lazarus/languages/lazaruside.fi.po
mattias 1fcc902ee4 translations: finnish: updates from Seppo
git-svn-id: trunk@16474 -
2008-09-07 21:27:05 +00:00

11311 lines
292 KiB
Plaintext

msgid ""
msgstr ""
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
#: lazarusidestrconsts:srkmcommand1
msgid " command1 \""
msgstr ""
#: lazarusidestrconsts:srkmcommand2
msgid " command2 \""
msgstr ""
#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr ""
#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""
#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr ""
#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (käännetään ...)"
#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr ""
#: lazarusidestrconsts:liscovarious
msgid "%s (various)"
msgstr ""
#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr ""
#: lazarusidestrconsts:lislazarusversionstring
msgid "%s beta"
msgstr ""
#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s tavua"
#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr ""
#: lazarusidestrconsts:lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""
#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""
#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""
#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s on jo osa projektia."
#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr ""
#: lazarusidestrconsts:lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""
#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s on vääränlainen projektin tiedostonimi.%sOle hyvä ja valitse joku muu (esim. projekti1.lpi)"
#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s ei ole laillinen tunniste"
#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr ""
#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr ""
#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Komponenttipaletin välilehti: %s"
#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""
#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr ""
#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr ""
#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sKatso projektivalikon kohtaa -> Projektinhallinta"
#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr ""
#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sSeuraava käännösyksikkö (unit) lisätään %s-tiedoston uses-lauseeseen :%s%s%s"
#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr ""
#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr ""
#: lazarusidestrconsts:lisnone
msgid "%snone"
msgstr ""
#: lazarusidestrconsts:liswladd
msgid "&Add"
msgstr ""
#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr ""
#: lazarusidestrconsts:lisfrbackwardsearch
msgid "&Backward search"
msgstr "Taaksepäin"
#: lazarusidestrconsts:dlgcasesensitive
msgid "&Case Sensitive"
msgstr "Sama kirjainkoko"
#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "Sama kirjainkoko"
#: lazarusidestrconsts:lisclose
msgid "&Close"
msgstr "&Sulje"
#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "Sulje välilehti"
#: lazarusidestrconsts:lismenuviewcomponents
msgid "&Components"
msgstr "&Komponentit"
#: lazarusidestrconsts:liswldelete
msgid "&Delete"
msgstr ""
#: lazarusidestrconsts:lisdeleteall
msgid "&Delete All"
msgstr ""
#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Muokkaa"
#: lazarusidestrconsts:lisenableall
msgid "&Enable All"
msgstr ""
#: lazarusidestrconsts:liswlenabled
msgid "&Enabled"
msgstr ""
#: lazarusidestrconsts:dlgentirescope
msgid "&Entire Scope"
msgstr "Ulottuvuuden alkukohta"
#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Tiedosto"
#: lazarusidestrconsts:lismenufind2
msgid "&Find ..."
msgstr "Etsi"
#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Etsi määrittely"
#: lazarusidestrconsts:dlgfromcursor
msgid "&From Cursor"
msgstr "Kohdistimen osoittama kohta"
#: lazarusidestrconsts:dlgglobal
msgid "&Global"
msgstr "Kaikki"
#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Siirry kirjaimerkkiin"
#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "&Ohje"
#: lazarusidestrconsts:lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""
#: lazarusidestrconsts:lisplistobjects
msgid "&Objects"
msgstr "Luokka"
#: lazarusidestrconsts:lisok
msgid "&Ok"
msgstr ""
#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Avaa kohdistimen osoittama tiedosto"
#: lazarusidestrconsts:lismenupackage
msgid "&Package"
msgstr "Komponenttipaketti"
#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "&Projekti"
#: lazarusidestrconsts:dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "Kysy vielä muutoksille vahvistusta"
#: lazarusidestrconsts:liswlproperties
msgid "&Properties"
msgstr ""
#: lazarusidestrconsts:dlgregularexpressions
msgid "&Regular Expressions"
msgstr "Säännölliset lausekkeet"
#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "Säännölliset lausekkeet"
#: lazarusidestrconsts:rsremove
msgid "&Remove"
msgstr "Poista"
#: lazarusidestrconsts:lismenureplace2
msgid "&Replace ..."
msgstr "Etsi ja korvaa..."
#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "Korvaava"
#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "&Suorita"
#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr ""
#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "&Etsi"
#: lazarusidestrconsts:dlgselectedtext
msgid "&Selected Text"
msgstr "Valittu teksti"
#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Merkitse kirjainmerkiksi"
#: lazarusidestrconsts:lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""
#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "Etsittävä"
#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "&Työkalut"
#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Näytä"
#: lazarusidestrconsts:lismenuviewsource
msgid "&View Source"
msgstr "Näytä lähdekoodi"
#: lazarusidestrconsts:dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "Etsi vain kokonaisia sanoja"
#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "Etsi vain kokonaisia sanoja"
#: lazarusidestrconsts:lismenuwindow
msgid "&Window"
msgstr "Ikkunat"
#: lazarusidestrconsts:liscefilter
msgid "(Filter)"
msgstr ""
#: lazarusidestrconsts:lisfilter2
msgid "(filter)"
msgstr ""
#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""
#: lazarusidestrconsts:dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(ei alikansiota)"
#: lazarusidestrconsts:liscodehelpnodocumentation
msgid "(none)"
msgstr ""
#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr ""
#: lazarusidestrconsts:lisplistall
msgid "<All>"
msgstr "<Kaikki>"
#: lazarusidestrconsts:liscodehelpnotagcaption
msgid "<NONE>"
msgstr ""
#: lazarusidestrconsts:lisplistnone
msgid "<None>"
msgstr "<Ei mikään>"
#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""
#: lazarusidestrconsts:lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr ""
#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr ""
#: lazarusidestrconsts:lisoff
msgid "? (Off)"
msgstr ""
#: lazarusidestrconsts:lison
msgid "? (On)"
msgstr ""
#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr ""
#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Tiedosto %s%s%s on jo olemassa.%skorvataanko se? "
#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""
#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr ""
#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Perus Pascal-ohjelma tiedosto.%sTämä on tarkoitettu lähinnä testaamiseen.%sYleisesti olisi parempi valita jokin uusi projekti kuten esim. sovellus."
#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr ""
#: lazarusidestrconsts:lisabandonchanges
msgid "Abandon changes?"
msgstr ""
#: lazarusidestrconsts:lisinfobuildmakeabort
msgid "Abort"
msgstr "Keskeytä"
#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr ""
#: lazarusidestrconsts:lisabortall
msgid "Abort all"
msgstr "Keskeytä kaikki"
#: lazarusidestrconsts:lisabortallloading
msgid "Abort all loading"
msgstr ""
#: lazarusidestrconsts:liskmabortbuilding
msgid "Abort building"
msgstr ""
#: lazarusidestrconsts:lisabortloadingproject
msgid "Abort loading project"
msgstr "Keskeytä projektin lataaminen"
#: lazarusidestrconsts:lisabortwholeloading
msgid "Abort whole loading"
msgstr ""
#: lazarusidestrconsts:lisinfobuildabort
msgid "Aborted..."
msgstr ""
#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "Tietoja"
#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr "Tietoja Lazarus:sta"
#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""
#: lazarusidestrconsts:lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""
#: lazarusidestrconsts:lissortselsort
msgid "Accept"
msgstr "Hyväksy"
#: lazarusidestrconsts:lisacknowledgements
msgid "Acknowledgements"
msgstr "Kiitokset"
#: lazarusidestrconsts:lislazbuildaboaction
msgid "Action"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr ""
#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Salli etsintäoperandit (mm * ja ?)"
#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Lisää"
#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "Lisätäänkö tiedosto %s projektiin?"
#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr ""
#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Lisää tiedosto"
#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr ""
#: lazarusidestrconsts:rsaddinverse
msgid "Add Inverse"
msgstr ""
#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr ""
#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr ""
#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr ""
#: lazarusidestrconsts:liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr ""
#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr ""
#: lazarusidestrconsts:dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Lisää := operaattori (saa arvokseen) "
#: lazarusidestrconsts:liskmaddbreakpoint
msgid "Add break point"
msgstr ""
#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr ""
#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Lisää koodilyhenne"
#: lazarusidestrconsts:lisadddirectory
msgid "Add directory"
msgstr ""
#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Lisää editorin tiedosto projektiin"
#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr "Lisää editorissa avoinna olevia tiedostoja"
#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr ""
#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Lisää tiedosto projektiin:"
#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr "Lisää tiedostoja"
#: lazarusidestrconsts:lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""
#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Lisää nämä tiedostot tähän projektiin tai pakettiin"
#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr ""
#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Lisää hyppy historia"
#: lazarusidestrconsts:liscodehelpaddlinkbutton
msgid "Add link"
msgstr ""
#: lazarusidestrconsts:lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr ""
#: lazarusidestrconsts:podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""
#: lazarusidestrconsts:liscodehelpaddpathbutton
msgid "Add path"
msgstr ""
#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr ""
#: lazarusidestrconsts:dlgaddsemicolon
msgid "Add semicolon"
msgstr "Lisää puolipiste"
#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr ""
#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr ""
#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr "Lisää projektiin"
#: lazarusidestrconsts:lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""
#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr ""
#: lazarusidestrconsts:liskmaddwatch
msgid "Add watch"
msgstr ""
#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr ""
#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr ""
#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr ""
#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr ""
#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Laajennetaan toiminta koskemaan myös näihin tiedostoihin (esim. /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts:rsadditionalinfo
msgid "Additional info"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr ""
#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr ""
#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr ""
#: lazarusidestrconsts:rslanguageafrikaans
msgid "Afrikaans"
msgstr "afrikaans"
#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Sijoittele"
#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr "Sijoita"
#: lazarusidestrconsts:lisemdall
msgid "All"
msgstr "Kaikki"
#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr "Kaikki tiedostot"
#: lazarusidestrconsts:lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Kaikki lohkorakenteet vaikuttavat hyviltä."
#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr ""
#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr ""
#: lazarusidestrconsts:lisedtdefsallprojects
msgid "All projects"
msgstr ""
#: lazarusidestrconsts:lisccotestssuccess
msgid "All tests succeeded."
msgstr ""
#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""
#: lazarusidestrconsts:lisallowfunctio
msgid "Allow Function Calls"
msgstr ""
#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr ""
#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr ""
#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr ""
#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr ""
#: lazarusidestrconsts:lisalternativekey
msgid "Alternative key"
msgstr ""
#: lazarusidestrconsts:lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts:srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr ""
#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr ""
#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Aina käännetään kaikki (vaikka mikään ei muuttunutkaan)"
#: lazarusidestrconsts:dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr ""
#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr ""
#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr ""
#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr ""
#: lazarusidestrconsts:lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""
#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Toiminta moniselitteisten tai epäselvien tiedostojen kanssa"
#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Epäselvä (tai moniselitteinen) tiedosto löytyi"
#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Epäselviä (tai moniselitteisiä) tiedostoja löytyi"
#: lazarusidestrconsts:lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Epäselvä (tai moniselitteinen) käännösyksikkö löytyi"
#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr ""
#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Virhe esiintyi kun avattiin projektia %s!%s%sAvataanko tämä projekti uudelleen?"
#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr ""
#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr ""
#: lazarusidestrconsts:lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr ""
#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr ""
#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Sovellus"
#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Sovelluksen asetukset"
#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Sovellus %sGraafinen lcl/freepascal ohjelma. Ohjelma tehdään Lazaruksella (Näistä suositeltavin vaihtoehto)."
#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr ""
#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr ""
#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr "arabia"
#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr ""
#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Normaali (aakkostus)"
#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Kysy"
#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Varmistetaan vielä erikseen että korvataanko kyseinen kohta"
#: lazarusidestrconsts:dlgcoasmstyle
msgid "Assembler style:"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr "At (@)"
#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Tekijä:"
#: lazarusidestrconsts:liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""
#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Luo myös uusi lomake kun avataan uusi käännösyksikkö"
#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr ""
#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Poista tiedosto automaattisesti"
#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr ""
#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr "Automaattinen sisennys"
#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr ""
#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr "Muunna nimi automaattisesti pienillä kirjaimilla kirjoitetuksi"
#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Automaattinen tallennus"
#: lazarusidestrconsts:lisautoshowobjectinspector
msgid "Auto show Object Inspector"
msgstr "Näytetään automaattisesti komponenttimuokkain"
#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaattisesti luotavat lomakkeet:"
#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr ""
#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "oletuskieli (tai englanti)"
#: lazarusidestrconsts:lisautomaticfeatures
msgid "Automatic features"
msgstr "Automaattiset ominaisuudet"
#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""
#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr ""
#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaattisesti asennettavat komponenttipaketit"
#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr ""
#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Käytettävissä olevat lomakkeet:"
#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr ""
#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr ""
#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr "Yksi taaksepäin"
#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr "Taustaväri"
#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Varmistus"
#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Varmuuskopiointi epäonnistui"
#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr ""
#: lazarusidestrconsts:dlgblockindent
msgid "Block indent"
msgstr ""
#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Lihavoitu"
#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Kirjainmerkki"
#: lazarusidestrconsts:lisborderspace
msgid "BorderSpace"
msgstr ""
#: lazarusidestrconsts:lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""
#: lazarusidestrconsts:lisbottom
msgid "Bottom"
msgstr ""
#: lazarusidestrconsts:lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr ""
#: lazarusidestrconsts:lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""
#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr ""
#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr "Alareunat"
#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr "Sulkeiden korostaminen"
#: lazarusidestrconsts:lisbreak
msgid "Break"
msgstr ""
#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""
#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Rivinvaihto"
#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Rivinvaihto ilman kursorinsiirtoa"
#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr ""
#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr ""
#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr ""
#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr ""
#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Selaa"
#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr ""
#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Käännä"
#: lazarusidestrconsts:lislazbuildqbobuildall
msgid "Build All"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr ""
#: lazarusidestrconsts:lisbfbuildcommand
msgid "Build Command"
msgstr ""
#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildide
msgid "Build IDE"
msgstr ""
#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""
#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr ""
#: lazarusidestrconsts:lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""
#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr ""
#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildoptions
msgid "Build Options"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr ""
#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Käännä kaikki"
#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""
#: lazarusidestrconsts:lislazbuildbuildexamples
msgid "Build examples"
msgstr ""
#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr ""
#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr ""
#: lazarusidestrconsts:liskmbuildprojectprogram
msgid "Build project/program"
msgstr ""
#: lazarusidestrconsts:rsbuild
msgid "Build:"
msgstr ""
#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr ""
#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr ""
#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr ""
#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr ""
#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr ""
#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr ""
#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr ""
#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""
#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Päätason komponenttia ei voida kopioida"
#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr ""
#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr ""
#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Peru"
#: lazarusidestrconsts:liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr ""
#: lazarusidestrconsts:liscancelloadingunit
msgid "Cancel loading unit"
msgstr ""
#: lazarusidestrconsts:liscancelrenaming
msgid "Cancel renaming"
msgstr "Perutaan uudelleen nimeäminen"
#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr ""
#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Kirjaimen koolla ei väliä"
#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "katalaani"
#: lazarusidestrconsts:liscecategories
msgid "Categories"
msgstr ""
#: lazarusidestrconsts:listtodolcategory
msgid "Category"
msgstr ""
#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr ""
#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr ""
#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr ""
#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr "Keskelle ikkunaa"
#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr "Keskilinjat"
#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Muuta"
#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr ""
#: lazarusidestrconsts:lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""
#: lazarusidestrconsts:lischangeencoding
msgid "Change Encoding"
msgstr ""
#: lazarusidestrconsts:lisplistchangefont
msgid "Change Font"
msgstr ""
#: lazarusidestrconsts:lischangefile
msgid "Change file"
msgstr "Muunna tiedosto"
#: lazarusidestrconsts:lischangeparent
msgid "Change parent ..."
