Page"
msgstr "Přesunout stránku..."
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Uložit zprávy do souboru (*.txt)"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Konflikt jmen"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Jméno nové procedury"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nikdy"
#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "nový"
#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Nový předek"
#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "Nový režim sestavení"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nová třída"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nová konzolová aplikace"
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "Vytvořit novou CGI aplikaci.%sZdroj aplikace je spravován Lazarusem."
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Vytvořit nový program."
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Vytvořit nový editovaný soubor.%sVyberte typ."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Vytvořit prázdný textový soubor."
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Vytvořit novou grafickou aplikaci.%sZdroj aplikace je spravován Lazarusem."
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Vytvořit novou pascalovskou jednotku."
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Vytvořit nový program.%sZdroj programu je spravován Lazarusem."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Vytvořit nový projekt.%sVyberte typ."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Vytvořit nový vzorový balíček.%sBalíček je sada jednotek a komponent."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Vytvořit novou jednotku s datovým modulem."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Vytvořit novou jednotku s rámcem."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Vytvořit novou jednotku s formulářem LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Zdědit z formuláře projektu nebo komponenty"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nevybrány žádné položky"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Prosíme nejdříve vyberte položku."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nové kódování:"
#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr "Nová skupina - sada režimů"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nový projekt)"
#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "Nové nastavení"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr "Nové jednotky jsou přidány do sekce uses:"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Ne"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Nezálohovat soubory"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Není zvolen žádný profil k sestavení."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Žádné změny"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nevybraný žádný kód"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nezděděny žádné volby překladače."
#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr "Žádné chyby"
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "žádný tip"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nevybráno žádné okno IDE"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Žádný soubor LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Žádné vybrané makro"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "bezejmenný"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sžádný"
#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "žádné"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "žádný, klikněte pro výběr jednoho"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "žádný uzel nevybrán"
#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "Žádný pascalovský soubor"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Nenalezen žádný programový soubor %s%s%s."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nenalezen žádný výběr ResourceStringu"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Obyčejně je filtr regulární výraz. V jednoduché syntaxi je . obyčejný znak, * znamená cokoliv, ? znamená jakýkoliv znak a čárka a středník oddělují varianty. Např. Jednoduché syntaxi *.pas;*.pp odpovídá ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenalezeny žádné konstantní řetězce."
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Není instalovatelný balíček"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "Neplatný pascalovský identifikátor"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Free Pascalu"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Lazarusu"
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Doposud neimplementováno"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Zatím neimplementováno:%s%s"
#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Doposud neimplementováno."
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nyní ne"
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Vytvořit"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Vytvořit nový projekt"
#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Vyberte typ projektu"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Počet souborů k převodu: %s"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - výchozí"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "cesta objektu"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Přepnout na záložku Oblíbené v Inspektoru Objektů"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Přepnout na záložku Oblíbené v Inspektoru Objektů po dotazu na jméno komponenty"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Vypnuto)"
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Přidat do oblíbených vlastností"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Vyberte základní třídu pro oblíbené vlastnosti %s%s%s."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Třída %s%s%s nenalezena,"
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Odebrat z oblíbených vlastností"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automaticky instaluj dynamické"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "automaticky instaluj statické"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Popis: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sPopis: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Jméno souboru: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "instalováno dynamicky"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "instalováno staticky"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "chybějící"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "změněný"
#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Nevybrán žádný balíček"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Otevřít načtený balíček"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Jméno balíčku"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Prosím vyberte balíček"
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Prosím vyberte balíček k otevření"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "pouze pro čtení"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Stav"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen"
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sTento balíček byl vytvořen automaticky"
#: lazarusidestrconsts.lisok
msgid "&OK"
msgstr "&OK"
#: lazarusidestrconsts.lisold
msgid "old"
msgstr "starý"
#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Starý předek"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Stará třída"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Zapnuto)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Při zalomení řádku (tj. klávesa Enter)"
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hledat pouze celá slova"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Při vložení ze schránky"
#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr "Otevřít ..."
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Otevřít jako XML soubor"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Otevřít návrháře při otevření jednotky"
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Otevřít existující soubor"
#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Otevřít soubor"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Otevřít %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Otevřít balíček?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Otevřít balíček %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Otevřít soubor projektu"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Otevřít projekt?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Otevřít projekt"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Otevřít projekt znovu"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Otevřít soubor projektu"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Otevřít symbolický odkaz"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Otevřít cíl"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Otevřít soubor jako normální zdrojový soubor"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Otevřít balíček %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Otevřít projekt %s?"
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Volby změněny, čisté překládání s -B"
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "nebo"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varianty se podívejte na soubory ve složce jazyků."
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%spřepíše výchozí překladač. např. ppc386 ppcx64 ppcppc aj. výchozí je uložen v environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr "%spřepíše sestavovací mód projektu."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%spřepíše cpu projektu. např. i386 x86_64 powerpc powerpc_64 aj. výchozí: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%přepíše operační systém projektu. např. win32 linux. výchozí: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%spřepíše sadu widgetů projektu. např. gtk gtk2 qt win32 carbon. výchozí: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Přepsat soubor?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Přepsat soubor na disku"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' je již použit v TReader/TWriter. Prosím, zvolte jiné jméno"
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Balíček"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "balíček %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Informace balíčku"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Jméno balíčku začíná s..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Jméno balíčku obsahuje..."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Balíček vyžaduje instalaci"
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr ""
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr ""
#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Balíčky k instalování do IDE"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "jednotka balíčku"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", zanalyzovný "
#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Zdrojový soubor Pascalu"
#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Pascalovský jednotka"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Počet průchodů"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "vložit schránku"
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Vložit text ze schránky"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Cesta"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Procházet"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Posunout cestu dolů"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Posunout cestu nahoru"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Šablony cest"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Hledat cesty:"
#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Hledat adresář"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Cesta nástroje make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Cesta ke špatné instanci:"
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Přidat položku"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "Přidat do projektu"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Použít změny"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Volání %sRegistr%s procedura vybrané jednotky"
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Vyčistit přednastavené/preferované jméno souboru závislosti"
#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Přeložit"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Přeložit vše?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompilovat balíček"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Volby překladače pro balíček %s"
#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Volby překladače"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Vytvořit Makefile"
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, standardně: %s"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Vlastnosti závislosti"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Upravit obecné nastavení"
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Upravit nastavení pro překlad balíčku"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Vlastnosti souboru"
#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Obecná nastavení"
#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Nápověda"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalovat"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Instalovat balíček do IDE"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Neplatná maximální verze"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Neplatná minimální verze"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximální verze:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimální verze:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Změněný: %s"
#: lazarusidestrconsts.lispckeditmore
msgid "More >>"
msgstr "Více >>"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Posunout závislost dolů"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Posunout závislost nahoru"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Balíček %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Balíček %s%s%s byl změněn.%sUložit balíček?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "balíček %s nenalezen"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s,Stránka: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Znovu přidat závislost"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Znovu přidat soubor"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Pouze pro čtení: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Znovu přeložit vše potřebné"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Znovu přeložit načisto"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Znovu přeložit tento a všechny požadované balíčky?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrované zásuvné moduly"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registrovat jednotku"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Odstranit závislost"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Odstranit závislost?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Odstranit závislost %s%s%s%sz balíčku %s%s%s?"
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Odstranit soubory (tyto položky nejsou ukládány do souboru lpk)"
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Odstranit požadované balíčky (tyto položky nejsou uloženy do souboru lpk)"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Odstranit soubor"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Odstranit soubor?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Odstranit soubor %s%s%s%sz balíčku %s%s%s?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Odstranit vybrané položky"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Požadované balíčky"
#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Uložit změny?"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Uložit balíček"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Uchovat jméno souboru jako předvolené pro tuto závislost"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Uchovat jméno souboru jako preferované pro tuto závislost"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maximální verze %s%s%s není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimální verze %s%s%s není platná verze balíčku.%s(dobrý příklad 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Odinstalovat"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Zobrazit zdroj balíčku"
#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Automaticky vytvořeno"
#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Instalováno"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalovat při dalším spuštění"
#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Vybraný balíček je požadován:"
#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Načtené balíčky:"
#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Balíček %s nenalezen"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStav: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Odinstalovat při dalším spuštění"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Přidat volby do závislých balíčků a projektů"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Přidat cesty do závislých balíčků/projektů"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Autor:"
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Automaticky zvyšovat číslo verze při sestavení"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automaticky znovu sestavit podle potřeby"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automaticky znovu sestav pokud znovu sestavení všeho"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Vlastní"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Popis/obsah"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Doba návrhu a doba kompilace"
#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Pouze doba návrhu"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrace IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Zahrnout"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Neplatný typ balíčku"
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "Cesta souborů FPDoc"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Knihovna"
#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Licence:"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Spojovací program"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Hlavní"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ruční překlad (nikdy automaticky)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minoritní"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objekt"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Nastavení balíčku"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Typ balíčku"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Poskytuje"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Uvolnění"
#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Pouze běhový"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Balíček %s%s% má vlajku autoinstalace.%sTo znamená, že bude instalován do IDE. Instalované balíčky musí"
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Tento balíček poskytuje to samé jako následující balíčky:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Aktualizovat/Znovu sestavit"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Použití"
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Přerušit"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Průběh"
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Sbalit adresář"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Nalezen konflikt"
#: lazarusidestrconsts.lispedirectories
msgid "Directories"
msgstr "Adresáře"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Upravit virtuální jednotku"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Rozbalit adresář"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Jméno souboru:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Opravit velikost písmen souborů"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Neplatné jméno souboru jednotky"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Neplatné jméno jednotky"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Chybějící soubory balíčku %s"
#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Posunout soubor dolů"
#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Posunout soubor nahoru"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Nový soubor není v zahrnované cestě"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Žádné chybějící soubory. Všechny soubory existují."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Odstranit soubory"
#: lazarusidestrconsts.lisperemoveselectedfiles
msgid "Remove selected files"
msgstr "Odstranit vybrané soubory"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert package"
msgstr "Vrátit balíček"
#: lazarusidestrconsts.lispesavepackageas
msgid "Save package as"
msgstr "Uložit balíček jako"
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Zobrazit adresářovou strukturu"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show missing files"
msgstr "Zobrazit chybějící soubory"
#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "Řadit soubory"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Řadit soubory abecedně"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Soubor \"%s\" není v současnosti v zahrnované cestě balíčku.%sPřidat \"%s\" do zahrnuté cesty?"