msgstr ""
#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Muuttuneet tiedostot:"
#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr ""
#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr ""
#: lazarusidestrconsts:lischaracter
msgid "Character"
msgstr ""
#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr ""
#: lazarusidestrconsts:rscharacterset
msgid "Character set:"
msgstr ""
#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr ""
#: lazarusidestrconsts:lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr ""
#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Tarkista yksikäsitteisyys"
#: lazarusidestrconsts:dlgccocaption
msgid "Checking compiler options"
msgstr ""
#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr ""
#: lazarusidestrconsts:rslanguagechinese
msgid "Chinese"
msgstr "kiina"
#: lazarusidestrconsts:lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""
#: lazarusidestrconsts:lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""
#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr ""
#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr ""
#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr ""
#: lazarusidestrconsts:liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""
#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Valitse Lazarus:n kansio"
#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr ""
#: lazarusidestrconsts:lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""
#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr ""
#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Valitse toisenlainen nimi"
#: lazarusidestrconsts:lischooseakey
msgid "Choose a key ..."
msgstr ""
#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Valitse koodilyhennetiedosto (*.dci)"
#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Valitse kääntäjän tiedostonimi (%s)"
#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr ""
#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr ""
#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr "Valitse make-työkalun hakupolku"
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden tiedoston"
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden komponenttipaketin"
#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Valitse jokin alla olevista kohteista saadaksesi aikaan uuden ohjelmointiprojektin"
#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""
#: lazarusidestrconsts:lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""
#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Valitse ohjelman lähdekoodi (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Lisää, alla olevasta listasta valittu, rakenne. Valitun lohkon ympärille"
#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Valitse kansio testiprojekteihin"
#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr ""
#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Luokkaa (Class) %s%s%s ei löydy."
#: lazarusidestrconsts:lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr ""
#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""
#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr ""
#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr ""
#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr ""
#: lazarusidestrconsts:liskmclassic
msgid "Classic"
msgstr ""
#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr "Ylimääräisten tiedostojen poisto"
#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr ""
#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""
#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr ""
#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory ..."
msgstr "Ylimääräisten tiedostojen poisto ..."
#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Poista tiedostot myös alikansioista"
#: lazarusidestrconsts:liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Poistetaanko käännösyksikön tiedostopolku?"
#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr ""
#: lazarusidestrconsts:lisuidclear
msgid "Clear"
msgstr "Tyhjennä"
#: lazarusidestrconsts:liscleardirectory
msgid "Clear Directory?"
msgstr ""
#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr ""
#: lazarusidestrconsts:lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr ""
#: lazarusidestrconsts:lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klikkaa jotain ylläolevaa kohtaa nähdäksesi muuttuneet kohdat"
#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Sulje"
#: lazarusidestrconsts:liskmcloseall
msgid "Close All"
msgstr "Sulje kaikki"
#: lazarusidestrconsts:lismenucloseproject
msgid "Close Project"
msgstr "Sulje projekti"
#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Sulje kaikki editorin tiedostot"
#: lazarusidestrconsts:lissrclosepage
msgid "Close page"
msgstr "Sulje välilehti"
#: lazarusidestrconsts:liskmcloseproject
msgid "Close project"
msgstr "Sulje projekti"
#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr ""
#: lazarusidestrconsts:lismenuviewcodebrowser
msgid "Code Browser"
msgstr ""
#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr ""
#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr ""
#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Koodilyhenteet ..."
#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr ""
#: lazarusidestrconsts:liscodebrowser
msgid "Code browser"
msgstr ""
#: lazarusidestrconsts:dlgusecodefolding
msgid "Code folding"
msgstr "Koodin laskostus"
#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr ""
#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr ""
#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Koodilyhenteet"
#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr ""
#: lazarusidestrconsts:liscodetools
msgid "CodeTools"
msgstr ""
#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr ""
#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr ""
#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr ""
#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr ""
#: lazarusidestrconsts:liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""
#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr ""
#: lazarusidestrconsts:liskmcodetoolsoptions
msgid "CodeTools options"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr ""
#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr ""
#: lazarusidestrconsts:liscollapseallclasses
msgid "Collapse all classes"
msgstr ""
#: lazarusidestrconsts:liscollapseallpackages
msgid "Collapse all packages"
msgstr ""
#: lazarusidestrconsts:liscollapseallunits
msgid "Collapse all units"
msgstr ""
#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Kaksoispiste (:)"
#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Väri"
#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme"
msgstr "Värikaavio"
#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Värit"
#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Pilkku (,)"
#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr ""
#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr ""
#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr ""
#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Komentojen komennot"
#: lazarusidestrconsts:dlgcommandlineparameters
msgid "Command line parameters"
msgstr ""
#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Komentorivin parametrit (ilman ohjelman omaa nimeä)"
#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr ""
#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Komento:"
#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Laita lohko kommentiksi (//)"
#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Kommentti:"
#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr ""
#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Käännä"
#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr ""
#: lazarusidestrconsts:lisinfobuildcaption
msgid "Compile Project"
msgstr "Tietoja projektin käännöksestä"
#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr ""
#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Kääntää komponenttipaketin"
#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr ""
#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr ""
#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr ""
#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Kääntäjän optiot ..."
#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr ""
#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Kääntäjän optiot projektissa: %s"
#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr ""
#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr ""
#: lazarusidestrconsts:liskmcompileroptions
msgid "Compiler options"
msgstr ""
#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "FreePascal kääntäjä (%s) löytyy tästä polusta/linkistä"
#: lazarusidestrconsts:lisinfobuildcomplile
msgid "Compiling..."
msgstr "Käännetään..."
#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Täydennä koodia"
#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr "Täydennä koodia"
#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr ""
#: lazarusidestrconsts:liscomponent
msgid "Component"
msgstr ""
#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr ""
#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr ""
#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Komponentin nimi (name) %s%s%s ei ole sallittu tunnus"
#: lazarusidestrconsts:lisfpcomponents
msgid "Components"
msgstr "Komponentit"
#: lazarusidestrconsts:liscondition
msgid "Condition"
msgstr ""
#: lazarusidestrconsts:rsconditionaldefines
msgid "Conditional defines"
msgstr ""
#: lazarusidestrconsts:liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr ""
#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr ""
#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""
#: lazarusidestrconsts:lisconfigurebuild
msgid "Configure Build %s"
msgstr ""
#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr ""
#: lazarusidestrconsts:liskmconfigurehelp
msgid "Configure Help"
msgstr ""
#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Ohjeen asetukset ..."
#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr ""
#: lazarusidestrconsts:liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr ""
#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr ""
#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr ""
#: lazarusidestrconsts:liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr ""
#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr ""
#: lazarusidestrconsts:lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr ""
#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr "Vahvista seuraavat muutokset"
#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Vahvista riippuvuuden poistaminen"
#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Vahvista uusi komponettipakettien joukko kehitysympäristöön"
#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Vahvista tiedoston poistaminen"
#: lazarusidestrconsts:liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""
#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr ""
#: lazarusidestrconsts:lispeconflictfound
msgid "Conflict found"
msgstr ""
#: lazarusidestrconsts:lisconsoleapplication
msgid "Console application"
msgstr "Komentorivisovellus"
#: lazarusidestrconsts:lisceconstants
msgid "Constants"
msgstr ""
#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr ""
#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr ""
#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr ""
#: lazarusidestrconsts:liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr ""
#: lazarusidestrconsts:liscontinue
msgid "Continue"
msgstr "Jatka"
#: lazarusidestrconsts:liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr ""
#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr "Tekijät"
#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr ""
#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr ""
#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr ""
#: lazarusidestrconsts:liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "Muunna tiedosto: DFM -> LFM ..."
#: lazarusidestrconsts:lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Muunna Delphi-projektista"
#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Muunna tiedosto: DPK -> LPK ..."
#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Muunna tiedosto: DPR -> LPR ..."
#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Muunna tiedosto: Delphi unit -> Lazarus unit ..."
#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr ""
#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr ""
#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Kopioi"
#: lazarusidestrconsts:liscopyall
msgid "Copy All"
msgstr ""
#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr ""
#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr "Kopio kaikki kääntäjän viestit sisältäen myös piilotetut viestit leikepöydälle"
#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Kopio kaikki kääntäjän viestit leikepöydälle"
#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr ""
#: lazarusidestrconsts:uemcopyfilename
msgid "Copy filename"
msgstr "Kopio tiedoston nimi leikepöydälle"
#: lazarusidestrconsts:lisldcopyfrominherited
msgid "Copy from inherited"
msgstr ""
#: lazarusidestrconsts:lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Kopio aliohjelman (/funktion/metodin...) nimi leikepöydälle"
#: lazarusidestrconsts:lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""
#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr ""
#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kopio valitut kääntäjän viestit leikepöydälle"
#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kopio valittu leikepöydälle"
#: lazarusidestrconsts:lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Kopio versiotieto leikepöydälle"
#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Valitse kopioinnissa kursorin osoittama sana jos muuta ei ole valittu"
#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kokonaisen lomakkeen (form) kopioiti ei ole tuettuna."
#: lazarusidestrconsts:rscopyright
msgid "Copyright:"
msgstr ""
#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Lisätään laskijanumero (.pp;1)"
#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr "Luo"
#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr ""
#: lazarusidestrconsts:dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr ""
#: lazarusidestrconsts:lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""
#: lazarusidestrconsts:dlgcocreatemakefile
msgid "Create Makefile"
msgstr ""
#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Luo alivalikko"
#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Tee uusi tyhjä tekstitiedosto (*.txt)."
#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Luo uusi graafinen sovellus.%sOhjelma tehdään ja ylläpidetään Lazaruksella."
#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Tee uusi pascal käännösyksikkö (unit)"
#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Tee uusi ohjelma"
#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr ""
#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr "Luo uusi projekti"
#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Tee uusi standardi paketti.%sPaketti on kokoelma käännösyksiköitä ja komponentteja. Soveltuu pitkälle ehtineille käyttäjille."
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Tee uusi unit ja lomake (LCL form)"
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr ""
#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame"
msgstr ""
#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr ""
#: lazarusidestrconsts:liscreatedirectory
msgid "Create directory?"
msgstr ""
#: lazarusidestrconsts:liscodehelpcreatebutton
msgid "Create help item"
msgstr ""
#: lazarusidestrconsts:liscreateit
msgid "Create it"
msgstr ""
#: lazarusidestrconsts:rscreatenewdefine
msgid "Create new define"
msgstr ""
#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr ""
#: lazarusidestrconsts:liscreatenewproject
msgid "Create new project"
msgstr "Luodaan uusi projekti"
#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Luonti"
#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr ""
#: lazarusidestrconsts:liscurrent
msgid "Current"
msgstr ""
#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr ""
#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr ""
#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Päivämäärä ja aika"
#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Käyttäjätunnus"
#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr ""
#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr ""
#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""
#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Kursorin siirtokomennot"
#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr ""
#: lazarusidestrconsts:dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""
#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr ""
#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr ""
#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Erikoisohjelma%sFreepascal ohjelma."
#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr ""
#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr ""
#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr ""
#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr ""
#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr ""
#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Leikkaa"
#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr ""
#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Leikkaa valittu leikepöydälle"
#: lazarusidestrconsts:liswldisableall
msgid "D&isable All"
msgstr ""
#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr ""
#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr "Olla peräisin"
#: lazarusidestrconsts:liswldeleteall
msgid "De&lete All"
msgstr ""
#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Virheenjäljitys"
#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr ""
#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr ""
#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Virheenjäljittimen asetukset ..."
#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr ""
#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr ""
#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr ""
#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr ""
#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr ""
#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr ""
#: lazarusidestrconsts:lisdecimal
msgid "Decimal"
msgstr ""
#: lazarusidestrconsts:dlgassemblerdefault
msgid "Default"
msgstr ""
#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Editorin oletuskirjasin"
#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Oletuksena käytettävä Pascal-kielen tiedostopääte"
#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr "Oletusarvo"
#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr ""
#: lazarusidestrconsts:lisctdefdefinetemplates
msgid "Define templates"
msgstr ""
#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Viive"
#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr ""
#: lazarusidestrconsts:lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""
#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr ""
#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Poista valikon kohta"
#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Poista edellinen kirjain"
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""
#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Poistetaanko kaikki nämä tiedostot?"
#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""
#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Poista kursorin osoittama kirjain"
#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr ""
#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Poistetaanko riippuvuus %s :n ?"
#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr ""
#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr ""
#: lazarusidestrconsts:liskmdeletelastchar
msgid "Delete last char"
msgstr ""
#: lazarusidestrconsts:liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr ""
#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Poistetaanko %s%s%s-niminen vanha fiedosto?"
#: lazarusidestrconsts:lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Poistetaanko vanha tiedosto?"