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Již existuje jednotka s tímto jménem.%sSoubor: %s"
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Jméno jednotky není platný pascalovský identifikátor."
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Jméno jednotky je použito, když IDE rozšiřuje definici uses."
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Jméno jednotky:"
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Použít všechny jednotky v adresáři"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Nepoužít žádné jednotky v adresáři"
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Doplněk CompiledSrcPath"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Výstupní adresář"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Značka zdrojového adresáře balíčku"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Cesta jednotky"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nová jednotka není v cestě jednotek"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Vydat balíček"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Navrátit balíček?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unit path of the package.%s%sAdd %s%s%s to unit path?"
msgstr "Soubor %s%s%s%snení aktuálně v cestě jednotek balíčku.%s%sPřidat %s%s%s do cesty jednotek?"
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online nápověda zatím neimplementována"
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Kliknutí pravým tlačítkem na strom položek zpřístupní všechny dostupné funkce balíčku."
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "V roletovém menu je více funkcí"
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binární"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Zahrnout soubor"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Vyvolání souboru XML"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Text formuláře Lazarusu"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Zdrojový soubor Lazarusu"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Hlavní jednotka"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Text"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Jednotka"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuální jednotka"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID"
msgstr ""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Přidat jednotku do sekce uses v balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Víceznačné jednotky nalezeny"
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Požadovaný balíček nenalezen. Podívejte se na graf balíčků."
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaticky instalované balíčky"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Porušená závislost"
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Kruh v závislostech balíčků"
#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Překládání balíčku %s"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Odstranění selhalo"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Smazat starý soubor balíčku?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Odstranit starý soubor balíčku %s%s%s?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Závislost bez vlastníka: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Chyba načítání souboru"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Chyba načítání balíčku"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Chyba: změna souboru po selhala pro balíček %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisování souboru"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Chyba zapisování balíčku"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Soubor je již obsažen v balíčku"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Soubor je projekt"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Jméno souboru se liší od jména balíčku"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Jméno souboru je použito jiným balíčkem"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Jméno souboru je použito projektem"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Soubor %s%s%s nenalezen."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Soubor není uložený"
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Nyní balíček ignorovat a uložit"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Instalace balíčku %s automaticky nainstaluje balíček:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Instalace balíčku %s automaticky nainstaluje balíčky:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Neplatné jméno překladače"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Neplatná přípona souboru"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Neplatná přípona balíčku"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Neplatné jméno souboru balíčku"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Neplatné jméno balíčku"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Neplatné jméno balíčku"
#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Načtení balíčku %s nahradí balíček %s%sze souboru %s.%sStarý balíček je změněn.%s%sUložit starý balíček %s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nový balíček"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Balík: %s"
#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Balíček %s%s%s změněn. Uložit?"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Konflikt balíčků"
#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Soubor balíčku chybí"
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Soubor balíčku neuložen"
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Balíček %s%s%s nemá platný výstupní adresář: %s%s%s%s"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Balíček není návrhový balíček"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Balíček je vyžadován"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "hlavní zdrojový soubor balíčku"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Jméno balíčku již existuje"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Balíček musí mít příponu .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr ""
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Prosíme uložte soubor před jeho přidáním do balíčku."
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Přestavět Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Přejmenovat soubor v balíčku?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Přejmenovat soubor na malé písmena?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Nahradit existující soubor %s%s%s?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Nahradit soubor"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Uložit balíček?"
#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Uložit balíček?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Uložit balíček %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Měl by být soubor přejmenován na malé znaky na %s%s%s%s?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Přeskočit tento balíček"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "konfigurační soubor statického balíčku"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Soubor překladače pro balíček %s není platný spustitelný soubor:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Soubor %s%s%s%s je již v balíčku %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Soubor %s%s%s není balíček lazarusu."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Jméno souboru %s%s%s nesouhlasí se jménem balíčku %s%s%s v souboru.%sZměnit jméno balíčku na %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Jméno souboru %s%s%s je částí aktuálního projektu.%sProjekty a balíčky nemůžou sdílet soubory."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Jméno souboru %s%s%s je použité %sbalíčkem %s%s%s%sv souboru %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Chybí soubor %s%s%s%sbalíčku %s."
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Soubor %s%s%s%sz balíčku %s potřebuje být nejdříve uložen."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Následující balíček se nepodařilo načíst:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Následující balíčky se nepodařilo načíst:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sNásledující jednotky budou přidány do sekce uses jednotky %s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Selhal překlad balíčku %s%s%s.%sOdstranit jej z instalačního seznamu?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Jméno souboru balíčku %s%s%s v%s%s%s%s není platné jméno balíčku Lazarusu."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Balíček %s je balíčkem jen pro dobu běhu. %sBalíčky jen pro dobu běhu nelze instalovat do IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package %s is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also uses the default unit search of the compiler. This creates a circle.%sYou can fix this issue%sby removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package%sor by removing dependencies."
msgstr ""
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Balíček %s%s%s je označen k instalaci, ale nedá se najít.%sOdstranit závislost ze seznamu instalovaných balíčků?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Balíček %s je vyžadován balíčkem %s, který je označen k instalaci.%sViz. graf balíčků."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Jméno balíčku %s%s%s není platným jménem balíčku%sProsím, zvolte jiné jméno (např. balicek1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Jméno balíčku %s%s%s %ssouboru %s%s%s je neplatné."
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Balíček %s vlastní soubor %s%s%s%s.%sMá být soubor přejmenovaný také v balíčku?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s byl označen.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečné odinstalování vyžaduje znovu sestavení a restartování lazarusu.%s%sChcete znovu sestavit Lazarus?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s byl označen pro instalaci.%sAktuálně lazarus podporuje pouze staticky spojené balíčky. Skutečná instalace vyžaduje znovu sestavení a restart lazarusu.%s%sChcete znovu sestavit Lazarus?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt vyžaduje balíček %s%s%s.%sAle tento nebyl nalezen. Viz Projekt -> Inspektor projektu."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Dvě jednotky mají stejné jméno:%s%s1. %s%s%s z %s%s2. %s%s%s z %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "V požadovaných balíčcích je smyčka. Podívejte se na graf balíčků."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Existuje jednotka FPC se stejným jménem jako balíček:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Existuje jednotka FPC se stejným jménem jako %s%s%s%s%s z %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Balíček se zvoleným jménem %s%s%s.%suž existuje. Konfliktní balíček: %s%s%s%sSoubor: %s%s%s."
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Balíček %s%s%s načtený %sze souboru %s%s%s už existuje.%sViz Balíček -> Graf balíčků .%sNahrazení není možné."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Mezi vyžadovanými balíčky jsou některé neuložené. Viz graf balíčků."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Již existuje jednotka se stejným jménem jako balíček:%s%s1. %s%s%s z %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Toto je virtuální balíček. Zatím nemá zdrojový kód. Prosím uložte nejdříve balíček."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nelze vytvořit adresář"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Nelze vytvořit výstupní adresář %s%s%s%sbalíčku %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Nelze vytvořit zdrojový adresář %s%s%s%s balíčku %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Nelze vytvořit cílový adresář Lazarusu:%s%s%s%s.%sTento adresář je nutný pro nové, změněné Lazarus IDE s vlastními balíčky."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Nelze smazat soubor %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nelze smazat soubor"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Nelze smazat starý stavový soubor %s%s%s%sbalíčku %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Nelze načíst balíček"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Nelze otevřít balíček %s%s%s.%sTento balíček byl označen k instalaci."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nelze číst stavový soubor %s%s%s%sbalíčku %s.%sChyba: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Nelze zapsat balíček %s%s%s%sdo souboru %s%s%s.%sChyba: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nelze zapsat stavový soubor %s%s%s%sbalíčku %s.%sChyba: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Odinstalovat balíček?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Odinstalovat balíček %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Neuložený balíček"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Požít jednotku"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Varování: Soubor %s%s%s%spatří k aktuálnímu projektu."