#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""
#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Poista valittu"
#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr "Poistetaanko koodilyhenne "
#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr ""
#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Poista kirjaimet kursorin osoittamasta paikasta rivin loppuun asti"
#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Poista seuraava sana"
#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Poista edellinen sana"
#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr ""
#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr ""
#: lazarusidestrconsts:lisdelphi
msgid "Delphi"
msgstr ""
#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr ""
#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr ""
#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr ""
#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr ""
#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""
#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr ""
#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr ""
#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "Käänteinen (aakkostus)"
#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Kuvaus"
#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr ""
#: lazarusidestrconsts:lisoipdescription
msgid "Description: "
msgstr ""
#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr ""
#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr ""
#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr ""
#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Työpöytä"
#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Työpöytätiedostot"
#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr ""
#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr ""
#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr ""
#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Eroavuudet"
#: lazarusidestrconsts:liskmdiffeditorfiles
msgid "Diff editor files"
msgstr ""
#: lazarusidestrconsts:lisdigits
msgid "Digits:"
msgstr ""
#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Suunta"
#: lazarusidestrconsts:lisdirectives
msgid "Directives"
msgstr "Ohjeet kääntäjälle"
#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Kansio"
#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr ""
#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Kansio jossa käännetään testiprojektit"
#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Kansiota ei löytynyt"
#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Kansion lisäasetukset"
#: lazarusidestrconsts:lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""
#: lazarusidestrconsts:lisdisablegroup
msgid "Disable Group"
msgstr ""
#: lazarusidestrconsts:lisdisabled
msgid "Disabled"
msgstr ""
#: lazarusidestrconsts:lisdiscardchanges
msgid "Discard changes"
msgstr "Hylkää muutokset"
#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Näkymä"
#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr ""
#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr ""
#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Erottelee pienet ja isot kirjaimet (esim. A ja a )"
#: lazarusidestrconsts:dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr ""
#: lazarusidestrconsts:lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Ei sittenkään suljeta Lazarusta"
#: lazarusidestrconsts:lisdonotclosetheproject
msgid "Do not close the project"
msgstr ""
#: lazarusidestrconsts:lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr ""
#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr ""
#: lazarusidestrconsts:lisuedonotsho
msgid "Do not show this message again."
msgstr "Älä näytä tätä viestiä uudelleen"
#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Riviä ei katkaista kun sitä seuraa:"
#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Riviä ei katkaista kun sitä edellä oli:"
#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr ""
#: lazarusidestrconsts:lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr "Haluatteko uudelleen muodostaa (eli kääntää) Lazaruksen?"
#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr ""
#: lazarusidestrconsts:lismvdocking
msgid "Docking"
msgstr ""
#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr ""
#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr "Lajittelu peruste"
#: lazarusidestrconsts:listodoldone
msgid "Done"
msgstr ""
#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Kaksoisklikkaus valitsee koko rivin"
#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr ""
#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr "Alas"
#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr ""
#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr ""
#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr ""
#: lazarusidestrconsts:rslanguagedutch
msgid "Dutch"
msgstr "hollanti"
#: lazarusidestrconsts:liswlenableall
msgid "E&nable All"
msgstr ""
#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "Käyttöliittymä"
#: lazarusidestrconsts:lisccoerrormsg
msgid "ERROR: "
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Muokkaa"
#: lazarusidestrconsts:liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr ""
#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr ""
#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Muokkaa näppäinten merkityksiä"
#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr ""
#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr ""
#: lazarusidestrconsts:lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""
#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Muokkaa koodilyhenteitä"
#: lazarusidestrconsts:lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr ""
#: lazarusidestrconsts:liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr ""
#: lazarusidestrconsts:liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""
#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys of command"
msgstr ""
#: lazarusidestrconsts:lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr ""
#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr ""
#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr ""
#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Editorin käyttämä kirjasin"
#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Editorin käyttämän kirjasimen koko"
#: lazarusidestrconsts:liskmeditoroptions
msgid "Editor options"
msgstr ""
#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options ..."
msgstr "Editorin asetukset ..."
#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "Editorin asetukset"
#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr ""
#: lazarusidestrconsts:lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Tyhjät metodit (luokan tyhjät aliohjelmarungot)"
#: lazarusidestrconsts:lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""
#: lazarusidestrconsts:lisenablegroup
msgid "Enable Group"
msgstr ""
#: lazarusidestrconsts:lisenablemacros
msgid "Enable Macros"
msgstr ""
#: lazarusidestrconsts:rsenablei18n
msgid "Enable i18n"
msgstr ""
#: lazarusidestrconsts:lisenabled
msgid "Enabled"
msgstr ""
#: lazarusidestrconsts:lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""
#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr "Lisää lauserakenne"
#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr "Lauserakenteen lisäys"
#: lazarusidestrconsts:liskmencloseselection
msgid "Enclose selection"
msgstr ""
#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Lauserakenteen lisäys ..."
#: lazarusidestrconsts:uemencoding
msgid "Encoding"
msgstr "Merkistön koodaus"
#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Merkistö on tiedostossa %s%s%s%skoodattu %s-koodauksella. Muunnetaanko tiedoston uudeksi merkistön koodaukseksi %s."
#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "englanti"
#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr ""
#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr ""
#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr ""
#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "Käyttöympäristö"
#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Käyttöliittymä valikon komennot"
#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options ..."
msgstr "Käyttöliittymän asetukset ..."
#: lazarusidestrconsts:lisccoerrorcaption
msgid "Error"
msgstr "Virhe"
#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr ""
#: lazarusidestrconsts:lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr ""
#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr ""
#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr ""
#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr ""
#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr ""
#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr ""
#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorloadingfile
msgid "Error loading file"
msgstr ""
#: lazarusidestrconsts:lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr ""
#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr "Virhe siirrettäessä komponenttia"
#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Virhe siirrettäessä %s:%s komponenttia"
#: lazarusidestrconsts:lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""
#: lazarusidestrconsts:liserroropeningcomponent
msgid "Error opening component"
msgstr ""
#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Virhe luettaessa %s%s%s%s%s"
#: lazarusidestrconsts:liserrorreadingxml
msgid "Error reading XML"
msgstr ""
#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr ""
#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr ""
#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr ""
#: lazarusidestrconsts:liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lislazbuilderrorwritingfile
msgid "Error writing file"
msgstr ""
#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisinfobuilderror
msgid "Error..."
msgstr ""
#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "Virhe: "
#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Virhe: toimimaton kääntäjä: %s"
#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "Virheet"
#: lazarusidestrconsts:lisinfobuilderrors
msgid "Errors:"
msgstr "Virheitä:"
#: lazarusidestrconsts:liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr ""
#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr ""
#: lazarusidestrconsts:liseverynthlinenumber
msgid "Every n-th line number:"
msgstr ""
#: lazarusidestrconsts:liscodehelpexampletag
msgid "Example"
msgstr ""
#: lazarusidestrconsts:lisexamples
msgid "Examples"
msgstr ""
#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""
#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr ""
#: lazarusidestrconsts:lisexcludefilter2
msgid "Exclude filter"
msgstr ""
#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr ""
#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr ""
#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr ""
#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command before"
msgstr ""
#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr ""
#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr ""
#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Ohjelman suoritus on pysäytetty"
#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Ohjelman suoritus on pysäytetty%s"
#: lazarusidestrconsts:lispldexists
msgid "Exists"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Lopeta"
#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr ""
#: lazarusidestrconsts:lisexpandallclasses
msgid "Expand all classes"
msgstr ""
#: lazarusidestrconsts:lisexpandallpackages
msgid "Expand all packages"
msgstr ""
#: lazarusidestrconsts:lisexpandallunits
msgid "Expand all units"
msgstr ""
#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr ""
#: lazarusidestrconsts:lisexport
msgid "Export ..."
msgstr ""
#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr ""
#: lazarusidestrconsts:lisiecoexportfileexists
msgid "Export file exists"
msgstr ""
#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr ""
#: lazarusidestrconsts:liswlexpression
msgid "Expression"
msgstr ""
#: lazarusidestrconsts:lisexpression
msgid "Expression:"
msgstr ""
#: lazarusidestrconsts:lisextendunitpath
msgid "Extend unit path?"
msgstr "Laajennetaanko käännösyksikön tiedostopolkua?"
#: lazarusidestrconsts:liskmexternaltoolssettings
msgid "External Tools settings"
msgstr ""
#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr ""
#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External tools"
msgstr ""
#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr ""
#: lazarusidestrconsts:dlgextracharspacing
msgid "Extra char spacing"
msgstr ""
#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Lisäpikselien määrä rivien välissä (tekstin erottaminen helpottuu)"
#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr "Tee aliohjelma"
#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr "Tee valitusta lohkosta aliohjelma"
#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr "Tee valitusta lohkosta aliohjelma"
#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure ..."
msgstr "Tee valitusta lohkosta aliohjelma ..."
#: lazarusidestrconsts:lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr ""
#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr ""
#: lazarusidestrconsts:lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""
#: lazarusidestrconsts:lisfpcversion
msgid "FPC Version: "
msgstr ""
#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC:n (FreePascal:n) lähdekoodin kansio"
#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "FPC:n (FreePascal:n) lähdekoodin kansiota \"%s\" ei löytynyt."
#: lazarusidestrconsts:lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""
#: lazarusidestrconsts:lismenufpdoceditor
msgid "FPDoc Editor"
msgstr ""
#: lazarusidestrconsts:lisfpdoceditor
msgid "FPDoc editor"
msgstr ""
#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
msgid "FPDoc files path"
msgstr ""
#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr ""
#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr ""
#: lazarusidestrconsts:lismenutemplatefile
msgid "File"
msgstr "Tiedosto"
#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr ""
#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Tiedosto %s%s%s on muuttunut. Tallennetaanko se?"
#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Tiedostoa %s%s%s ei löytynyt."
#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Tiedostoa %s%s%s ei löytynyt.%s"
#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Tiedostoa %s%s%s ei löytynyt.%sHaluatko luoda sen?%s"
#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Tiedosto %s%s%s%s ei näyttäisi olevan tekstitiedosto.%s Yritetäänkö se silti avata?"
#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr ""
#: lazarusidestrconsts:lisfilesettings
msgid "File Settings ..."
msgstr "Tiedoston asetukset ..."
#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr ""
#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr ""
#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr ""
#: lazarusidestrconsts:lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""
#: lazarusidestrconsts:dlgfileexts
msgid "File extensions"
msgstr "Tiedostopäätteet"
#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr ""
#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Tiedosto on jo projektissa"
#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr "Tiedoston tallentaminen ei onnistunut"
#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "Tiedosto on vain luettavissa"
#: lazarusidestrconsts:lisfileissymlink
msgid "File is symlink"
msgstr ""
#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr ""
#: lazarusidestrconsts:lisfilelinkerror
msgid "File link error"
msgstr ""
#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Tiedostojen suodatus/maskaus (*;*.*;*.bak?)"
#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Tiedostovalikon komennot"
#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr ""
#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr ""
#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Tiedostoa ei löytynyt"
#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr ""
#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "Tiedosto ei ole tekstitiedosto"
#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Tiedosto ei ole Pascal:n käännösyksikkö (unit)"
#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Tiedoston nimi"
#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr ""
#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr ""
#: lazarusidestrconsts:lisfilenameaddress
msgid "Filename/Address"
msgstr ""
#: lazarusidestrconsts:lispefilename
msgid "Filename:"
msgstr "Tiedostonimi:"
#: lazarusidestrconsts:lisoipfilename
msgid "Filename: %s"
msgstr "Tiedostonimi: %s"
#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Tiedostot"
#: lazarusidestrconsts:lisfilter
msgid "Filter"
msgstr ""
#: lazarusidestrconsts:lisplistfilterany
msgid "Filter by matching any part of method"
msgstr ""
#: lazarusidestrconsts:lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr ""
#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Etsi"
#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Etsi &Seuraava"
#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "Etsi &Edellinen"
#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files ..."
msgstr "Etsi tiedostoista ..."
#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Etsi kohdistimen osoittaman kohdan määrittely"
#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Etsi tunnisteiden nimiä"
#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Etsi tunnisteiden nimiä ..."
#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr "Etsi seuraava"
#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr "Etsi tunnisteet"
#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr ""
#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr ""
#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Etsi koodilohkon alku"
#: lazarusidestrconsts:liscomppalfindcomponent
msgid "Find component"
msgstr "Etsi komponentti"
#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Etsi määrittely"
#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Etsi tunnisteiden nimiä"
#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Etsi tiedostoista"
#: lazarusidestrconsts:liskmfindincremental
msgid "Find incremental"
msgstr ""
#: lazarusidestrconsts:lisfindkeycombination
msgid "Find key combination"
msgstr ""
#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Etsi seuraava"
#: lazarusidestrconsts:srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Etsi sanan seuraava esiintymiskohta"
#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Etsi tai vaihda tunnisteiden nimiä"
#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Mene koodilohkon toiseen päähän (begin <-> end)"
#: lazarusidestrconsts:lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Etsi komponenttipaletista komponentti"
#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Etsi edellinen"
#: lazarusidestrconsts:srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Etsi sanan edellinen esiintymiskohta"
#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr ""
#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr ""
#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr ""
#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Etsi oletuksena kursorin osoittamaa tekstiä"
#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "suomi"
#: lazarusidestrconsts:lispefixfilescase
msgid "Fix Files Case"
msgstr ""
#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr "LFM tiedoston korjaus"
#: lazarusidestrconsts:lisfloatingpoin
msgid "Floating Point"
msgstr ""
#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""
#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr ""
#: lazarusidestrconsts:liscefollowcursor
msgid "Follow cursor"
msgstr ""
#: lazarusidestrconsts:lisuefontwith
msgid "Font without UTF-8"
msgstr ""
#: lazarusidestrconsts:lisforcerenaming
msgid "Force renaming"
msgstr "Kaikesta huolimatta nimetään näin"
#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Kirjaimien väri"
#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Lomake-editori"
#: lazarusidestrconsts:rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr ""
#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr ""
#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr ""
#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Lomakkeet"
#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Lomakkeet..."