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Nelze registrovat komponenty bez jednotky"
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - nástroje a funkce k analýze, procházení a úpravě pascalovských zdrojů"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Třída komponenty %s%s%s je již definována."
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sJméno souboru: %s%s%s"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Neplatná třída komponenty"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Neplatné jméno jednotky: %s"
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Soubor balíčku nenalezen"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Chyba registrace balíčku"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Registrační procedura je nil"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Bylo voláno RegisterUnit, ale žádný balíček není registrován."
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - editor komponent používaný Lazarusem. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
#, fuzzy
#| msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgid "The FCL - Free Pascal Component Library provides the base classes for Object Pascal."
msgstr "FCL - FreePascal Component Library poskytuje základní třídy pro objektový pascal."
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Lazarus Component Library obsahuje všechny základní komponenty pro úpravu formulářů."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Balíček %s%s%s je instalován, ale nebyl nalezen platný soubor (.lpk).%sByl vytvořen rozbitý prázdný balíček."
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - Run-Time Library (Běhové knihovny) jsou základem všech programů Free Pascalu."
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Toto je přednastavený balíček určený jen pro komponenty bez balíčků. Tyto komponenty jsou zastaralé."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Tento balíček je nainstalován, ale soubor lpk nebyl nalezen. Všechny jeho komponenty jsou deaktivované. Prosím, opravte to."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sJméno jednotky: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr ""
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr ""
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Soubor není v žádném načteném balíčku."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Nelze číst soubor balíčku %s%s%s.%sChyba: %s"
#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Existuje"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Celkový"
#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Pouze existující soubory"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Odkazy balíčku"
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Ukázat celkové odkazy"
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Ukázat uživatelské odkazy"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Uživatel"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgstr "Prosím, opravte chybu zobrazenou v okně zpráv, které je zpravidla pod editorem zdrojů."
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Prosím otevřete jednotku před spuštěním."
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "Prosíme nejdříve vyberte režim sestavení."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Prosíme vyberte nějaký kód k vytažení nové procedury/metody."
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Všechno>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Změnit písmo"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Zkopírovat jméno metody do schránky"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrovat podle jakékoliv odpovídající části metody"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrovat podle začátku metody"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Skoč na výběr"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<žádný>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objekty"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Seznam procedur"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Vyberte adresář .po souborů"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Neukládat žádné informace o sezení"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Ukazatel"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Uložit v konfiguračním adresáři IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Uložit v souboru .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Uložit v souboru .lps v adresáři projektu"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Uložit informace sezení v"
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Předcházející slovo"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "hlavní konfigurační složka, kde Lazarus uchovává své konfigurační soubory. Implicitní je "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Primární konfigurační cesta"
#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Tisknout"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Soukromý"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Soukromá metoda"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Před pokračováním asi bude nutné nainstalovat některé balíčky .%s%sVarování:%sProjekt používá následující balíčky v čase návrhu, které mohou být nezbytné k otevření formuláře v návrháři. Pokud budete pokračovat, můžete obdržet chyby o chybějících komponentách a načítání formuláře pravděpodobně způsobí nechtěné výsledky.%s%sJe doporučeno zrušit akci a nejdříve nainstalovat tyto balíčky.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedura"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedura s rozhraním"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Program%sProgram Free Pascalu. Zdroj programu je automaticky spravován Lazarusem."
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Zjištěn program"
#: lazarusidestrconsts.lisprogramnotfound
msgid "Program %s not found"
msgstr ""
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Zdrojový soubor programu musí mít pascalovkou příponu jako .pas, .pp nebo .lpr"
#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr "Přidat soubory do projektu"
#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Přidat soubor do projektu:"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Závislost již existuje"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Přidat editované soubory"
#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Přidat soubory"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Neplatná verze Min-Max"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Neplatné jméno balíčku"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Neplatné jméno pascalovské jednotky"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Neplatná verze"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximální verze (nepovinné):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimální verze (nepovinné):"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nové požadavky"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Jméno balíčku:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Balíček nenalezen"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Závislost %s%s%s nebyla nalezena.%sProsím zvolte existující balíček."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximální verze %s%s%s je neplatná.%sProsím použite formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximální verze je menší než Minimální verze."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimální verze %s%s%s je neplatná.%sProsím použijte formát hlavní.vedlejší.vydání.sestavení%sNapříklad: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Jméno balíčku %s%s%s není platné.%sProsím použijte existující balíček."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Projekt již je závislý na balíčku %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Jméno jednotky %s%s%s už v projektu%sexistuje se souborem: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Jméno jednotky %s%s%s už existuje ve výběru%sse souborem: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Jméno jednotky %s%s%s není platný pascalovský identifikátor."
#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Přidat do projektu"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Jméno jednotky již existuje"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt změněn"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projekt změněn na disku"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Adresář projektu"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Titulek panelu úloh zobrazuje také adresářovou cestu projektu"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Jméno souboru projektu"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Cesta začleněných souborů projektu"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Zjištěn informační soubor projektu"
#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Informace projektu"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt je spustitelný"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Vlastnosti makra projektu"
#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "makro ProjectUnitPath"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Výstupní adresář projektu (např. ppu adresář)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr ""
#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "Cesta projektu:"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Adresář, v němž musí být hlavní soubor projektu"
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Projekt %s vyvolal výjimku třídy '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projekt %s vyvolal výjimku třídy '%s' se zprávou:%s%s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Zdrojová cesta projektu"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built"
msgstr "Projekt %s%s%s úspěšně sestaven"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "jednotka projektu"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Cesta jednotek projektu"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Průvodce projektu"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potvrdit odstranění závislostí"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Potvrdit odstranění souboru"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Odstranit závislost pro %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspektor projektu - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Odstranit požadované balíčky"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Odstranit soubor %s z projektu?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Nelze načíst soubor %s projektu %s%sChyba: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Nelze zapsat stavový soubor projektu %s%sChyba: %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Vždy sestavit (i pokud se nic nezmění)"
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Chyba"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Nelze změnit seznam automaticky vytvářených formulářů ve zdrojovém kódu programu.%sNejdříve opravte chyby."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Značka zdrojového adresáře projektu"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Dotázat se na hodnotu"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Vlastnosti (nahradit nebo odstranit)"
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "Vlastnosti volby podmíněného překladu"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Chráněné"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Chráněné metody"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Veřejná metoda"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Zveřejněné metody"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Zveřejni adresář projektu"
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Neplatný vylučovací filtr"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Neplatný filtr zahrnutí"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Uložit .lrs soubory ve výstupním adresáři"
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Upravit virtuální jednotku"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Již existuje jednotka s tímto jménem.%sSoubor: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Jméno jednotky není platný pascalovský identifikátor."
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Jméno jednotky je použito, když IDE rozšiřuje definici uses."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Převést Delphi projekt"
#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Nový projekt"
#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Otevřít projekt"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Otevřít nedávný projekt"
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Vytvořit lokální proměnnou"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Rychlé opravy"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Rychlá oprava: Odstranit jednotku"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Hledat identifikátor"
#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Ukončit Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Chyba čtení"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Záznam/Struktura"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registry"
#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Jméno"
#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Regulární výrazy"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relativní cesty"
#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "odstranit"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Odstranit všechny neplatné vlastnosti"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Odebrat všechny jednotky"
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Odestranit ze seznamu instalovaných"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Odstranit z projektu"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Odstranit z vyhledávací cesty"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Odstranit zahrnutou cestu?"
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Odstranit lokální proměnnou %s"
#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Odstranit lokální proměnnou"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr "Odstranit neexistující soubory"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Odstranit vybrané jednotky"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Odstranit je"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Odstranit cesty z \"Ostatní zdroje\""
#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Odstranit jednotku ze sekce uses"
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Odstranit cestu jednotek?"
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Přejmenovat soubor?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Přejmenování souboru selhalo"
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Přejmenovat na %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Přejmenovat na malá písmena"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Znovuotevřít projekt"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Znovuotevřít s jiným kódováním"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Počet opakování:"
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Nahrazení"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Náhrazující funkce"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Náhrady"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Opravit neznámé vlastnosti a typy"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Nahrazení výběru selhalo."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Vyžaduje FPC 2.4 nebo vyšší. Jako zdroje Delphi"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Přeskenovat"
#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Chyba načtení zdroje"
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Chyba uložení zdroje"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr "Typ zdroje projektu:"
#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "Odpověď: %sPokračovat?"
#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "Výsledek :="
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Výsledek:"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "vrací seznam všech hodnot podmínkové proměnné před proměnnou"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Vrácení selhalo"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Vpravo"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Pravé ukotvení"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Pravý okraj. Tato hodnota je přidána k základnímu okraji a použitá pro odsazení vpravo od prvku."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož pravé straně je ukotven. Ponechte prázdné pro rodiče."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Pravé strany"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Stejná pravá vzdálenost"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Kořen"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (běžící ...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Soubor není spustitelný"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Hostitelská aplikace %s%s%s není spustitelná."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Spustit-po selhalo"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Abstraktní metody - doposud nepředefinováno"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Abstraktní metody %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Ukazatel není v deklaraci třídy"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE je zaneprázdněno"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s je abstraktní třída, protože má abstraktní metody %s."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nenalezeny abstraktní metody"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Přepsat celý výběr"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Přepsat první vybraný"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Vybrat žádný"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existuje %s abstraktních metod, které lze implementovat.%sZvolte metody, pro které chcete vytvořit kostry:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Neexistují žádné abstraktní metody k přetížení."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Tuto metodu nelze přetížit, protože je definována v aktuální třídě"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nelze zobrazit abstraktní metody této třídy, protože"
#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Uložit..."