#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Eteenpäin"
#: lazarusidestrconsts:lisvsrforwardsearch
msgid "Forward Search"
msgstr "Eteenpäin"
#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr "Yksi eteenpäin"
#: lazarusidestrconsts:lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Löydetyt tyhjät metodit:"
#: lazarusidestrconsts:lisfreepascal
msgid "Free Pascal"
msgstr ""
#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr ""
#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr ""
#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "ranska"
#: lazarusidestrconsts:lisfunction
msgid "Function"
msgstr ""
#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr ""
#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr ""
#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr ""
#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr ""
#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr ""
#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Yleistä"
#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr ""
#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr ""
#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr ""
#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr ""
#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr ""
#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr ""
#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr ""
#: lazarusidestrconsts:rslanguagegerman
msgid "German"
msgstr "saksa"
#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Hae sijainti"
#: lazarusidestrconsts:lispldglobal
msgid "Global"
msgstr ""
#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr ""
#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr ""
#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr ""
#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Siirry riville"
#: lazarusidestrconsts:liskmgotomarker0
msgid "Go to marker 0"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker1
msgid "Go to marker 1"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker2
msgid "Go to marker 2"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker3
msgid "Go to marker 3"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker4
msgid "Go to marker 4"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker5
msgid "Go to marker 5"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker6
msgid "Go to marker 6"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker7
msgid "Go to marker 7"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker8
msgid "Go to marker 8"
msgstr ""
#: lazarusidestrconsts:liskmgotomarker9
msgid "Go to marker 9"
msgstr ""
#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr ""
#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Mene seuraavalle välilehdelle"
#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Mene edelliselle välilehdelle"
#: lazarusidestrconsts:liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr ""
#: lazarusidestrconsts:liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr ""
#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr ""
#: lazarusidestrconsts:listodogoto
msgid "Goto"
msgstr "Mene"
#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr ""
#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr ""
#: lazarusidestrconsts:lismenugotoline
msgid "Goto line ..."
msgstr "Hyppää riville ..."
#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Hyppää riville :"
#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr ""
#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr ""
#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Mene valitun kohdan osoittamalle lähdekoodiriville"
#: lazarusidestrconsts:srkmgrabkey
msgid "Grab key"
msgstr ""
#: lazarusidestrconsts:srkmgrabsecondkey
msgid "Grab second key"
msgstr ""
#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Valitun komponentin (tai valinta-alueen) ilmaiseminen"
#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Apupisteet"
#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Apupisteiden väri"
#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Apupisteiden väli X"
#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Apupisteiden väli Y"
#: lazarusidestrconsts:lisgroup
msgid "Group"
msgstr ""
#: lazarusidestrconsts:dlggroupundo
msgid "Group Undo"
msgstr ""
#: lazarusidestrconsts:lisgrowtolarges
msgid "Grow to Largest"
msgstr ""
#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr ""
#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr ""
#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr ""
#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Kohdistusviivat"
#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Reunuksen väri"
#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Reunuksen leveys"
#: lazarusidestrconsts:lisccohintmsg
msgid "HINT: "
msgstr ""
#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr "Vain puolen sivun liikutus (scrollaus) (PageUp- & PageDown-näppäimillä)"
#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Käsittele kohdan OnClick-tapahtuma"
#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr ""
#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr ""
#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr ""
#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr ""
#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr "heprea"
#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Korkeus:"
#: lazarusidestrconsts:lispckedithelp
msgid "Help"
msgstr "Ohje"
#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr "Ohjeen asetukset"
#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr ""
#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Ohjevalikon komennot"
#: lazarusidestrconsts:lishelpselectordialog
msgid "Help selector"
msgstr "Ohjeen valinta"
#: lazarusidestrconsts:lishexadecimal
msgid "Hexadecimal"
msgstr ""
#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Pienennä Lazaruksen käyttöliittymä ohjelmaa suorittaessa "
#: lazarusidestrconsts:uemhighlighter
msgid "Highlighter"
msgstr "Syntaksin korostus"
#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Vihje: Tarkista sisältääkö kaksi eri komponenttipakettia käännösyksikön samalla nimellä."
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr ""
#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr ""
#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Vihje: Klikkaa komentoa jota haluat muuttaa"
#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Vihje: voitte asettaa kääntäjän halupolun Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehdessä"
#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Vihjetekstit komponenttipaletille"
#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Vihjetekstit työkalupainikkeille"
#: lazarusidestrconsts:lisinfobuildhint
msgid "Hints:"
msgstr "Vihjeitä:"
#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home-näppäin siirtyy koodirivin alkuun sisennykset huomioiden"
#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr "Vaakasuunta"
#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Apupisteiden välinen etäisyys vaakasuunnassa"
#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr ""
#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmid
msgid "ID"
msgstr ""
#: lazarusidestrconsts:liside
msgid "IDE"
msgstr ""
#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr ""
#: lazarusidestrconsts:lisideintf
msgid "IDE Interface"
msgstr ""
#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr ""
#: lazarusidestrconsts:lismenuideinternals
msgid "IDE internals"
msgstr ""
#: lazarusidestrconsts:lissamideisbusy
msgid "IDE is busy"
msgstr ""
#: lazarusidestrconsts:uepins
msgid "INS"
msgstr "Lisää"
#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Tunniste (mm muuttuja)"
#: lazarusidestrconsts:lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr ""
#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Koodin täydentäminen"
#: lazarusidestrconsts:lisidentifiercontains
msgid "Identifier contains ..."
msgstr ""
#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier length:"
msgstr ""
#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr ""
#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr ""
#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr "Tunniste on: %s"
#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr ""
#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr ""
#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Ohita"
#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Jätä välilyönnit huomiotta"
#: lazarusidestrconsts:lisignoreall
msgid "Ignore all"
msgstr "Ohita kaikki"
#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Jätä huomiotta välilyöntien määrä merkkien välissä "
#: lazarusidestrconsts:lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""
#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr ""
#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr ""
#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Jätä huomiotta erilaiset rivinloppumerkinnät (esim. #10 = #13#10)"
#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Jätä huomiotta tallennetun version muutokset"
#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Jätä huomiotta tyhjät rivit"
#: lazarusidestrconsts:lisignoremissingfile
msgid "Ignore missing file"
msgstr "Jätä huomiotta puuttuva tiedosto"
#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Jätä välilyönnit huomiotta (ei koske tyhjiä rivejä)"
#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Jätä huomiotta välilyönnit rivin lopussa"
#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Jätä huomiotta välilyönnit rivin alussa"
#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr ""
#: lazarusidestrconsts:lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr ""
#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr ""
#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr ""
#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr ""
#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr ""
#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr ""
#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr ""
#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr ""
#: lazarusidestrconsts:rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr ""
#: lazarusidestrconsts:lisincludepaths
msgid "Include paths"
msgstr ""
#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Sisällytetään myös alikansiot "
#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr ""
#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr ""
#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Etsi kirjain kerrallaan"
#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr ""
#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr ""
#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Sisennä valittu lohko"
#: lazarusidestrconsts:lisindex
msgid "Index"
msgstr ""
#: lazarusidestrconsts:rslanguageindonesian
msgid "Indonesian"
msgstr "indonesia"
#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Tietoja %s tiedostosta"
#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""
#: lazarusidestrconsts:liscmplstinheritance
msgid "Inheritance"
msgstr ""
#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr ""
#: lazarusidestrconsts:lisinheriteditem
msgid "Inherited Item"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolinsert
msgid "Insert"
msgstr ""
#: lazarusidestrconsts:liskminsertifdef
msgid "Insert $IFDEF"
msgstr ""
#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Ehdollinen kääntäminen"
#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Aseta CVS:n avainsana Author"
#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Aseta CVS:n avainsana Date"
#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Aseta CVS:n avainsana Header"
#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Aseta CVS:n avainsana ID"
#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Aseta CVS:n avainsana Log"
#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Aseta CVS:n avainsana Name"
#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Aseta CVS:n avainsana Revision"
#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Aseta CVS:n avainsana Source"
#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Lisää valmiista malleista..."
#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr ""
#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr ""
#: lazarusidestrconsts:lisctinsertmacro
msgid "Insert Macro"
msgstr ""
#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr ""
#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Lisää uusi valikon kohta (jälkeen)"
#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Lisää uusi valikon kohta (eteen)"
#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr ""
#: lazarusidestrconsts:listddinserttodo
msgid "Insert ToDo"
msgstr ""
#: lazarusidestrconsts:ueminserttodo
msgid "Insert Todo"
msgstr "Lisää tehtävälista merkintä (ToDo)"
#: lazarusidestrconsts:srkmecinsertguid
msgid "Insert a GUID"
msgstr ""
#: lazarusidestrconsts:liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr ""
#: lazarusidestrconsts:liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""
#: lazarusidestrconsts:liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr ""
#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr ""
#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr ""
#: lazarusidestrconsts:liskminsertdateandtime
msgid "Insert date and time"
msgstr ""
#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Lisää merkkitaulukosta"
#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr ""
#: lazarusidestrconsts:liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr ""
#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr ""
#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""
#: lazarusidestrconsts:liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr ""
#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Lisää välilyönti seuraavien jälkeen"
#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Lisää välilyönti ennen seuraavia (merkkejä)"
#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Lisää seuraava teksti"
#: lazarusidestrconsts:liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr ""
#: lazarusidestrconsts:liskminsertusername
msgid "Insert username"
msgstr ""
#: lazarusidestrconsts:liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr ""
#: lazarusidestrconsts:liskminspect
msgid "Inspect"
msgstr ""
#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr ""
#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Asenna"
#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Asennetaan seuraavan käynnistyksen yhteydessä"
#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Asenna komponenttipaketti kehitysympäristöön"
#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr ""
#: lazarusidestrconsts:lisinstallationfailed
msgid "Installation failed"
msgstr "Asennus epäonnistui"
#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr ""
#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr ""
#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Asennettaessa komponettipaketti %s tullaan automaattisesti asentamaan paketit:"
#: lazarusidestrconsts:lisdebugoptionsfrminterface
msgid "Interface"
msgstr ""
#: lazarusidestrconsts:listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr ""
#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr ""
#: lazarusidestrconsts:lisinvalidoff
msgid "Invalid (Off)"
msgstr ""
#: lazarusidestrconsts:lisinvalidon
msgid "Invalid (On)"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr ""
#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Virheellinen kääntäjän tiedostonimi"
#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr ""
#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr ""
#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr ""
#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr ""
#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr ""
#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr ""
#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr ""
#: lazarusidestrconsts:lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr ""
#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr ""
#: lazarusidestrconsts:lisinvalidcircle
msgid "Invalid circle"
msgstr ""
#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr ""
#: lazarusidestrconsts:lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr ""
#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr ""
#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr ""
#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr ""
#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr ""
#: lazarusidestrconsts:lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Vääränlainen tiedoston tarkennin"
#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr ""
#: lazarusidestrconsts:lisinvalidfilter
msgid "Invalid filter"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr ""
#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr ""
#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr ""
#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr ""
#: lazarusidestrconsts:liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr ""
#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr ""
#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr ""
#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr "Vääränlainen aliohjelman nimi"
#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Vääränlainen projektitiedoston nimi"
#: lazarusidestrconsts:lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""
#: lazarusidestrconsts:lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""
#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr "Vääränlainen valinta"
#: lazarusidestrconsts:lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr ""
#: lazarusidestrconsts:lispeinvalidunitname
msgid "Invalid unitname"
msgstr ""
#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr ""
#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr ""
#: lazarusidestrconsts:dlgedinvert
msgid "Invert"
msgstr ""
#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr "Käännä sijoitus päinvastaiseksi"
#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""
#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "italia"
#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Kursivoitu"
#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Rivin korkeus"
#: lazarusidestrconsts:lisjitform
msgid "JIT Form"
msgstr ""
#: lazarusidestrconsts:rslanguagejapanese
msgid "Japanese"
msgstr "japani"
#: lazarusidestrconsts:lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Mene valittuun aliohjelmaan,funktioon..."
#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Hyppää takaisin"
#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Hyppää eteenpäin"
#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr "Hyppää"
#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Mene seuraavaan kirjainmerkkiin"
#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr ""
#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Mene edelliseen kirjainmerkkiin"
#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr ""
#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr ""
#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Säilytä kaikki tekstitiedostot"
#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""
#: lazarusidestrconsts:dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""
#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Säilytettävien tiedostojen tiedostopäätteet"
#: lazarusidestrconsts:liskeepname
msgid "Keep name"
msgstr "Hyväksy nimi tälläisenään"
#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr ""
#: lazarusidestrconsts:liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Pidä ne ja jatka"
#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr ""
#: lazarusidestrconsts:liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""
#: lazarusidestrconsts:srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Näppäin (tai näppäinpainallusten yhdistelmä)"
#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr ""
#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Näppäinkomennot"
#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr ""
#: lazarusidestrconsts:liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr ""
#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr ""
#: lazarusidestrconsts:lislcl
msgid "LCL"
msgstr ""
#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr ""
#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr ""
#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr ""
#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr ""
#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "LFM tiedosto"
#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr ""
#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr ""
#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr ""
#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Kieli"
#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr ""
#: lazarusidestrconsts:rslanguageoptions
msgid "Language options"
msgstr ""
#: lazarusidestrconsts:rslanguageselection
msgid "Language selection:"
msgstr ""
#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr ""
#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr ""
#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr ""
#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr ""
#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr ""
#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr ""
#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr ""
#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr ""
#: lazarusidestrconsts:lislazaruside
msgid "Lazarus IDE"
msgstr ""
#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr ""
#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr ""
#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr ""
#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus:n kansio (oletuksena kaikissa projekteissa)"
#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Lazarus:n kansiota \"%s\" ei löytynyt."
#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr ""
#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr ""
#: lazarusidestrconsts:lislazarusinclude
msgid "Lazarus include file"
msgstr ""
#: lazarusidestrconsts:lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr ""
#: lazarusidestrconsts:lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr ""
#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus komponenttipakettitiedostot"
#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr ""
#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr ""
#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr ""
#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr ""
#: lazarusidestrconsts:lisleft
msgid "Left"
msgstr ""
#: lazarusidestrconsts:lisleftgroupboxcaption
msgid "Left anchoring"
msgstr ""
#: lazarusidestrconsts:lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""
#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr "Vasemmat reunat"
#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr ""
#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Vasemmalta:"
#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Taso 0 (Ei optimointia)"
#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr ""
#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""
#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr ""
#: lazarusidestrconsts:lislevels
msgid "Levels"
msgstr "Tasot"
#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr ""
#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Aliohjelmakirjasto"
#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr "Kirjasto%sFreePascal kirjasto (.dll windows:ssa, .so linux:ssa, .dylib MacOSX:ssa). Kirjaston lähdekoodia hallitaan Lazarus:lla."