#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Uložit všechna hlášení do souboru"
#: lazarusidestrconsts.lissaveallmodified
#, fuzzy
#| msgid "save all modified files"
msgid "Save all modified files"
msgstr "Uložit všechny upravené soubory"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Uložit a ukončovací dialog"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Uložit a znovu sestavit IDE"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Uložit změny?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Uložit změny projektu %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
#, fuzzy
#| msgid "save current editor file"
msgid "Save current editor file"
msgstr "uložit aktuální editovaný soubor"
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Uložit informace editoru neprojektových souborů"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Uložit soubor jako"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Uložit soubor %s%s%s%spřed zavřením formuláře %s%s%s?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Uložit informace zavřených souborů editoru"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Uložit projekt %s (*%s)"
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Uložit nastavení"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Uložit "
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Činitel zvětšení:"
#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Hledat pro "
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Hledat jednotku"
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "druhotná konfigurační složka, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Druhotná konfigurační cesta"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Podívat se na hlášení."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sPodívejte se na Projekt -> Inspektor projektu"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Vybrat položku nápovědy:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Vybrat uzel"
#: lazarusidestrconsts.lisselectanotherlclwidgetsetmacrolclwidgettype
msgid "Select another LCL widget set (macro LCLWidgetType)"
msgstr "Vyberte jinou sadu LCL widgetů (makro LCLWidgetType)"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Vybrat soubor formuláře Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Vybrané"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(vybraný dolní soused)"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(vybraný levý soused)"
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(vybraný pravý soused)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(vybraný horní soused)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Vybrat soubor"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Vybrat zdrojový adresář FPC"
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Výběr přesahuje řetězcovou konstantu"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Nástroj výběru"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Vybrat zdrojový adresář Lazarusu"
#: lazarusidestrconsts.lisselectpathof
msgid "Select path of %s"
msgstr "Vybrat cestu %s"
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr ""
#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "Vybrat aktivní režim sestavení"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Nastavit výchozí"
#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr "Nastavit hodnoty makra"
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(Nastavení předvoleného odsazování)"
#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "Nastavit hodnotu"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Krátky:"
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Ukázat pokyny deklarace"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Ukázat rozdíly mezi módy ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Ukázat prázdné jednotky/balíčky"
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Zobrazit ikony pro:"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Ukázat žlábek"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Ukázat pokyny"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Ukázat identifikátory"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Ukázat informační rámeček"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Ukázat balíčky"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Ukázat pozici v zdrojovém editoru"
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Ukázat dialog nastavení nejdůležitějších nastavení"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Ukázat speciální znaky"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Ukázat stavový pruh"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Ukázat jednotky"
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Ukázat pokyny hodnot během ladění"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "ukázat verzi a odejít"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Zúžit na nejmenší"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Sourozenec"
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Jednoduchá syntaxe"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr ""
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Přeskočit soubor"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Přeskočit soubor a pokračovat v načítání"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Přeskočit načtení posledního projektu"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "menší raději než rychlejší"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Odpovídá"
#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Promiňte, zatím nezrealizováno"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Omlouváme se, tento typ ještě nebyl implementován."
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Vzestupný"
#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Zrušit"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Rozlišovat velikost znaků"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Vzestupný"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Doména"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorovat mezery"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Řádky"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Volby"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Odstavce"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Náhled"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Přijmout"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Seřadit výběr"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Slova"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Zdroj a cíl jsou stejné:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
#, fuzzy
#| msgid "&Source Breakpoint..."
msgid "&Source Breakpoint ..."
msgstr "&Zdrojový bod přerušení"
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Zdrojový adresář %s%s%s%sa cílový adresář %s%s%s%sjsou stejné.%s%sMožná jste špatně pochopili tuto funkci.%sFunkce vyčistí/znovuvytvoří cílový adresář %sa zkopíruje do něj balíček/projekt."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Zdrojový adresář %s%s%s neexistuje."
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Zdroj upraven"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Zdroj stránky %s%s%s změněn. Uložit?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "Zdroje více než jedné stránky se změnily. Uložit stránku %s%s%s? (%d více)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Zdrojové cesty"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Mezery stejně"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Zdroj. OS"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Hledání"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Hledat text"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Začátek převodu"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Spustit IDE"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Začít s novým projektem"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Zastavit aktuální ladění a znovu sestavit projekt?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zastavit ladění?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Zastavit ladění?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Zastavit při výjimce"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zastavit ladění?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr ""
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Divný soubor lpi"
#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Chyba proudu"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Chyba proudového zpracování"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Řetězec"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Styl"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Podprocedure"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Vnořená procedura na stejné úrovni"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Úspěch"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Podezřelá cesta zahrnovaných"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Podezřelá cesta jednotek"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revize SVN: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Neplatné jméno proměnné"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s není platný identifikátor."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Přepsat systémovou proměnou"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Režim syntaxe"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu nenalezen. Zkontrolujte Váš fpc.cfg"
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderof
#, fuzzy
#| msgid "Tab Order of"
msgid "Tab Order of %s"
msgstr "Pořadí záložek"
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr ""
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Cílový CPU"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Jméno cílového souboru (prázdné = použít výstupní adresář jednotek):"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Jméno cílového souboru (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Cílové jméno souboru projektu"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Cílové jméno souboru + parametry"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Cílový OS"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Vnitřní chyba překladače! (%d)"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Upravitelná buňka"
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""
"Vložit upravitelné buňky s výchozími hodnotami\n"
"\"\",Sync=n (,S=n), k Sync s předchozí buňkou (n= 1 po nejvyšší předchozí buňku\n"
"\"výchozí\",Sync, po Sync s předchozí buňkou odpovídající výchozí\n"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testovací složka"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Aplikační balík byl vytvořen pro \"%s\""
#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr "Sestavovací makro \"%s\" nezačíná \"%s\"."
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Třída %s%s%s ke TControl a nemůže být vložena na neovládací prvek.%sNelze vložit."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "Chyba nalezená codetools:%s%s%s"
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Příkaz po %s%s%s není spustitelný."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Příkaz za publikováním je neplatný:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Komponenta %s nemůže být smazána, protože není vlastněna %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Editor komponenty třídy %s%s%s vytvořil chybu:%s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Třída editoru komponent %s%s%s%svyvolaná slovesem #%s %s%s%s%svytvořila chybu:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Komponenta %s je zděděná z %s.%sKe smazání zděděné komponenty otevřete předka a smažte ji tam."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Komponenta %s je zděděná z %s.%sKe přejmenování zděděné komponenty otevřete předka a přejmenujte jij tam."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr "Jméno komponenty musí být jedinečné ve všech komponentách na formuláři/datovém modulu. Jméno je porovnáváno bez citlivosti na velikost písmen jako normální identifikátor pascalu."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a not existing directory:%s%s"
msgstr "%s obsahuje neexistující adresář:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s obsahuje znak hvězdičky *.%sLazarus to považuje za běžný znak a neprovádí rozšíření jako souborová maska."
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
#, fuzzy
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "Aktuální soubor překladače %s%s%s%snení platný spustitelný soubor.%sVyberte Ok k výběru výchozího"
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
#, fuzzy
#| msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Tools -> Options -> Files"
msgstr "Aktuální jméno souboru překladače %s%s%s%snení platný spustitelný soubor.%sProsím, zkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Aktuální FPC nemá žádný konfigurační soubor. Pravděpodobně budou chybět některé jednotky. Zkontrolujte svou instalaci FPC."
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
#, fuzzy
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "Aktuální adresář zdrojových kódů Free Pascalu %s%s%s%snevypadá správně.%sZvolte OK pro nastavení předvoleného %s%s%s.%sJinak zkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
#, fuzzy
#| msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Tools -> Options -> Files"
msgstr "Aktuální adresář zdrojových kódů Free Pascalu %s%s%s%snevypadá správně.%sZkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
#, fuzzy
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Tools -> Options -> Files"
msgstr "Aktuální adresář Lazarusu %s%s%s%snevypadá správně.%sBez něj nebudete možné vytvářet LCL aplikace.%sZvolte OK pro nastavení předvoleného %s%s%s.%sJinak zkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
#, fuzzy
#| msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Tools -> Options -> Files"
msgstr "Aktuální adresář Lazarusu %s%s%s%snevypadá správně.%sBez něj nebudete možné vytvářet LCL aplikace.%sZkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy
#| msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Tools -> Options -> Debugger options"
msgstr "Ladič %s%s%s%sneexistuje, nebo není spustitelný.%s%sZkontrolujte Prostředí -> Volby ladiče"
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Cílový adresář%s%s%s%s neexistuje."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Cílový adresář %s%s%s neexistuje.%sProsím, zkontrolujte cílové jméno souboru projektu v menu Projekt -> Volby projektu."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Adresář \"%s\" již neobsahuje žádné zahrnované soubory projektu. Odstranit tento adresář z projektové cesty zahrnovaných cest?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Adresář \"%s\" již neobsahuje žádné projektové jednotky. Odstranit tento adresář z projektové cesty jednotek?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Adresář %s%s%s nadále není potřeba v cestě jednotek.%sOdstranit jej?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "Adresář %s%s%s není zapisovatelný."