#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Lisenssi:"
#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Lisenssi: GPL/LGPL%sLazarus on FreePascalin kehitysympäristö jolla voi tehdä (graafisia ja komentorivi) sovelluksia FreePascalille. FreePascal on (L)GPL-lisensoitu (mm oliopohjainen) Pascal kääntäjä joka toimii mm. Linux, Win32, OS/2, Mac OS X ja FreeBSD käyttöjärjestelmissä"
#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr ""
#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Rivi"
#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Rivin katkaisu"
#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr ""
#: lazarusidestrconsts:lislinelength
msgid "Line/Length"
msgstr ""
#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Rivit"
#: lazarusidestrconsts:lisinfobuildlines
msgid "Lines:"
msgstr "Rivejä:"
#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr ""
#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr ""
#: lazarusidestrconsts:lislinktarget
msgid "Link target"
msgstr ""
#: lazarusidestrconsts:lislink
msgid "Link:"
msgstr ""
#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr ""
#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr ""
#: lazarusidestrconsts:liscmplstlist
msgid "List"
msgstr ""
#: lazarusidestrconsts:rslanguagelithuanian
msgid "Lithuanian"
msgstr "liettua"
#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Lue työpöytäasetukset tiedostosta"
#: lazarusidestrconsts:lisiecoloadfromfile
msgid "Load from file"
msgstr ""
#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr ""
#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr ""
#: lazarusidestrconsts:lisloadingfailed
msgid "Loading %s failed."
msgstr ""
#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr ""
#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Paikalliset"
#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr ""
#: lazarusidestrconsts:lislocals
msgid "Locals"
msgstr ""
#: lazarusidestrconsts:lislogo
msgid "Logo"
msgstr ""
#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Muuta pieniksi kirjaimiksi"
#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Ensimmäinen kirjain iso muut pieniä"
#: lazarusidestrconsts:liskmmacosx
msgid "Mac OS X"
msgstr ""
#: lazarusidestrconsts:lismacpascal
msgid "Mac Pascal"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr ""
#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Päävalikko"
#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Pääohjelmassa on Application.CreateForm -lause tai -lauseet"
#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Pääohjelmassa on Application.Title -lause"
#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Pääohjelman Uses -esittelyosassa on kaikki projektin käännösyksiköt (eli unitit)"
#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Pääohjelma on Pascal-kielinen lähdekoodi"
#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr ""
#: lazarusidestrconsts:rsmajorrevision
msgid "Major revision:"
msgstr ""
#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr ""
#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr ""
#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr ""
#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr ""
#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr "Make -ohjelman hakupolku"
#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr ""
#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr ""
#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Oikea marginaali ja vasen reunus"
#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Valittujen komponenttien ilmaiseminen"
#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr "Löydetty"
#: lazarusidestrconsts:lismaxs
msgid "Max %d"
msgstr ""
#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "Suurin rivinpituus:"
#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Tallessa pidettävien viimeiseksi käytettyjen tiedostojen nimien lukumäärä"
#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Tallessa pidettävien viimeiseksi käytettyjen projektien lukumäärä"
#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr ""
#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr ""
#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr ""
#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Suurin laskijanumero"
#: lazarusidestrconsts:lismemorydump
msgid "Memory Dump"
msgstr ""
#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Valikkomuokkain"
#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Kääntäjän viestit"
#: lazarusidestrconsts:lismethodclassnotfound
msgid "Method class not found"
msgstr ""
#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr ""
#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr ""
#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr ""
#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr ""
#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr ""
#: lazarusidestrconsts:rsminorrevision
msgid "Minor revision:"
msgstr ""
#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr ""
#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr ""
#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Muut"
#: lazarusidestrconsts:lismissingevents
msgid "Missing Events"
msgstr "Puuttuvia tapahtumia"
#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr "Komponenttipaketti puuttuu"
#: lazarusidestrconsts:lismissingidentifiers
msgid "Missing identifiers"
msgstr ""
#: lazarusidestrconsts:lisccomissingunit
msgid "Missing unit"
msgstr ""
#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr ""
#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Muutettu"
#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""
#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr ""
#: lazarusidestrconsts:listodolfile
msgid "Module"
msgstr ""
#: lazarusidestrconsts:lismore
msgid "More"
msgstr ""
#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Näytä muut ..."
#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Hiirilinkit (Toimii Ctrl-näppäimen painalluksen kanssa)"
#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Siirrä alaspäin (tai oikeallepäin)"
#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Siirrä vasemmanpuoleiselle välilehdelle"
#: lazarusidestrconsts:uemmoveeditorleftmost
msgid "Move Editor Leftmost"
msgstr "Siirrä kaikkien vasemmanpuolimmaiselle välilehdelle"
#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Siirrä oikeanpuoleiselle välilehdelle"
#: lazarusidestrconsts:uemmoveeditorrightmost
msgid "Move Editor Rightmost"
msgstr "Siirrä kaikkien oikeanpuolimmaiselle välilehdelle"
#: lazarusidestrconsts:lismovepage
msgid "Move Page ..."
msgstr "Siirrä välilehdelle ..."
#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Siirrä ylöspäin (tai vasemmallepäin)"
#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr ""
#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr ""
#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr ""
#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr ""
#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr ""
#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr ""
#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr ""
#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr ""
#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr ""
#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Siirrä kursori rivin loppuun"
#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Siirrä kursori rivin alkuun"
#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr ""
#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr ""
#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr ""
#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr ""
#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Siirrä riippuvuutta alaspäin"
#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Siirrä riippuvuutta ylöspäin"
#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Siirry vasemmalla olevalle välilehdelle"
#: lazarusidestrconsts:srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""
#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr "Siirry oikealla olevalle välilehdelle"
#: lazarusidestrconsts:srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""
#: lazarusidestrconsts:lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr ""
#: lazarusidestrconsts:lispemovefiledown
msgid "Move file down"
msgstr ""
#: lazarusidestrconsts:lispemovefileup
msgid "Move file up"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr ""
#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr ""
#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr ""
#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr "Siirrä taainmaksi"
#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr "Siirrä päällimmäksi"
#: lazarusidestrconsts:dlgmultiselect
msgid "Multi Select"
msgstr "Monivalinta"
#: lazarusidestrconsts:fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr ""
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr ""
#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr ""
#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr ""
#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr ""
#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmname
msgid "Name"
msgstr ""
#: lazarusidestrconsts:lisnameconflict
msgid "Name conflict"
msgstr ""
#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Uuden aliohjelman nimi"
#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Nimi:"
#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Nimeäminen"
#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr ""
#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr "Uusi"
#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Uusi"
#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr ""
#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr ""
#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr ""
#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr ""
#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Uusi Lomake"
#: lazarusidestrconsts:lispwnewproject
msgid "New Project"
msgstr "Luo uusi Projekti"
#: lazarusidestrconsts:lismenunewproject
msgid "New Project ..."
msgstr "Luo uusi Projekti ..."
#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Luo uusi projekti tiedostosta ..."
#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr ""
#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr ""
#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Uusi käännösyksikkö (Unit)"
#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr ""
#: lazarusidestrconsts:liskmnewpackage
msgid "New package"
msgstr ""
#: lazarusidestrconsts:lismenunewpackage
msgid "New package ..."
msgstr ""
#: lazarusidestrconsts:liskmnewproject
msgid "New project"
msgstr ""
#: lazarusidestrconsts:liskmnewprojectfromfile
msgid "New project from file"
msgstr ""
#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr ""
#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr ""
#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr ""
#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr ""
#: lazarusidestrconsts:lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""
#: lazarusidestrconsts:lisnobackupfiles
msgid "No backup files"
msgstr "Ei varmuuskopioita"
#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr "Ei muutoksia"
#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr "Ei valittua koodia"
#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr ""
#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Virheenjäljitintä (debugger) ei ole valittu"
#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr ""
#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr ""
#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr ""
#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""
#: lazarusidestrconsts:lisnostringconstantfound
msgid "No string constant found"
msgstr ""
#: lazarusidestrconsts:lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr ""
#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr ""
#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr ""
#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr ""
#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr ""
#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr ""
#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr ""
#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Ei löytynyt"
#: lazarusidestrconsts:lisnotimplemented
msgid "Not implemented"
msgstr ""
#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr ""
#: lazarusidestrconsts:lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""
#: lazarusidestrconsts:lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""
#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr ""
#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr ""
#: lazarusidestrconsts:lisinfobuildnote
msgid "Notes:"
msgstr "Huomioita:"
#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Huomaa: Projektin tiedostot ovat kaikki tiedostot projektikansiossa"
#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Numero"
#: lazarusidestrconsts:lisifdok
msgid "OK"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr ""
#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr "Korvaa"
#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr ""
#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Komponenttimuokkain"
#: lazarusidestrconsts:liskeycatobjinspector
msgid "Object Inspector commands"
msgstr ""
#: lazarusidestrconsts:lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""
#: lazarusidestrconsts:dlgedoff
msgid "Off"
msgstr ""
#: lazarusidestrconsts:lisokbtn
msgid "Ok"
msgstr ""
#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr ""
#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr ""
#: lazarusidestrconsts:dlgedon
msgid "On"
msgstr ""
#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr ""
#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr ""
#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr ""
#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr ""
#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Avustusta ei ole vielä tehty"
#: lazarusidestrconsts:lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""
#: lazarusidestrconsts:lisemdonlypublished
msgid "Only published"
msgstr "Vain published"
#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Esittävä sana ei voi olla osa toista sanaa"
#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Ainoastaan valittu osa"
#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr ""
#: lazarusidestrconsts:lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""
#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr "Avaa"
#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr "Avaa %s"
#: lazarusidestrconsts:lismenuopen
msgid "Open ..."
msgstr "Avaa ..."
#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Avaa eroavuudet editorissa"
#: lazarusidestrconsts:lisopenfile2
msgid "Open File ..."
msgstr "Avaa tiedosto ..."
#: lazarusidestrconsts:liscpopenpackage
msgid "Open Package %s"
msgstr "Avaa komponenttipaketti %s"
#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr "Avataan komponenttipakettitiedosto"
#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr ""
#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr ""
#: lazarusidestrconsts:lispwopenproject
msgid "Open Project"
msgstr "Avaa Projekti"
#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project ..."
msgstr "Avaa Projekti ..."
#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr ""
#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Avataanko projekti?"
#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Avaa viimeksi esillä olleista"
#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent ..."
msgstr "Avaa viimeksi esillä olleista ..."
#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Avaa esillä ollut projekti ..."
#: lazarusidestrconsts:liscpopenunit
msgid "Open Unit %s"
msgstr "Avaa käännösyksikkö %s"
#: lazarusidestrconsts:lisopenasxmlfile
msgid "Open as XML file"
msgstr "Avataan XML-tiedostona"
#: lazarusidestrconsts:lisopenexistingfile
msgid "Open existing file"
msgstr ""
#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Avaa tiedosto"
#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Avaa kohdistimen osoittama tiedosto"
#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Avaa kohdistimen osoittama tiedosto"
#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Avaa viimeksi käsitelty projekti Lazaruksen käynnistyksen yhteydessä"
#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Avaa komponenttipaketti"
#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Avaa komponenttipaketti ..."
#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr ""
#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Avaa paketti"
#: lazarusidestrconsts:lisopenpackage2
msgid "Open package %s"
msgstr ""
#: lazarusidestrconsts:liskmopenpackagefile
msgid "Open package file"
msgstr ""
#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Avataan komponenttipakettitiedosto (.lpk) ..."
#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr ""
#: lazarusidestrconsts:lisopenproject2
msgid "Open project"
msgstr "Avaa projekti"
#: lazarusidestrconsts:lisopenprojectagain
msgid "Open project again"
msgstr "Avaa projekti uudelleen"
#: lazarusidestrconsts:lisiecoopenrecent
msgid "Open recent"
msgstr ""
#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Avaa esillä ollut komponenttipaketti ..."
#: lazarusidestrconsts:lisopensymlink
msgid "Open symlink"
msgstr ""
#: lazarusidestrconsts:lisopentarget
msgid "Open target"
msgstr ""
#: lazarusidestrconsts:lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Avaa tiedosto normaalina lähdekoodina"
#: lazarusidestrconsts:lisopenthepackage
msgid "Open the package %s?"
msgstr ""
#: lazarusidestrconsts:lisopentheproject
msgid "Open the project %s?"
msgstr "Avataanko projekti %s?"
#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Avaa käännösyksikkö (unit)"
#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr ""
#: lazarusidestrconsts:liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr ""
#: lazarusidestrconsts:liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr ""
#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Sijoita apupisteiden mukaan"
#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Sijoita kohdistusviivojen mukaan"
#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Optiot"
#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr ""
#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr ""
#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr "Järjestys"
#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr "Lähtökohta"
#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr ""
#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr ""
#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr ""
#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Muut tiedostot"
#: lazarusidestrconsts:rsotherinfo
msgid "Other info"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmoutput
msgid "Output"
msgstr ""
#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Sovelluksen tiedostoasetukset"
#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr ""
#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr ""
#: lazarusidestrconsts:lissamoverrideallselected
msgid "Override all selected"
msgstr ""
#: lazarusidestrconsts:lissamoverridefirstselected
msgid "Override first selected"
msgstr ""
#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr ""
#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr ""
#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr ""
#: lazarusidestrconsts:lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Korvaa tällä tiedostolla"
#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Korvataanko tiedosto?"
#: lazarusidestrconsts:listodolowner
msgid "Owner"
msgstr ""
#: lazarusidestrconsts:rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""
#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr ""
#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Komponenttipaketti %s"
#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Komponenttipakettia %s ei löydetty"
#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr ""
#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr ""
#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph ..."
msgstr ""
#: lazarusidestrconsts:lispackageinfo
msgid "Package Info"
msgstr "Komponenttipaketin tietoja"
#: lazarusidestrconsts:lispldpackagelinks
msgid "Package Links"
msgstr ""
#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Komponenttipaketin nimi"
#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr ""
#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr ""
#: lazarusidestrconsts:lispkgreg
msgid "Package Registration"
msgstr ""
#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr ""
#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""
#: lazarusidestrconsts:liskmpackagegraph
msgid "Package graph"
msgstr ""
#: lazarusidestrconsts:dlgpldpackagegroup
msgid "Package group"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Ei ole suunnitteluaikainen komponenttipaketti"
#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Komponenttipakettia tarvitaan"
#: lazarusidestrconsts:lismenupackagelinks
msgid "Package links ..."
msgstr ""
#: lazarusidestrconsts:srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Komponenttipakettivalikon komennot"
#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr ""
#: lazarusidestrconsts:lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr ""
#: lazarusidestrconsts:lispackagenamecontains
msgid "Package name contains ..."
msgstr ""
#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr ""
#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Komponenttipakettia ei löytynyt"
#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr ""
#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr ""
#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr ""
#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr ""
#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr ""
#: lazarusidestrconsts:liscmplstpalette
msgid "Palette"
msgstr ""
#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr ""
#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Rivit (sisennykset ovat ed. riviä)"
#: lazarusidestrconsts:liscmparameter
msgid "Parameter"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametrit:"
#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr ""
#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr ""
#: lazarusidestrconsts:lislazbuildabopart
msgid "Part"
msgstr ""
#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr ""
#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr ""
#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal:n käännösyksikön (unit) tiedostopääte on joko .pp tai .pas"
#: lazarusidestrconsts:lispasscount
msgid "Pass Count"
msgstr ""
#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr ""
#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Liitä"
#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr ""
#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Liitä leikepöydältä"
#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr ""
#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""
#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr ""
#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr "Tiedostopolku:"
#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr ""
#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr ""
#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr ""
#: lazarusidestrconsts:liskmpauseprogram
msgid "Pause program"
msgstr ""
#: lazarusidestrconsts:dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""
#: lazarusidestrconsts:lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""
#: lazarusidestrconsts:lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr ""
#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr ""
#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""
#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr ""
#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr ""
#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr ""
#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr ""
#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr ""
#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr ""
#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr ""
#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Ole hyvä ja valitse ensin jokin koodin osa josta tehdään uusi aliohjelma tai metodi"
#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr "Piste (.)"