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Adresář %s%s%s ještě není v cestě jednotek.%sPřidat jej?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Adresář %s nebyl nalezen."
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Soubor %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Soubor %s nevypadá jako soubor lpi."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Indexový soubor je nutný pro funkce jako hledání deklarací. Během vytváření můžete upravovat zdrojové kódy a překládat, ale funkce jako hledání deklarací zobrazí chyby o nenalezených jednotkách. Může to trvat několik minut."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Soubor %s%s%s je symbolický odkaz.%s%sOtevřít místo něj %s%s%s?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "Soubor %s%s%s není projekt lazarusu.%sVytvořit nový projekt pro tento %s?"
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Soubor %s%s%s%svypadá jako program. Zavřít aktuální projekt a vytvořit nový projekt lazarusu pro tento"
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Soubor %s vypadá, že je programový soubor existujícího projektu Lazarusu."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Soubor %s%s%s%sbyl nalezen v jednom ze zdrojových adresářů balíčku %s a vypadá jako přeložená jednotka. Přeložené jednotky musí být ve výstupním adresáři balíčku, jinak můžou mít jiné balíčky problémy s použitím tohoto balíčku.%s%sSmazat tento soubor?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Soubor %s%s%s%snebyl nalezen.%sChcete ho najít sami?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Soubor %s%s%s%snebyl nalezen.%sZvolte Ignorovat pro pokračování v načítání projektu,%szvolte Zrušit pro zastavení načítání."
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "První sestavovací mód je předvolený mód a musí být uložen v projektu, nikoliv v sezení."
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "První sestavovací mód je předvolený mód a musí být uložen v projektu, nikoliv v sezení."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Následující metody použité v %s nejsou v zdrojovém kódu%s%s%s%s%s%sOdstranit tyto odkazy?"
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Spustitelný soubor Free Pascal překladače má obvykle jméno \"%s\". Můžete rovněž použít překladač specifický pro cílovou platformu jako \"%s\". Zadejte, prosím, kompletní souborovou cestu."
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Překladač Free Pascal (jméno souboru: %s) nebyl nalezen.%sDoporučujeme nainstalovat fpc."
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
#, fuzzy
#| msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sTools -> Options -> Files"
msgstr "Adresář zdrojových kódů Free Pascalu nebyl nalezen.%sNěkteré funkce kódu nebudou fungovat.%sDoporučujeme jej nainstalovat a nastavit cestu v %sProstředí->Volby prostředí->Soubory"
#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr "GNU debugger(ladič) přes ssh umožňuje vzdálené ladění přes ssh spojení. Viz docs/RemoteDebugging.txt pro více detailů. Cesta musí obsahovat jméno souboru ssh klienta, jméno hostujícího stroje s volitelným uživatelským jménem a jméno souboru gdb na vzdáleném počítači. Například: %s/usr/bin/ssh uzivatelskejmeno@jmenohostujicihostroje gdb%s nebo: %s/usr/bin/setsid /usr/bin/ssh uzivatelskejmeno@jmenohostujicihostroje gdb%s"
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Identifikátor je jednotkou. Použijte funkci Soubor->Uložit jako k přejmenování jednotky."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Klávesa %s%sje již přiřazena k %s.%s%sOdstranit staré přiřazení a přiřadit klávese novou funkci%s%s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Program %s%snutný ke spuštění neexistuje, nebo není spustitelný.%sChcete jej vytvořit?%s%sViz. nastavení v Projekt -> Volby projektu -> Aplikace."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Spouštěcí aplikace %s%s%s%sneexistuje, nebo není spustitelná.%s%sViz. Spustit -> Parametry spouštění -> Lokální"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Adresář Lazarusu obsahuje zdrojové kódy IDE a soubory balíčků LCL a mnoha standardních balíčků. Obsahuje například soubor \"ide%slazarus.lpi\". Soubory překladů jsou umístěny také tam."
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
#, fuzzy
#| msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Tools -> Options -> Files"
msgstr "Adresář Lazarusu nebyl nalezen.%sNebudete moci vytvářet LCL aplikace.%sProsím, zkontrolujte Prostředí -> Volby prostředí -> Soubory"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Soubor LFM (formulář Lazarusu) obsahuje neplatné vlastnosti. To například znamená, že obsahuje nějaké vlastnosti/třídy, které neexistují v aktuálním LCL. Obvyklá oprava je odstranit tyto vlastnosti z lfm a ručně opravit kód Pascalu."
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Jméno %s%s%s není platný pascalovský identifikátor."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Nový zahrnovaný soubor ještě není ve vyhledávací cestě zahrnutí.%sPřidat adresář %s?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Nová jednotka zatím není v cestě hledání jednotek.%sPřidat adresář %s?"
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Ostatní zdroje\" obsahuje adresář, který je již v \"Ostatní soubory jednotek\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Výstupní adresář %s%s%s chybí."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Výstupní adresář %s je v seznamu cest hledání include %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Výstupní adresář %s je v zděděném seznamu cest hledání include %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Výstupní adresář %s je v seznamu zděděných cest hledání jednotek %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Výstupní adresář %s je v seznamu cest hledání jednotek%s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "Výstupní adresář by měl být samostatný adresář a neměl by obsahovat žádné zdrojové soubory."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Vlastnící třída má toto jméno"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Vlastník má toto jméno"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Balíček %s přidává cestu \"%s\" do zahrnované cesty IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Balíček %s přidává cestu \"%s\" do cesty jednotek IDE.%sPravděpodobně jde o chybnou konfiguraci balíčku."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Balíček již obsahuje jednotku s tímto jménem."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Balíček %s nemůže být odinstalován, protože jej potřebuje samo IDE."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Balíček %s nemá proceduru \"Register\", což typicky znamená, že neposkytuje žádný přídavek pro IDE. Jeho instalací se pravděpodobně pouze zvětší velikost IDE a může dokonce způsobit jeho nestabilitu.%s%sTip: Pokud chcete použít balíček ve Vašem projektu, použijte položku menu \"Přidat do projektu\"."
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Program %smake%s nebyl nalezen.%sTento nástroj je nutný k sestavení Lazarusu.%s"
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Volby překladače projektu a příkazy v hlavním zdroji se liší. Nové jednotky použijí mód a řetězcový typ z voleb projektu:"
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr "Projekt nepoužívá rozhraní jednotek LCL, ale zdá se, že je potřebuje.%sDostanete různé chyby při linkování, pokud použijete LCL formulář bez rozhraní."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Projekt nemá hlavní soubor zdrojového kódu."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Informační soubor projektu %s%s%s%sje shodný s hlavním souborem zdrojového kódu!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Informační soubor projektu %s%s%s%sse změnil na disku."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy
#| msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Před sestavením musíte projekt uložit%sPokud jste nastavili testovací adresář ve volbách prostředí,%smůžete nový projekt zároveň vytvořit i sestavit.%sUložit projekt?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Projekt používá cílový OS=%s a CPU=%s.%sSoubor system.ppu pro tento cílový systém nebyl nalezen v programovém adresáři FPC. Ujistěte se, že je FPC nainstalován pro tento cílový systém a fpc.cfg obsahuje správné adresáře."
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Projekt používá nové zdroje FPC, což vyžaduje alespoň FPC 2.4"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "V adresáři jsou další soubory se stejným jménem, %skteré se liší pouze ve velikosti písmen:%s%s%sSmazat je?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Na disku už je soubor se stejným jménem a podobnou koncovkou%sSoubor: %s%sNeplatný soubor: %s%s%sSmazat neplatný soubor?"
#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr "Sestavovací makro se jménem %s%s%s již existuje."
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Již existuje komponenta se tímto jménem"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Již existuje formulář se jménem %s%s%s"
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "IDE makro se jménem \"%s\" již existuje"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Jednotka se jménem %s%s%sjiž existuje. Identifikátory Pascalu musí být unikátní."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Jednotka se jménem %s%s%s již v projektu existuje.%sZvolte, prosím, jiné jméno"
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Musí existovat alespoň jeden sestavovací mód."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Zdrojová třída %s%s%s dědí z %s%s%s. Pravděpodobně je to překlep pro TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Při zápisu zvolené komponenty nastala chyba %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Při převodu binárního proudu zvolené komponenty nastala chyba %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Při kopírování proudu komponenty do schránky nastala chyba:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Kořenový komponentu nelze smazat."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted:"
msgstr ""
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Tyto nastavení jsou uloženy v projektu"
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Tyto jednotky nebyly nalezeny:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Zdrojové kódy balíčků Free Pascalu jsou nutné pro prohlížení a doplňování kódu. Například obsahuje soubor \"%s\"."
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see IDE options)"
msgstr ""
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Jednotka %s%s%s již existuje.%sIgnorovat vynutí přejmenování,%sZrušit zruší ukládání tohoto zdrojového kódu a %sZrušit zruší celé ukládání."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Jednotka patří balíčku %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Jednotka %s existuje dvakrát v cestě jednotek %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Jednotka má toto jméno"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy
#| msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgid "The unit filename %s%s%s is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Jméno souboru jednotky %s%s%s není malými písmeny.%sPřekladač FreePascal nehledá všechny velikosti. Je lepší použít jména souborů s malými písmeny.%s%sPřejmenovat soubor malými písmeny?"
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Jednotka %s je používaná jinými soubory.%sAktualizovat automaticky odkazy?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Jednotka samotná už má jméno %s%s%s. Identifikátory Pascalu musí být unikátní."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Cesta hledání jednotek %s%s%s obsahuje zdrojový adresář %s%s%s balíčku %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Pracovní adresář %s%s%s neexistuje.%sProsím, zkontrolujte pracovní adresář v Spustit -> Parametry spuštění."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Tato funkce vyžaduje otevřený .lfm soubor v editoru zdrojového kódu."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "tato zpráva nápovědy"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Vypadá to jako pascalovský soubor.%sDoporučujeme ve jméně použít malá písmena, aby jste předešli problémům na některých souborových systémech a různých překladačích.%sPřejmenovat malými písmeny?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Tento projekt nemá hlavní zdrojový soubor"
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Tato kombinace voleb sestavení Lazarusu není podporována touto instalací.%sAdresář %s%s%s není zapisovatelný.%sViz. webové stránky Lazarusu pro jiné způsoby instalace Lazarusu."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tento příkaz nelze vyjmout.%sProsím, vyberte nějaký kód pro vyjmutí procedury/metody."
#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr "Toto vytvoří kruh."
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr ""
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Aktuální"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Funkce"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr ""
#: lazarusidestrconsts.listhreadsid
msgid "Id"
msgstr ""
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Řádek"
#: lazarusidestrconsts.listhreadsname
msgctxt "lazarusidestrconsts.listhreadsname"
msgid "Name"
msgstr "Jméno"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr ""
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Zdroj"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Stav"
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "&Automaticky zavřít při úspěchu"
#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Překládání:"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titulek"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Titulek v panelu úloh zobrazí například: projekt1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Název (nechejte prázdné pro výchozí)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkce: připojit oddělovač cesty"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funkce: odstranit oddělovač cesty"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkce: vytáhnout příponu souboru"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkce: vytáhnout jméno souboru + příponu"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkce: vytáhnout pouze jméno souboru"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkce: vytáhnout cestu"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(neznámé makro: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Cesta:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Přepnout zobrazení názvů souborů s plnou cestou nebo s relativní cestou"
#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr "Pro instalaci musíte přeložit a restartovat IDE"
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Nahoře"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Přichycení nahoru"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Horní okrajový prostor. Tato hodnota je přidána jako základ okrajového prostoru a použita pro prostor nad prvkem."
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Vrcholky"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Toto je sourozenec prvku, k jehož horní straně je ukotvený. Ponechte prázdné pro rodiče."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Horní mezery stejně"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Strom potřebuje obnovení"
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Typy (neodstraňovat pokud není náhrada)"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Neukazovat znova tuto zprávu."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Chyba v regulárním výrazu"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Písmo bez UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Přejít na řádek:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nenalezeno"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Nahradit výskyty %s%s%s%s s %s%s%s?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Hledání: %s"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Hledaný řetězec '%s' nenalezen!"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Aktuální písmo editoru nepodporuje UTF-8, ale váš sytém vypadá, že ho používá.%sTo znamená, že ne-ASCII"
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Smazat vyrovnávací paměť pro include"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bajtů"
#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Smazat"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Zahrnut tímto:"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "v projektu:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Řádky:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Jméno:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "ne"
#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "Ok"
#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Cesty (pouze ke čtení)"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Velikost:"
#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Zdroj"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Jednotka"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "ano"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Ukázat hodnoty CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Nelze převést binární proud na text"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Nelze zkopírovat komponenty do schránky"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nelze přidat zdrojovou hlavičku do souboru zdrojů %s%s%s%s.%sNejspíše chyba syntaxe."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nelze přidat zdroj T%s:FORMDATA do souboru zdrojů %s%s%s%s.%sPravděpodobně syntaktická chyba."
#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "Nelze přidat nastavení"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Do projektu nelze přidat %s, přestože projekt už obsahuje jednotku se stejným jménem."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Nelze zálohovat soubor %s%s%s do %s%s%s!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNelze změnit jméno třídy %s na %s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "Nelze změnit titulek projektu ve zdrojích.%s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nelze vyčistit cílový adresář"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Nelze vyčistit %s%s%s.%sProsím, zkontrolujte přístupová práva."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Nelze převést text komponenty do binárního formátu:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Nelze převést soubor %s%s%s%sChyba: %s"
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Nelze převést soubor lfm na lrs a zapsat lrs."
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Nelze převést textová data formuláře souboru %s%s%s%s%sdo binárního proudu. (%s)"
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Soubor nelze zkopírovat"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Nelze zkopírovat soubor %s%s%s%sna %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Nelze zkopírovat soubor %s%s%s%sna %s%s%s."
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Nelze vytvořit záložní adresář %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Nelze vytvořit adresář %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Nelze vytvořit adresář %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nelze vytvořit soubor"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Nelze vytvořit soubor %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Nelze vytvořit soubor %s%s%s%s"
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Nelze vytvořit soubor %s%s%s."
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Nelze vytvořit odkaz %s%s%s s cílem %s%s%s"
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Nelze vytvořit novou metodu."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Nelze vytvořit dočasnou paměť pro lfm."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Nelze smazat"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Nelze odstranit víceznačný soubor %s%s%s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Nelze najít sekci ResourceString v této nebo některé z použitých jednotek."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Nelze najít platné jméno třídy v %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Nelze nalézt soubor %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy
#| msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Nelze najít soubor %s%s%s.%sPokud patří do Vašeho projektu, zkontrolujte cestu hledání v %sProjekt -> Volby překladače... -> Cesty->Ostatní soubory jednotek. Pokud tento soubor patří do balíčku, zkontrolujte příslušné volby překladače balíčku. Pokud tento soubor patří do Lazarusu, ujistěte se čistým přeložením. Pokud soubor patří do FPC, zkontrolujte fpc.cfg. Pokud si nejste jistí, použijte Projekt -> Volby překladače... -> Test"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Nelze najít %s v proudu LFM."
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Nelze najít metodu."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "Nelze najít pascalovskou jednotku (.pas,.pp) pro soubor .lfm%s%%s%s"
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Nelze najít jednotku třídy komponenty %s%s%s."
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Nelze získat změny v editoru."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Nelze získat zdroj pro návrhář."
#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "Nelze načíst soubor:%s%s"
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr "Nelze nahrát soubor %s: %s"
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Nelze načíst starý soubor zdrojů.%sSoubor zdrojů je první vkládaný soubor v inicializační části %s.Na příklad {$I %s.lrs}.%sPravděpodobně chyba syntaxe."
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Nelze přečíst balíček %s%s%"
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Nelze načíst třídu komponenty %s%s%s, protože závisí na sobě samé."
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Nelze otevřít komponentu předka"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Nelze přečíst %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nelze přečíst soubor"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Nelze přečíst soubor %s%s%s!"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Nelze číst soubor %s%s%s%sChyba: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Nelze přečíst soubor %s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Nelze číst informační soubor projektu%s%s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Nelze číst informační soubor projektu%s%s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Nelze odstranit starý záložní soubor %s%s%s!"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Nelze odstranit titulek projektu ze zdrojů.%s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Nelze přejmenovat víceznačný soubor %s%s%s%sna %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Soubor nelze přejmenovat"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Nelze přejmenovat soubor %s%s%s na %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Nelze přejmenovat soubor %s%s%s%sna %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nelze přejmenovat formulář ve zdrojovém souboru."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nelze přejmenovat metodu. Prosím vyřešte chybu ukázanou v okně zpráv."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nelze přejmenovat proměnnou ve zdrojovém souboru."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Nelze spustit"
#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Soubor %s%s%s nelze uložit"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Nelze nastavit AnchorSide Control"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Nelze zobrazit metodu."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Nelze zřetězit vybranou komponenty"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Nelze zřetězit vybrané komponenty."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nelze zřetězit %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nelze převést komponentu v binárním proudu %s:T%s na text."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nelze zaktualizovat příkaz CreateForm v zdrojovém souboru projektu"
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Nelze aktualizovat binární zdrojový soubor%s%s%sz textového zdrojového souboru%s%s%s%sTextový soubor"
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Nelze zapisovat %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Nelze zapisovat do %s%s%s"
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Nelze zapsat soubor"
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Nelze zapisovat do souboru %s%s%s%sChyba: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Nelze zapisovat do informačního souboru projektu %s%s%s%sChyba: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Nelze zapsat soubor sezení projektu%s\"%s\".%sChyba: %s"
#: lazarusidestrconsts.lisunabletowritetofile
msgid "Unable to write to file %s%s%s."
msgstr "Nelze zapsat do souboru %s%s%s."