#: lazarusidestrconsts:lispointer
msgid "Pointer"
msgstr ""
#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr "puola"
#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr "puola (CP1250)"
#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr "puola (ISO 8859-2)"
#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr "portugali"
#: lazarusidestrconsts:lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""
#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Esikatselu"
#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Esikatselu (kun maksimi rivinpituus = 1)"
#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr ""
#: lazarusidestrconsts:lisprint
msgid "Print"
msgstr "Tulosta"
#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr ""
#: lazarusidestrconsts:listodolpriority
msgid "Priority"
msgstr ""
#: lazarusidestrconsts:lisprivate
msgid "Private"
msgstr ""
#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr "Private - metodi"
#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr ""
#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr "Aliohjelma"
#: lazarusidestrconsts:uemprocedurejump
msgid "Procedure Jump"
msgstr "Siirry aliohjelman tai funktion esittelyn ja toteuksen välillä"
#: lazarusidestrconsts:srkmecprocedurelist
msgid "Procedure List ..."
msgstr "Aliohjelmien ja funktioiden luettelo ..."
#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr ""
#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Aliohjelma ja interface osaan sen esittely"
#: lazarusidestrconsts:lisceprocedures
msgid "Procedures"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmprocess
msgid "Process"
msgstr ""
#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr ""
#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Tunnistettiin ohjelmaksi"
#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Ohjelman lähdekoodin tiedosto tarkennin pitää olla .pas, .pp tai .lpr"
#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Ohjelma%s Freepascal ohjelma. Ohjelmatiedosto hyödyntää lazarusta."
#: lazarusidestrconsts:lisexeprograms
msgid "Programs"
msgstr ""
#: lazarusidestrconsts:lispdprogress
msgid "Progress"
msgstr ""
#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr ""
#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr ""
#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr ""
#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr ""
#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projektinhallinta"
#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Projektinhallinta - %s"
#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Projektikohtaiset asetukset"
#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projektikohtaiset asetukset ..."
#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr ""
#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr ""
#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr ""
#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr ""
#: lazarusidestrconsts:lisprojectwizard
msgid "Project Wizard"
msgstr "Projekti 'velho'"
#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Projekti on muuttunut"
#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr ""
#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr ""
#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Projektin tiedostot"
#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Tunnistettiin 'Project Info'-tiedostoksi"
#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekti on ajettavissa virheenjäljittimessä"
#: lazarusidestrconsts:lisprojectmacroproperties
msgid "Project macro properties"
msgstr ""
#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Projektivalikon komennot"
#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr ""
#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr ""
#: lazarusidestrconsts:lisceproperties
msgid "Properties"
msgstr ""
#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr ""
#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr ""
#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr "Ominaisuuden nimi"
#: lazarusidestrconsts:lisprotected
msgid "Protected"
msgstr ""
#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr "Protected - metodi"
#: lazarusidestrconsts:lispckoptsprovides
msgid "Provides"
msgstr ""
#: lazarusidestrconsts:lisemdpublic
msgid "Public"
msgstr ""
#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr "Public - metodi"
#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr ""
#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project ..."
msgstr ""
#: lazarusidestrconsts:liskmpublishproject
msgid "Publish project"
msgstr ""
#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr ""
#: lazarusidestrconsts:lisemdpublished
msgid "Published"
msgstr ""
#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr "Published - metodi"
#: lazarusidestrconsts:lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr ""
#: lazarusidestrconsts:lismenuquickcompile
msgid "Quick compile"
msgstr ""
#: lazarusidestrconsts:liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""
#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Nopea syntaksin tarkistus"
#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "Lopeta"
#: lazarusidestrconsts:lisquitlazarus
msgid "Quit Lazarus"
msgstr "Poistu Lazaruksesta"
#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr ""
#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Palauta riippuvuus"
#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr ""
#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "Lukuvirhe"
#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Vain luettavissa"
#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Tämä on vain luettavissa: %s"
#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr ""
#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr ""
#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Vain luettavissa"
#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Rakennetaanko Lazarus uudelleen?"
#: lazarusidestrconsts:lisiecorecentfiles
msgid "Recent files"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr ""
#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr ""
#: lazarusidestrconsts:lisrecordstruct
msgid "Record/Structure"
msgstr ""
#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Uudelleen"
#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Vähennä näytön päivittämistä"
#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr "Koodin uudelleen muokkaus"
#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr ""
#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Päivitä"
#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr ""
#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Päivitä tehtävälistaa (ToDo-list)"
#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr ""
#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr ""
#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr ""
#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr ""
#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr ""
#: lazarusidestrconsts:lisregularexpression
msgid "Regular expression"
msgstr ""
#: lazarusidestrconsts:lisrelativepaths
msgid "Relative paths"
msgstr ""
#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr ""
#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Hae tallennettuna oleva versio"
#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Poista"
#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr ""
#: lazarusidestrconsts:liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr ""
#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Poista kaikki vikaantuneet tai toimimattomat ominaisuudet"
#: lazarusidestrconsts:liskmremovebreakpoint
msgid "Remove break point"
msgstr ""
#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Poista riippuvuus"
#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr ""
#: lazarusidestrconsts:srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Poista tyhjät metodit"
#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Poista tiedosto"
#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Poistetaanko tiedosto %s projektista?"
#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Poistetaanko tiedosto %s%s%s%skomponenttipaketista %s%s%s?"
#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Poistetaanko tiedosto?"
#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Poistettavien tiedostojen tiedostopäätteet"
#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Poista projektista ..."
#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr ""
#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr "Valitse projektista poistettava käännösyksikkö"
#: lazarusidestrconsts:lisemdremovemethods
msgid "Remove methods"
msgstr "Poista metodit"
#: lazarusidestrconsts:liscodehelpdeletepathbutton
msgid "Remove path"
msgstr ""
#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr ""
#: lazarusidestrconsts:lisremovethem
msgid "Remove them"
msgstr "Poista ne"
#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr ""
#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Poistettuja tarvittavia komponenttipaketteja"
#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr ""
#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr "Nimeä uudelleen"
#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""
#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr "Vaihda tunnisteen nimeä"
#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Vaihda tunnisteen nimeä ..."
#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr "Uudelleen nimeä kaikki tunnisteet"
#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr ""
#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Vaihdetaanko tiedoston nimeä komponenttipaketissa?"
#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Muutetaanko tiedoston nimeä?"
#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Vaihda tunnisteiden nimiä"
#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr "Uusi nimi on"
#: lazarusidestrconsts:lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Vaihda nimi pienillä kirjaimilla kirjoitetuksi"
#: lazarusidestrconsts:lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Avaa uudestaan toisella merkistön koodauksella"
#: lazarusidestrconsts:lisrepeatcount
msgid "Repeat Count:"
msgstr ""
#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Etsi ja korvaa"
#: lazarusidestrconsts:dlgreplaceall
msgid "Replace &All"
msgstr "Korvaa kaikki"
#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr ""
#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr ""
#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr ""
#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Korvataanko tässä esiintyvä %s%s%s%s tekstillä %s%s%s?"
#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr ""
#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr ""
#: lazarusidestrconsts:lismenureportingbug
msgid "Reporting a bug..."
msgstr ""
#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Tarvittavat komponenttipaketit"
#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr ""
#: lazarusidestrconsts:lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""
#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr ""
#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Resurssitiedoston lukeminen epäonnistui"
#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr ""
#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr ""
#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr ""
#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr "Käynnistä Lazarus uudelleen"
#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr ""
#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr ""
#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr ""
#: lazarusidestrconsts:lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""
#: lazarusidestrconsts:dlgccoresults
msgid "Results"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresume
msgid "Resume"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr ""
#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Palauta"
#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr ""
#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr ""
#: lazarusidestrconsts:lisright
msgid "Right"
msgstr ""
#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr "Valinta voidaan tehdä hiiren oikean näppäimellä"
#: lazarusidestrconsts:lisrightanchoring
msgid "Right anchoring"
msgstr ""
#: lazarusidestrconsts:lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Näpäyttämällä hiiren oikeaa näppäintä saat esiin ponnahdusvalikon jossa on kaikki saatavissa olevat komponenttipakettiin liittyvät toiminnallisuudet"
#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "Oikea marginaaliviiva"
#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Oikean marginaaliviivan väri"
#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves cursor"
msgstr ""
#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr "Oikeat reunat"
#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr ""
#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr "Alueen reunojen esille tuominen"
#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Suorita"
#: lazarusidestrconsts:lisbfruncommand
msgid "Run Command"
msgstr ""
#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr ""
#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Suoritusaikaiset parametrit..."
#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Suoritavalikon komennot"
#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Suoritusaikaiset parametrit"
#: lazarusidestrconsts:liskmrunprogram
msgid "Run program"
msgstr ""
#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr ""
#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr ""
#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr ""
#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "venäjä"
#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr ""
#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Sama nimi (mutta alikansiossa)"
#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Tallenna"
#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Tallenna "
#: lazarusidestrconsts:lissave
msgid "Save ..."
msgstr "Tallenna ..."
#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Tallenna kaikki"
#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr "Tallenna nimellä"
#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "'Tallenna nimellä'-toiminnossa, tiedoston nimen automaattinen muuntaminen pieniksi kirjaimiksi"
#: lazarusidestrconsts:lismenusaveas
msgid "Save As ..."
msgstr "Tallenna nimellä ..."
#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr ""
#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Talletetaanko muutokset?"
#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr ""
#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr ""
#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Tallenna Projekti"
#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Tallenna %s projekti (*.lpi)"
#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Tallenna Projekti nimellä ..."
#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr ""
#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr "Tallenna kaikki"
#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Tallenna kaikki kääntäjän viestit tiedostoon"
#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr ""
#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr ""
#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr ""
#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Tallennetaanko %s -projektiin tehdyt muutokset?"
#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr "Tallennetaanko muutokset?"
#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Tallenna työpöytäasetukset tiedostoon"
#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr ""
#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr ""
#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr ""
#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Tallennetaanko tiedosto %s%s%s%sennenkuin suljetaan lomake (form) %s%s%s?"
#: lazarusidestrconsts:lissavefileas
msgid "Save file as"
msgstr ""
#: lazarusidestrconsts:lisa2psavefiledialog
msgid "Save file dialog"
msgstr ""
#: lazarusidestrconsts:fdmsaveformasxml
msgid "Save form as xml"
msgstr "Tallenna lomake XML-tiedostona"
#: lazarusidestrconsts:lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ""
#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ""
#: lazarusidestrconsts:lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr ""
#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr ""
#: lazarusidestrconsts:lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr ""
#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr ""
#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr ""
#: lazarusidestrconsts:liskmsaveproject
msgid "Save project"
msgstr "Tallenna projekti"
#: lazarusidestrconsts:liskmsaveprojectas
msgid "Save project as"
msgstr "Tallenna projekti nimellä"
#: lazarusidestrconsts:lisposavesessioninformationin
msgid "Save session information in"
msgstr ""
#: lazarusidestrconsts:lislazbuildsavesettings
msgid "Save settings"
msgstr ""
#: lazarusidestrconsts:lisiecosavetofile
msgid "Save to file"
msgstr ""
#: lazarusidestrconsts:lisiecosavetorecent
msgid "Save to recent"
msgstr ""
#: lazarusidestrconsts:liskmsaveall
msgid "SaveAll"
msgstr "Tallenna kaikki"
#: lazarusidestrconsts:liskmsaveas
msgid "SaveAs"
msgstr "Tallenna nimellä"
#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Skaalaa"
#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr ""
#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr ""
#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr ""
#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr ""
#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Ulottuvuus"
#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr ""
#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr ""
#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr ""
#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Näytä tiedoston lopussa tyhjää tilaa ('Scrollaa' lopun yli)"
#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr "Kursoria liikuttaessa ('scrollatessa') ei välitetä rivinlopusta"
#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr ""
#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr ""
#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr "Viittaukset tunnisteeseen: "
#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Hakutulokset"
#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr "Etsi uudelleen"
#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Käy kommentit myöskin läpi"
#: lazarusidestrconsts:lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Haetaan näistä luokan (class) osista:"
#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
msgid "Search or Filter Phrases In List"
msgstr ""
#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr ""
#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Etsittyä merkkijonoa '%s' ei löydetty!"
#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Käyttäjä keskeytti hakemisen"
#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr "Etsittävä teksti"
#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr "Mistä etsitään"
#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr "Etsitään"
#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Etsitään..."