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Nelze zapsat do souboru \"%s\"."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Nelze zapsat xml proud do %s%sChyba: %s"
#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "Neočekávaná výsledek:%sLadič bude ukončen"
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Odinstalování není možné"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Odinstalovat vybrané?"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Jednotka %s%s%s byla změněna. Uložit?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identifikátor jednotky již existuje"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s jednotka %s v balíčku %s%s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Jméno jednotky je už v projektu"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Jméno jednotky začíná s..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Jméno jednotky obsahuje..."
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Výstupní adresář jednotky"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "cesta jednotky"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Cesty jednotky"
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr ""
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Bez znaménka"
#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Nepoužité jednotky"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Aktualizovat odkazy?"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "řetězec velkými písmeny"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Řetězec velkými písmeny předán jako parametr"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Zpráva o použití (volba -h)"
#: lazarusidestrconsts.lisuse
msgid "Use >>"
msgstr "Použít >>"
#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr "Použít Ansi řetězce"
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Použít balíčky návrhu"
#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Použít filtr vyřazení"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Použít identifikátor"
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Použít identifikátor %s v %s na %s"
#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Použít filtr zahrnutí"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Spouštím aplikaci"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Použít balíček %s v balíčku %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Použít balíček v balíčku"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Použít balíček %s v projektu"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Použít balíček v projektu"
#: lazarusidestrconsts.lisuseprojectunit
msgctxt "lazarusidestrconsts.lisuseprojectunit"
msgid "Add unit to uses section"
msgstr "Přidat jednotku do sekce použitých jednotek"
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Uživatelský domovský adresář"
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Použít jednotku %s v jednotce %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 s BOM"
#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr "Hodnota:"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Hodnota%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Hodnota: "
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Hodnoty"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Ověřit volání metod"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Verze"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Svislý"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Zkopírovat informace o verzi do schránky"
#: lazarusidestrconsts.lisviewbreakpointproperties
#, fuzzy
#| msgid "Breakpoint Properties..."
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Zobrazit vlastnosti Bodu přerušení"
#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Zobrazit jednotky projektu"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Zobrazit zdroj (.lfm)"
#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Dopředné hledání"
#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Resetovat seznam výsledků"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Varování: "
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Varování: víceznačný soubor nalezen: %s%s%s. Zdrojový soubor je: %s%s%"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sVarování: Toto je hlavní jednotka. Nová hlavní jednotka bude %s.pas"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Sledování"
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Vlastnosti sledování"
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Vítejte v Lazarus IDE %s"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "Aktualizuj odkazy, pokud je jednotka přejmenována..."
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "pokud je povoleno, aktuální nastavení jsou uloženy do šablony, která je použita při vytváření projektů"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Ukázat aktuální uzel v průzkumníku kódu při pohybu kurzoru v editoru zdrojového kódu"
#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr "%s, se zahrnutými %s"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", se zahrnutými "
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Bez správného překladače nebude procházení kódu a překlad dokonalé."
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Bez správného adresáře Lazarusu dostanete mnoho varování."
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Bez příslušných zdrojů FPC bude procházení a doplňování kódu velmi omezené."
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "S požadovanými balíčky"
#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Přidat"
#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Smazat"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Sma&zat vše"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Z&akázat vše"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "&Povolit vše"
#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Povolený"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Výraz"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Vlastnosti"
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Seznam sledování"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Slovo na pozici kurzoru v aktuálním editoru"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Pracovní složka pro sestavení"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Pracovní složka pro spuštění"
#: lazarusidestrconsts.lisworkingdirectorynotfound
msgid "Working directory %s not found"
msgstr ""
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Chyba zápisu"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Chyba zápisu: %s%sSoubor: %s%s%s"
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr "špatná verze v %s: %s"
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Chyba XML"
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "XML soubory"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Chyba XML analyzátoru v souboru %s%sChyba: %s"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Můžete to vypnout pro jednotlivé formuláře pomocí kontextového menu v Inspektoru projektu"
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Nemůžete sestavit lazarus v průběhu ladění nebo překládání."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Přidat jednotku balíčku do sekce uses"
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binární"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Číselný"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr ""
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr ""
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr ""
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr ""
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Přidat inverzi"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Automaticky zvyšovat číslo sestavení"
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Dostupné snímače"
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Sestavení:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Mapa znaků:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Zavřít aktuální složku"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Podmíněné definice"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Vytvořit novou definici"
#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "Vytváření adresáře \"%s\" selhalo!"
#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "Vytváření symbolického odkazu \"%s\" selhalo!"
#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "Vytváření symbolických odkazů není na této platformě podporováno!"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Povolit i18n"
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "Zadejte jednu nebo více frází, které chcete hledat nebo filtrovat v seznamu, oddělené mezerami nebo čárkami"
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "Filtrovat seznam dle aktuálního filtračního výrazu"
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Datový soubor formuláře (*.dfm)|*.dfm"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Nalezeno, ale zde nevypsáno: "
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "Jíž na další položku v seznamu hledání"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Nastavení i18n"
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Zahrnout informaci o verzi ve spustitelném souboru"
#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Vlastní pozice"
#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Výchozí"
#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Ukotvený"
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Obnovit rozměry okna"
#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Obnovit velikost okna"
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Uživatelské nastavení manažeru oken"
#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Klávesa"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikánština"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabština"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automaticky (nebo angličtina)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Katalánky"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Čínsky"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Česky"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandsky"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Anglicky"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finsky"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francouzky"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Německy"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebrejsky"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonésky"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italsky"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonsky"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litevsky"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Nastavení jazyku"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polsky"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Portugalsky"
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Brazilská portugalština"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Rusky"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Výběr jazyku:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovensky"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Španělsky"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turecky"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrajinsky"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Hlavní verze:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Ve&dlejší verze:"
#: lazarusidestrconsts.rsok
msgctxt "lazarusidestrconsts.rsok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Jiné informace"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Výstupní adresář pro PO:"
#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Odstranit"
#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "Nulovat filtr"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revize:"
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Snímače"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Vybrat zděděnou položku"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Začít nové hledání"
#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Hodnota"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Číslování verze"
#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Klíč \"%s\" již je připojen k \"%s\"."
#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternativní klávesa (nebo kombinace dvou kláves)"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Příkazy menu Nápověda"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Příkazové příkazy"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Příkazy CodeTools"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Příkazy výběru textových sloupců"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Příkazy přesunu ukazatele"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Příkazy editace textu"
#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Příkazy menu pro prostředí "
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Příkazy menu Soubor"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Příkazy skládání textu"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Příkazy označení textu"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Příkazy menu Balíček"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Příkazy menu Projekt"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Spustit příkazy menu"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Příkazy hledání a nahrazení textu"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Příkazy výběru textu"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Příkazy zdrojového zápisníku"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Editování Syncron"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Úpravy Syncron (ne v buňce)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Úpravy Syncron (při výběru)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Editování šablony"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Úprava šablony (ne v buňce)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Příkazy menu Nástroje"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Zobrazit příkazy menu"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Příkaz:"
#: lazarusidestrconsts.srkmcommand1
msgid " command1 \""
msgstr " příkaz1 \""
#: lazarusidestrconsts.srkmcommand2
msgid " command2 \""
msgstr " příkaz2 \""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt "
#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " konflikt s "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "přerušit sestavení"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract methods ..."
msgstr "Abstraktní metody ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr ""
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Přidat bod skoku"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "přidat sledování"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Dokončování šablon kódu"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Kopírovat blok"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Vymazat blok"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Jdi na začátek bloku"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Jít na konec bloku"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Skrýt blok"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Odsadit blok"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Přesunout blok"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Nastavit začátek bloku"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Nastavit konec bloku"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Ukázat blok"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Přepnout blok"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Vrátit odsazení bloku"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Sestavit program/projekt"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "sestavit soubor"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Sestavit lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Znak"
#: lazarusidestrconsts.srkmeccleanupcompiled
msgid "clean up build files"
msgstr ""
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Odstranit celý text"
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Definiční editor CodeTools"
#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Volby CodeTools"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Sloupec Vybrat dolů"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Sloupcový výběr do úplného konce"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Sloupcový výběr do úplného začátku"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Sloupec Vybrat vlevo"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Sloupec Vybrat ke konci řádku"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Sloupce Vybrat k začátku řádku"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Sloupce Vybrat k začátku v řádku"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Sloupec Vybrat k spodku stránky"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Sloupec Vybrat spodek stránky"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Sloupec Vybrat vrch stránky"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Sloupec Vybrat stránku nahoru"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Sloupec Vybrat vpravo"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Sloupec Vybrat nahoru"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Sloupec Vybrat slovo vlevo"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Sloupec Vybrat slovo vpravo"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Režim výběru sloupce"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "přeložit program/projekt"
#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "volby překladače"
#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Dokončení kódu"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "konfigurační soubor sestavení"
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Zkopírovat výběr do schránky"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Kopírovat editor do nového okna"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Kopírovat editor do dalšího volného okna"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Kopírovat editor do předešlého volného okna"
#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Vlastní nástroj %d"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Vyjmout výběr do schránky"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Odstranit k začátek řádku"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Odstranit znak na pozici kurzoru"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Smazat ke konci řádku"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Odstranit poslední znak"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Odstranit k začátku slova"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Odstranit aktuální řádek"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Odstranit ke konci slova"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Rozdíl"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Přesunout ukazatel na úplný konec"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Přesunout ukazatel na úplný začátek"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty methods ..."
msgstr "Prázdné metody ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Volby IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "vyhodnocení/upravení"
#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Rozbalit proceduru"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Vnější nástroj %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Nastavení vnějších nástrojů"
#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Najít text"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Najít další konec bloku"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Najít začátek bloku"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Najít deklaraci"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Najít použití identifikátoru"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Najít v souborech"
#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Najít další"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Najít další výskyt slova"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr "Najít přetížené"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find overloads ..."
msgstr "Najít přetížené ..."
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Najít předchozí"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Najít předchozí výskyt slova"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Najít definic procedury"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Najít metodu procedury"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Svinout na pozici ukazatele"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Svinout do úrovně %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Jít na editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Jít na direktivu include aktuálního vloženého souboru"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Jít na číslo řádku"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Jít na značku %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Jít na XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Hádat chybně umístěné $IFDEF"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Vložit položku ZáznamuZměn"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Vložit z mapy znaků"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Vložit klíčové slovo CVS Autor"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Vložit klíčové slovo CVS Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Vložit klíčové slovo CVS Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Vložit klíčové slovo CVS ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Vložit klíčové slovo CVS Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Vložit klíčové slovo CVS Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Vložit klíčové slovo CVS Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Vložit klíčové slovo CVS Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Vložit aktuální datum a čas"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Vložit GPL poznámku"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Vložit GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Vložit poznámku LGPL"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Ukončit řádek a nechat kurzor"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Režim vkládání"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Vložit upravenou poznámku LGPL"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Vložit aktuální jméno uživatele"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "zkoumat"
#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Převrátit přiřazení"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Ukončit řádek a přesunout kurzor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Přesunout ukazatel na konec řádku"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Režim výběru řádku"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Přesunout ukazatel na začátek řádku"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Přesunout ukazatel na začátek textu v řádku"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Uzamknout editor"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Vytvořit zdrojový řetězec"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Přejít na odpovídající závorku"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Přesunout editor doleva"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Přesunout editor zcela vlevo"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Přesunout editor do nového okna"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Přesunout editor do dalšího prázdného okna"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Přesunout editor do předešlého volného okna"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Přesunout editor doprava"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Přesunout editor zcela vpravo"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Další značka"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Přejít na další editor"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Jít na další editor se stejným Zdrojem"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Jít na další okno"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Režim normálního výběru"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Otevřít soubor na pozici kurzoru"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Režim přepisu"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Přesunout ukazatel na spodek stránky"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Přesunout ukazatel o stránku níže"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Přesunout kurzor o stranu vlevo"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Přesunout kurzor o stranu vpravo"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Přesunout ukazatel o začátek stránky"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Přesunout ukazatel o jednu stránku výše"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Vložit schránku na aktuální pozici"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pozastavit program"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Předchozí značka"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Přejít na předchozí editor"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Jít na předchozí editor se stejným Zdrojem"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Jít na předchozí okno"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "rychlý překlad, bez spojení"
#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr "Ukončit"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "odebrat bod přerušení"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Odebrat prázdné metody"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr "Odebrat nepoužívané jednotky"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Přejmenovat identifikátor"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Nahradit text"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Hlášení závady"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "resetovat ladič"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "spustit program"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "spustit soubor"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "spustit s parametry"
#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Uložit"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolovat dolů o jeden řádek"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolovat vlevo o jeden znak"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolovat vpravo o jeden znak"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolovat nahoru o jeden řádek"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Vybrat dolní"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Vybrat vše"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Převést ve výběru tabulátory na mezery"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Vybrat po úplný konec"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Vybrat po úplný začátek"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Vybrat Goto XY"
#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "SelLeft"
#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Vybrat konec řádku"
#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Vybrat začátek řádku"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Vybrat k začátku text v řádku"
#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Vybrat spodek stránky"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Vybrat stránku dole"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Vybrat stránku vlevo"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Vybrat stránku vpravo"
#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Vybrat vrch stránky"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Vybrat stránku nahoře"
#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "SelRight"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Vybrat nahoru"
#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Vybrat slovo nalevo"
#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Vybrat slovo napravo"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastavit volnou Záložku"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Nastavit značku %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Ukázat abstraktní metody"
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Ukázat obsah kódu"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "ukázat bod vykonávání"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "zastavit program"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Jít na poslední pozici v buňce"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Jít na první pozici v buňce"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Vybrat buňku"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Odejít"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Další buňka"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Další buňka (všechny vybrané)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Předchozí buňka"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Předchozí buňka (všechny vybrané)"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Spustit editor Syncro"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Přejít na poslední pozici v buňce"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Přejít na první pozici v buňce"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Vybrat buňku"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Odejít"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Dokončit"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Další buňka"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Další buňka (rotace)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Další buňka (všechny vybrané)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Další buňka (rotace / všechny vybrané)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Předchozí buňka"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Předchozí buňka (všechny vybrané)"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Kontrola syntaxe"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Zobrazit assembler"
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr "prohodit bod přerušení"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Zobrazit body zastavení"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Zobrazit volací zásobník"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Zobrazit prohlížeč kódu"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Zobrazit průzkumník kódu"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Zobrazit sadu komponent"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Zobrazit výstup ladícího nástroje"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Přepnout mezi formulářem a jednotkou"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Zobrazit editor dokumentace"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Zobrazit rychlá tlačítka IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Zobrazit místní proměnné"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Prohodit Značkovač %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Prohodit zvýraznění aktuálního slova"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Zobrazit hlášení"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Přepnout režim"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Zobrazit inspektor objektů"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Zobrazit registry"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Zobrazit prohlížeč omezení"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Zobrazit výsledky hledání"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Zobrazit editor zdrojů"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Zobrazit sledovače"
#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "Rozevřít vše"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Rozevřít na pozici ukazatele"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "neznámý příkaz editoru"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused units ..."
msgstr "Nepoužité jednotky ..."
#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Nejdříve uživatel"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Zobrazit editor kotev"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Zobrazit komponenty"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Zobrazit formuláře"
#: lazarusidestrconsts.srkmecviewhistory
msgid "View History"
msgstr ""
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgid "View Terminal Output"
msgstr ""
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr ""
#: lazarusidestrconsts.srkmecviewthreads
msgid "View Threads"
msgstr ""
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Zobrazit závislosti jednotky"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Zobrazit informace o jednotkách"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Zobrazit jednotky"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Doplnění slova"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Přesunout ukazatel o slovo doleva"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Přesunout ukazatel o slovo doprava"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Upravit klávesy povelů"
#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Upravit klávesy"
#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Zachytit klávesu"
#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Zachytit druhou klávesu"
#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Klávesa (nebo kombinace dvou kláves)"
#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Prosím stiskněte klávesu..."
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Zabalit komentáře ve výběru"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Skrýt komentáře ve výběru"
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr "Rozbalit všechny komentáře ve výběru"
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr "Rozbalit komentáře ve výběru"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Soubor je pouze ke čtení"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Soubor \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" není zapisovatelný."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Zamknutý"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Přidat &Sledování v místě kurzoru"
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Značka"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Zavřít všechny &ostatní stránky"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Zavřít stránku"
#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopírovat"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Zkopírovat název souboru"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to new Window"
msgstr "Klonovat do nového okna"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr "Klonovat do jiného Okna"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nové okno"
#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Vyjmout"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Ladění"
#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Vlastnosti editoru"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kódování"
#: lazarusidestrconsts.uemevaluatemodify
#, fuzzy
#| msgid "&Evaluate/Modify..."
msgid "&Evaluate/Modify ..."
msgstr "&Vyhodnocení/Upravení..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Najít deklaraci"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Skok na značku"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Zvýrazňovač"
#: lazarusidestrconsts.ueminspect
#, fuzzy
#| msgid "&Inspect..."
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Zkoumat..."
#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Převrátit přiřazení"
#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "Konec řádku"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Uzamknout stránku"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "Přesunout stránku doleva"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "Přesunout stránku nejvíce doleva"
#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "Přesunout stránku doprava"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "Přesunout stránku nejvíce doprava"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "Přesunout do nového Okna"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr "Přesunout do jiného Okna"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nové okno"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Přejít na další záložku"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Změněný"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Otevřít soubor na pozici kurzoru"
#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Vložit"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Přejít na předchozí záložku"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Skok procedury"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Pouze pro čtení"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Spustit po kurzor"
#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Nastavit značku"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastavit volnou Záložku"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zobrazovat čísla řádků"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Zdroj"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Přepnout záložku"
#: lazarusidestrconsts.uemtogglebreakpoint
#, fuzzy
#| msgid "&Toggle Breakpoint"
msgid "Toggle &Breakpoint"
msgstr "&Přepnout záložku"
#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Zobrazit volací zásobník"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Doposud neimplementováno"
#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Říkal jsem ti: Ještě není implementováno"
#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Pošlete e-mail na lazarus@miraclec.com, pokud nám můžete pomoci implementovat tuto vlastnost."
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "VLO"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "PŘE"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Pouze pro čtení"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informace o verzi"