#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Etsitään tiedostosta: %s"
#: lazarusidestrconsts:liscodehelpseealsotag
msgid "See also"
msgstr ""
#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "Katso \"Kääntäjän viestit \" -ikkunaa"
#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr ""
#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr ""
#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Valitse"
#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr ""
#: lazarusidestrconsts:lisctselectcodemacro
msgid "Select Code Macro"
msgstr ""
#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Valitse Delphi form (lomake) tiedosto (*.dfm)"
#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr ""
#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""
#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr ""
#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr ""
#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Valitse muokattava valikko (menu)"
#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr ""
#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr ""
#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr ""
#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr ""
#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr ""
#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr ""
#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Valitse valmis malli:"
#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr ""
#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr ""
#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr ""
#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr "Valitse jokin kohta seuraavista:"
#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr ""
#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr ""
#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Valitse kaikki"
#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr ""
#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr ""
#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr ""
#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Valitse rivi"
#: lazarusidestrconsts:liskmselectlineend
msgid "Select line end"
msgstr ""
#: lazarusidestrconsts:liskmselectlinestart
msgid "Select line start"
msgstr ""
#: lazarusidestrconsts:lissamselectnone
msgid "Select none"
msgstr ""
#: lazarusidestrconsts:liskmselectpagebottom
msgid "Select page bottom"
msgstr ""
#: lazarusidestrconsts:liskmselectpagetop
msgid "Select page top"
msgstr ""
#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr ""
#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr ""
#: lazarusidestrconsts:lisselectfile
msgid "Select the file"
msgstr ""
#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr ""
#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr ""
#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr ""
#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr ""
#: lazarusidestrconsts:liskmselectwordleft
msgid "Select word left"
msgstr ""
#: lazarusidestrconsts:liskmselectwordright
msgid "Select word right"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr ""
#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr ""
#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Valinta"
#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr ""
#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Valintatyökalu"
#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Puolipiste (;)"
#: lazarusidestrconsts:dlgposavesession
msgid "Session"
msgstr ""
#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr ""
#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr ""
#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr ""
#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr ""
#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr ""
#: lazarusidestrconsts:liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker0
msgid "Set marker 0"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker1
msgid "Set marker 1"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker2
msgid "Set marker 2"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker3
msgid "Set marker 3"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker4
msgid "Set marker 4"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker5
msgid "Set marker 5"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker6
msgid "Set marker 6"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker7
msgid "Set marker 7"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker8
msgid "Set marker 8"
msgstr ""
#: lazarusidestrconsts:liskmsetmarker9
msgid "Set marker 9"
msgstr ""
#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr ""
#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Merkitse tämä kuitenkin keskeyskohdaksi"
#: lazarusidestrconsts:lisedtexttoolshift
msgid "Shift"
msgstr ""
#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr ""
#: lazarusidestrconsts:liscodehelpshorttag
msgid "Short"
msgstr ""
#: lazarusidestrconsts:liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""
#: lazarusidestrconsts:lisshort
msgid "Short:"
msgstr ""
#: lazarusidestrconsts:lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr ""
#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisshow
msgid "Show"
msgstr ""
#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr ""
#: lazarusidestrconsts:liscemodeshowcategories
msgid "Show Categories"
msgstr ""
#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr ""
#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "Näytä virheet"
#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Näytä kohdistusviivat"
#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Näytä vihjeet"
#: lazarusidestrconsts:dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr ""
#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr ""
#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Näytä rivinumerot"
#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Näytä muistutukset"
#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr ""
#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Näytä lomake editorin asetukset"
#: lazarusidestrconsts:liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""
#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Näytä varoitukset"
#: lazarusidestrconsts:srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""
#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr ""
#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr ""
#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr ""
#: lazarusidestrconsts:dlgqshowborderspacing
msgid "Show border spacing"
msgstr ""
#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Näytä sulje-painike välilehdellä"
#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr ""
#: lazarusidestrconsts:dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Näytä käännösikkuna"
#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr ""
#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr ""
#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Näytä komponenttien nimet vihjeessä"
#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr ""
#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr ""
#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr ""
#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Näytä editointivihjeet"
#: lazarusidestrconsts:liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Näytä tyhjät metodit"
#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr "Näytä kaikki (hidas)"
#: lazarusidestrconsts:dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr ""
#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr ""
#: lazarusidestrconsts:lispldshowgloballinks
msgid "Show global links"
msgstr ""
#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Näytä apupisteet"
#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr ""
#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr "Näytä komponenttimuokkaimessa vihjeet"
#: lazarusidestrconsts:lisshowidentifiers
msgid "Show identifiers"
msgstr ""
#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr "Näytä rivinumerot"
#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr ""
#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Näytä ainoastaan virheet"
#: lazarusidestrconsts:lisshowoldtaborder
msgid "Show old tab order"
msgstr ""
#: lazarusidestrconsts:lisshowpackages
msgid "Show packages"
msgstr ""
#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr ""
#: lazarusidestrconsts:lisshowspecialcharacters
msgid "Show special characters"
msgstr "Tuo esille erikoismerkit (kuten välilyönnit pisteinä, kelpaattomat merkit kysymysmerkkeinä)"
#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr "Näytä yhteenveto"
#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr ""
#: lazarusidestrconsts:lisshowunits
msgid "Show units"
msgstr ""
#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr ""
#: lazarusidestrconsts:lispldshowuserlinks
msgid "Show user links"
msgstr ""
#: lazarusidestrconsts:lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""
#: lazarusidestrconsts:lissibling
msgid "Sibling"
msgstr ""
#: lazarusidestrconsts:lisdebugoptionsfrmsignals
msgid "Signals"
msgstr ""
#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr ""
#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr ""
#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Koko"
#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr "Koko:"
#: lazarusidestrconsts:lisccoskip
msgid "Skip"
msgstr ""
#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr ""
#: lazarusidestrconsts:lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Ohita tiedosto ja jatka lataamista"
#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr ""
#: lazarusidestrconsts:lispkgmangskipthispackage
msgid "Skip this package"
msgstr ""
#: lazarusidestrconsts:rslanguageslovak
msgid "Slovak"
msgstr "Slovakki"
#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr ""
#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr ""
#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr ""
#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Kiinnity kohdistusviivojen avulla"
#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Sijoitu apupisteiden avulla"
#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Seuraava tiedosto on muuttunut (seuraavat tiedostot ovat muuttuneet):"
#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""
#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr ""
#: lazarusidestrconsts:lispesortfiles
msgid "Sort files"
msgstr ""
#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr "Lajittele lohko"
#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection ..."
msgstr "Lajittele lohko ..."
#: lazarusidestrconsts:lisceomodesource
msgid "Source"
msgstr ""
#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Lähdekoodi editori"
#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Lähdekoodieditorin komennot"
#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr ""
#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr ""
#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""
#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "Lähdekoodi muuttunut"
#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts:lissourcepaths
msgid "Source paths"
msgstr ""
#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr ""
#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Välilyönnit"
#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr ""
#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "espanja"
#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr ""
#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr ""
#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr ""
#: lazarusidestrconsts:lisstartwithanewproject
msgid "Start with a new project"
msgstr "Aloita uusi projekti"
#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Tila"
#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr ""
#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr ""
#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr ""
#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr ""
#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr ""
#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Pysäytä"
#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Lopetetaanko testaus/virheenjäljitys?"
#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr ""
#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Pysäytetäänkö nykyinen virheenjäljitys ja muodostetaan käännös uudelleen?"
#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr "Pysäytetäänkö virheenjäljitys?"
#: lazarusidestrconsts:liskmstopprogram
msgid "Stop program"
msgstr ""
#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Pysäytetäänkö virheenjäljitys?"
#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr ""
#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr ""
#: lazarusidestrconsts:lisstreamerror
msgid "Stream Error"
msgstr ""
#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr ""
#: lazarusidestrconsts:lisstring
msgid "String"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr ""
#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr ""
#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr ""
#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr ""
#: lazarusidestrconsts:lisstyle
msgid "Style"
msgstr ""
#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr "Aliohjelman sisäinen aliohjelma"
#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr ""
#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Alikansio"
#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr "Aliominaisuudet"
#: lazarusidestrconsts:lissuccess
msgid "Success"
msgstr "Onnistui"
#: lazarusidestrconsts:lisinfobuildsuccess
msgid "Success..."
msgstr "Kääntäminen onnistui..."
#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Vaihda tiedostopolkua"
#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr ""
#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr ""
#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Varmistustiedoston symboli tiedoston tarkenteen loppuun (.pp~)"
#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Varmistustiedoston symboli tiedoston tarkenteen eteen (.~pp)"
#: lazarusidestrconsts:lissynedit
msgid "SynEdit"
msgstr ""
#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr ""
#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr ""
#: lazarusidestrconsts:lissyntaxmode
msgid "Syntax mode"
msgstr ""
#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr ""
#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr ""
#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr ""
#: lazarusidestrconsts:listab
msgid "Tab"
msgstr ""
#: lazarusidestrconsts:listaborderof
msgid "Tab Order of"
msgstr ""
#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr ""
#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr ""
#: lazarusidestrconsts:liseotabwidths
msgid "Tab widths"
msgstr ""
#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr ""
#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr ""
#: lazarusidestrconsts:lislazbuildqboapplcltarget
msgid "Target"
msgstr ""
#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetcpu
msgid "Target CPU:"
msgstr ""
#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr ""
#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr ""
#: lazarusidestrconsts:dlgtargetplatform
msgid "Target Platform:"
msgstr ""
#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""
#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Tehtävän sovelluksen tiedostonimi:"
#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""
#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr ""
#: lazarusidestrconsts:dlgtargetproc
msgid "Target processor"
msgstr ""
#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Mallin esikatselu"
#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr ""
#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr "Lyhenteet"
#: lazarusidestrconsts:dlgccotest
msgid "Test"
msgstr ""
#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testiprojektien kansiota \"%s\" ei löytynyt. "
#: lazarusidestrconsts:dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""
#: lazarusidestrconsts:dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""
#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""
#: lazarusidestrconsts:dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""
#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr ""
#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Kirjaimien määritteet"
#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Tekstin muokkauskomennot"
#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Tekstin merkkauskomennot"
#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Tekstin etsintä- ja korvauskomennot"
#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Tekstin valintakomennot"
#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Etsittävä teksti:"
#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Teksti 1"
#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Teksti 2"
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr ""
#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""
#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr "Kansio \"%s\" ei vaikuta FreePascalin lähdekoodin kansiolta! Senhän pitäisi sisältää sellaisia kansioita kuten rtl, packages, compiler jne."
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr ""
#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr ""
#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr ""
#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Lazaruksen lomake eli LFM-tiedosto sisältää vääränlaisia ominaisuuksia. Tämä tarkoittanee esimerkiksi jotain luokkaa tai sen ominaisuutta mitä ei ole käytettävissä käytössä olevassa LCL-kirjastossa. Normaali korjaus on poistaa nämä ominaisuudet LFM-tiedostosta ja korjata Pascal-koodi käsin."
#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr ""
#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""
#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""
#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr ""
#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Projektien testikansioksi merkittyä kansiota:%s%s%s%s%sei löydy (katso käyttöliittymän asetukset)!"
#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""
#: lazarusidestrconsts:lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Kääntäjän tiedosto \"%s\" ei ole ajettavissa."
#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr ""
#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""
#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Tällä hetkellä käytössä oleva kääntäjän tiedostonimi %s%s%s%sei ole suoritettavissa.%sValitsemalla Ok käytetään oletuksena olevaa %s%s%s.%sMuussa tapauksessa tarkista Käyttöliittymä-valikon -> Käyttöliittymä asetukset -> Tiedostot-välilehden kohdat"
#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr ""
#: lazarusidestrconsts:lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Nykyinen editorin kirjaisin ei tue UTF-8 merkistöä, mutta käyttöjärjestelmä tukee sitä. %sTämä merkitsee sitä että ei ASCII merkit voivat näkyä väärin.%sSopivamman kirjaisimen voi valita editorin asetuksista."
#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr ""
#: lazarusidestrconsts:lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""
#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Tarvittavaa komponenttipakettia %s%s%s ei löytynyt.%sJos mahdollista niin valitse jokin toinen komponenttipaketti."
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""
#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr ""
#: lazarusidestrconsts:listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""
#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Kansiota %s%s%s ei enään tarvita käännösyksikön tiedostopolussa.%sPoistetaanko se?"
#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Kansio %s%s%s ei vielä ole käännösyksikön polussa.%sLisätäänkö se sinne?"
#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr ""
#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Tiedosto %s vaikuttaa siltä että se on ohjelmatiedosto Lazaruksella tehdyssä projektissa."
#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "Tiedosto %s%s%s"
#: lazarusidestrconsts:listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""
#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr ""
#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr ""
#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr ""
#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""
#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Tiedosto %s%s%s%sei ole komponenttipaketin hakupolussa.%s%sLisätäänkö kansio %s%s%s käännösyksikköjen hakupolkuun?"
#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr ""
#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Tiedosto %s%s%s%s näyttää olevan Pascal-ohjelma. Suljetaanko nykyinen projekti ja avataan tämä uutena projektina?%s\"Ei\"-näppäin avaa sen vain lähdekoodina."
#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""
#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr ""
#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Tiedostoa %s%s%s%sei löytynyt.%sOhita-näppäimen nainallus jatkaa projektin lataamista,%sKeskeytä-näppäin keskeyttää sen."
#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "Tiedosto \""
#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr ""
#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr ""
#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Seuraavaa metodia %s on käytetty mutta sitä ei löydy lähdekoodista%s%s%s%s%s%sPoistetaanko 'roikkuva' viittaus?"
#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Seuraavan komponenttipaketin lataaminen epäonnistui:"
#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Seuraavien komponenttipakettien lataaminen epäonnistui:"
#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr "Seuraavia käännösyksiköitä (unit) ei löydetty:%s%s%s%s1) Joko nämä käännösyksiköt eivät olleet hakupolussa jolloin keskeytä ja korjaa hakupolut sekä yritä uudelleen.%s2) Tai voit ohittaa puuttuvat käännösyksiköt ja kommentoida ne pois käytöstä."
#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr ""
#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""
#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr ""
#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Kansio \"%s\" ei vaikuta Lazarus:n kansiolta! Senhän pitäisi sisältää mm seuraavia kansioita kuten lcl, debugger, designer, components jne."
#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr ""
#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr ""
#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""
#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Komponenttipaketti %s on ainoastaan ajonaikainen.%sVain ajonaikaisia komponenttipaketteja ei asenneta kehitysympäristöön."
#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Komponenttipakettia %s tarvitaan komponettipaketissa %s, mikä on merkitty asennukseen.%sKatso komponenttipakettien kuvauksista"
#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Komponenttipaketti %s omistaa tiedoston%s%s%s%s.%sPitäisikö tuota komponenttipaketin nimeäkin myöskin muuttaa?"
#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Komponenttipaketin %s%s%s kääntäminen epäonnistui.%sPoistetaanko se asennuksesta?"
#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr ""
#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Komponenttipaketti %s%s%s oli merkitty asennettavaksi mutta sitä ei löydetty. Poistetaanko tämä riippuvuus komponettipakettien asennusluettelosta?"
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Paketti %s%s%s on merkitty asennettavaksi.%sNykyinen lazarus tukee ainoastaan staattisesti linkattuja paketteja. Asennus vaatii Lazaruksen uudelleen rakentamisen ja uudelleen käynnistämisen.%s%sHaluako tehdä sen nyt?"
#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Komponenttipaketti %s%s%s oli merkitty.%sNykyinen Lazarus tukee ainoastaan staattisesti linkitettyjä komponenttipaketteja. komponenttipakettien poistaminen vatii Lazaruksen uudelleen rakentamisen ja käynnistämisen.%s%sTehdäänkö tämä nyt?"
#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr ""
#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr ""
#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr ""
#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr ""
#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr ""
#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr ""
#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr ""
#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Projektn info tiedosto %s%s%s%son/olisi saman niminen kuin projektin pääohjelman lähdekoodi tiedosto!"
#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr ""
#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Sovellus tarvitsee komponenttipaketin %s%s%s.%sMutta sitä ei löydy (tai ei ole asennettu). Katso projektivalikon kohtaa -> Projektinhallinta."
#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr ""
#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr ""
#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr ""
#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Käännösyksikkö (unit) %s löytyy %s:n kahdesta eri käännösyksikön hakupolusta:"
#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""
#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Käännösyksikön (unit) %s%s%s nimeä käytetään jo projektissa.%sVoitte kaikesta huolimatta nimetä näin jolloin nimenvaihto tapahtuu,%sMahdollista on myös perua tämä tallennus tai sitten keskeyttää kaikki tallennukset."
#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds
msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?"
msgstr "Käännösyksikön (unit) %s%s%s nimeä käytetään jo projektissa.%sOhita-näppäin jatkaa nimenvaihtoa,%sPeru-näppäin peruuttaa tämän tallennuksen ja Keskeytä-näppäin lopettaa kaikki tallennukset."
#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Käännösyksikkö (unit) on jo nimeltään %s%s%s. Pascal:ssa tunnukset pitää olla yksilöllisiä"
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Käännösyksikkö (unit) %s%s%s on jo olemassa projektissa%stiedostona: %s%s%s."
#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr ""
#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr ""
#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr ""
#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr ""
#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
msgid "The unitname is not a valid pascal identifier."
msgstr ""
#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""
#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""
#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""
#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Lista lisätoiminnoista"
#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""
#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Kansiossa on muitakin saman nimisiä tiedostoja,%sne eroavat ainoastaan kirjaimien koon perusteella:%s%s%sPoistetaanko ne?"
#: lazarusidestrconsts:lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""
#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr ""
#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Kansiosta löytyy jo myös samanlainen (epäselvä) tiedosto samantapaisella tiedostopäätteellä%sTallennettavatiedosto: %s%sSamanlainen (epäselvä) tiedosto: %s%s%sPoistetaanko samanlainen (epäselvä) tiedosto?"
#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr ""
#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr ""
#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Projektissa on jo %s%s%s-niminen lomake (form)"
#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr ""
#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr ""
#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""
#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr ""
#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Kun virheenjäljitintä (debugger) ei ole valittu niin keskeytyskohdalla (breakpoint) ei ole vaikutusta ennenkuin 'Käyttöliittymä'-valikon 'Virheenjäljittimen asetus'-kohtaan on asetettu virheenjäjitin."
#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr ""
#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr ""
#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr ""
#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr ""
#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr ""
#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr ""
#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr ""
#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Tämä vaikuttaa pascal-tiedostolta.%sOn suositeltavaa käyttää pieniä kirjaimia tiedoston nimessä jotta vältytään ongelmilta joissakin tiedostojärjestelmissä.%Vaihdetaanko tiedoston nimi pienillä kirjaimilla kirjoitetuksi?"
#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""
#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr ""
#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr ""
#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr ""
#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tästä ei voi tehdä omaa aliohjelmaa.%sOle hyvä ja valitse ensin jokin muu koodin osa josta voi tehdä uusi aliohjelma tai metodi"
#: lazarusidestrconsts:listhiswillhappencontinue
msgid "This will happen:%s%s%sContinue?"
msgstr "Näin tulee tapahtumaan:%s%s%sJatketaanko?"
#: lazarusidestrconsts:lisdebugoptionsfrmthread
msgid "Thread"
msgstr ""
#: lazarusidestrconsts:listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""
#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr ""
#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Nimi:"
#: lazarusidestrconsts:lismenuviewtodolist
msgid "ToDo List"
msgstr "Tehtävälista (ToDo List)"
#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr ""
#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Siirry lomakkeen ja käännösyksikön välillä"
#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr ""
#: lazarusidestrconsts:liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr ""
#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Siirry lomakkeen ja käännösyksikön välillä"
#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr ""
#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr ""
#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr ""
#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr ""
#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Työkalutvalikon komennot"
#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr ""
#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr ""
#: lazarusidestrconsts:listop
msgid "Top"
msgstr ""
#: lazarusidestrconsts:listopanchoring
msgid "Top anchoring"
msgstr ""
#: lazarusidestrconsts:listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""
#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr ""
#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Ylhäältä:"
#: lazarusidestrconsts:listops
msgid "Tops"
msgstr "Yläreunat"
#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Poista turhat välilyönnit rivinlopusta"
#: lazarusidestrconsts:listurbopascal
msgid "Turbo Pascal"
msgstr ""
#: lazarusidestrconsts:rslanguageturkish
msgid "Turkish"
msgstr "turkki"
#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr ""
#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Tyyppi"
#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr ""
#: lazarusidestrconsts:liscetypes
msgid "Types"
msgstr ""
#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ISOT KIRJAIMET"
#: lazarusidestrconsts:rslanguageukrainian
msgid "Ukrainian"
msgstr "ukraina"
#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr ""
#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr ""
#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr ""
#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr ""
#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Ei voida tehdä varmuuskopiota tiedostosta %s%s%s tiedostoon %s%s%s!"
#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr ""
#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr ""
#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr ""
#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr ""
#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Tiedoston kopiointi ei onnistunut"
#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s"
#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Tiedoston %s%s%s%skopiointi ei onnistunut tiedostoksi %s%s%s."
#: lazarusidestrconsts:lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""
#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Kansion luonti epäonnistui"
#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Tiedostoa %s%s%s ei pystytä luomaan"
#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr ""
#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr ""
#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr ""
#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr ""
#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""
#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Ei löydetä tiedostoa %s%s%s."
#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""
#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Metodia ei löydetty. Ole hyvä ja korjaa kääntäjän viestin mukainen virhe."
#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr ""
#: lazarusidestrconsts:lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""
#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr ""
#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr ""
#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Resurssitiedoston lukeminen ei onnistunut.%sResurssitiedosto pitää olla ensimmäisenä tiedostona %sinitialization osassa.%sEli tämän kaltainen määrittely siellä pitäisi olla {$I %s.lrs}.%sTodennäköisesti kyseessä on syntaksivirhe."
#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Ei pystytä lataamaan komponenttipakettia"
#: lazarusidestrconsts:lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Ei pystytä lataamaan komponenttipakettia %s%s%s"
#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr ""
#: lazarusidestrconsts:lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""
#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Ei pystytä avaamaan komponenttipakettia %s%s%s.%sTämä komponenttipaketti oli merkitty asennettavaksi."
#: lazarusidestrconsts:lisunabletoread
msgid "Unable to read %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Ei pystytä lukemaan tiedostoa %s%s%s!"
#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr ""
#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr ""
#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr ""
#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr ""
#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Ei pystytä tekemään muutoksia lähdekoodiin."
#: lazarusidestrconsts:lisunabletorun
msgid "Unable to run"
msgstr ""
#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr ""
#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""
#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Ei pystytä näyttämään metodia. Ole hyvä ja korjaa virhe joka näkyy kääntäjän viestit ikkunassa"
#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr ""
#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr ""
#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr ""
#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr ""
#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr ""
#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""
#: lazarusidestrconsts:lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr ""
#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr ""
#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut"
#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Tallentaminen ei onnistunut tiedostoon %s%s%s%sVirheenä oli: %s"
#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut."
#: lazarusidestrconsts:lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr "Tallentaminen tiedostoon %s%s%s ei onnistunut"
#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Ei pystytä tallettamaan tiedostoon %s%s%s!"
#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr ""
#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Poista lohkon kommentointi (//)"
#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr ""
#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Alleviivaus"
#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Kumoa"
#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr ""
#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit"
msgstr ""
#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr ""
#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Poista lohkon sisennys"
#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Poista asennuksesta"
#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr ""
#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Poistetaanko komponenttipaketti %s ?"
#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Poistetaanko komponenttipaketti Lazaruksen asennuksesta?"
#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr ""
#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""
#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr ""
#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr ""
#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Käännösyksikön tiedot"
#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr ""
#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr ""
#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr ""
#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr ""
#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr ""
#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr ""
#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "käännösyksikön (Unit) riippuvuudet"
#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr ""
#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr ""
#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Käännösyksikön (Unit) nimi on jo olemassa"
#: lazarusidestrconsts:lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr ""
#: lazarusidestrconsts:lisunitnamecontains
msgid "Unit name contains ..."
msgstr ""
#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr "Käännösyksikköä (unit) ei löydetty"
#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr ""
#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr ""
#: lazarusidestrconsts:lisunitpaths
msgid "Unit paths"
msgstr ""
#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr ""
#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr ""
#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Tätä Käännösyksikön nimeä käytetään jo projektissa"
#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""
#: lazarusidestrconsts:lispeunitname
msgid "Unitname:"
msgstr ""
#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr ""
#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Käännösyksiköt eli unitit ..."
#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr ""
#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr "Ylös"
#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr ""
#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr ""
#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Muuta isoiksi kirjaimiksi"
#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr ""
#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr ""
#: lazarusidestrconsts:dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr ""
#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr ""
#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr ""
#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr ""
#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr ""
#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Käytä oletusväriä"
#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr ""
#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr ""
#: lazarusidestrconsts:dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr ""
#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr ""
#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Käytä syntaksin korostusta"
#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr ""
#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr ""
#: lazarusidestrconsts:lisplduser
msgid "User"
msgstr ""
#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr ""
#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "Käyttäjän määrittämä tiedostontarkennin"
#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Käyttäjän määrittämä tiedostontarkennin (.pp.xxx)"
#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr ""
#: lazarusidestrconsts:lisusershomedirectory
msgid "User's home directory"
msgstr ""
#: lazarusidestrconsts:lisceuses
msgid "Uses"
msgstr ""
#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Arvo"
#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr ""
#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr ""
#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr ""
#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr ""
#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr ""
#: lazarusidestrconsts:liscevariables
msgid "Variables"
msgstr ""
#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr ""
#: lazarusidestrconsts:lisverifymethodcalls
msgid "Verify method calls"
msgstr ""
#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Versio"
#: lazarusidestrconsts:versioninfotitle
msgid "Version Info"
msgstr "Versiotiedot"
#: lazarusidestrconsts:rsversionnumbering
msgid "Version numbering"
msgstr ""
#: lazarusidestrconsts:rsversion
msgid "Version:"
msgstr ""
#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr "Pystysuunta"
#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Apupisteiden välinen etäisyys pystysuunnassa"
#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr ""
#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr ""
#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Näytä koodiselain"
#: lazarusidestrconsts:lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr "Näytä tai poista komponenttipaletti näkyvistä"
#: lazarusidestrconsts:srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr ""
#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Näytä lomakkeet"
#: lazarusidestrconsts:lismenuviewidespeedbuttons
msgid "View IDE speed buttons"
msgstr ""
#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Näytä hyppy historia ..."
#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Näytä komponenttimuokkain"
#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr ""
#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr ""
#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr ""
#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Näytä lomakkeen koodi (.lfm)"
#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr ""
#: lazarusidestrconsts:lispeviewtodolist
msgid "View ToDo list"
msgstr ""
#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Näytä käännösyksikön (Unit) riippuvuudet"
#: lazarusidestrconsts:liskmviewunitinfo
msgid "View Unit Info"
msgstr "Näytä käännösyksikön (Unit) tietoja"
#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr "Näytä käännösyksikön (Unit) tietoja"
#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Näytä käännösyksiköt (Unit)"
#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr ""
#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr ""
#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr ""
#: lazarusidestrconsts:srkmectogglecodebrowser
msgid "View code browser"
msgstr ""
#: lazarusidestrconsts:srkmectogglecomppalette
msgid "View component palette"
msgstr ""
#: lazarusidestrconsts:srkmecviewcomponents
msgid "View components"
msgstr ""
#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr ""
#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr ""
#: lazarusidestrconsts:liskmviewjumphistory
msgid "View jump history"
msgstr ""
#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr ""
#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Näytä valikon komennot"
#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr ""
#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Näytä projektin lomakkeet (forms)"
#: lazarusidestrconsts:dlgmainviewframes
msgid "View project frames"
msgstr ""
#: lazarusidestrconsts:liskmviewprojectoptions
msgid "View project options"
msgstr ""
#: lazarusidestrconsts:liskmviewprojectsource
msgid "View project source"
msgstr ""
#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Näytä projektin käännösyksiköt (units)"
#: lazarusidestrconsts:srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""
#: lazarusidestrconsts:srkmecviewtodolist
msgid "View todo list"
msgstr "Näytä tehtävälista (ToDo List)"
#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr ""
#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr ""
#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr ""
#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr ""
#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr ""
#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr ""
#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr ""
#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Näytä vasen reunus"
#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Näytä oikea marginaaliviiva"
#: lazarusidestrconsts:lisccowarningmsg
msgid "WARNING: "
msgstr ""
#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr ""
#: lazarusidestrconsts:lisccowarningcaption
msgid "Warning"
msgstr ""
#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr ""
#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Varoitus: Tiedosto %s%s%s%skuuluu jo projektiin."
#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr ""
#: lazarusidestrconsts:lisinfobuildwarning
msgid "Warnings:"
msgstr "Varoituksia:"
#: lazarusidestrconsts:liswatchpropert
msgid "Watch Properties"
msgstr ""
#: lazarusidestrconsts:liswlwatchlist
msgid "Watch list"
msgstr ""
#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr ""
#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Kun tehdään uusi lomake niin se laitetaan automaattisesti luotaviin lomakkeisiin"
#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr ""
#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr ""
#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Mistä"
#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Leveys:"
#: lazarusidestrconsts:dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""
#: lazarusidestrconsts:dlgwindow
msgid "Window"
msgstr ""
#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Ikkunoiden paikat"
#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""
#: lazarusidestrconsts:liswithrequiredpackages
msgid "With required packages"
msgstr ""
#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr ""
#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr ""
#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Sanat"
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr ""
#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr ""
#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr ""
#: lazarusidestrconsts:lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr ""
#: lazarusidestrconsts:lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr ""
#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "Tiedoston tallentaminen ei onnistunut"
#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Tiedoston tallentaminen ei onnistunut"
#: lazarusidestrconsts:liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""
#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr ""
#: lazarusidestrconsts:lisxmlerror
msgid "XML Error"
msgstr ""
#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr "XML tiedostot"
#: lazarusidestrconsts:lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""
#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr ""
#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr ""
#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" ei voida tallentaa."
#: lazarusidestrconsts:lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""
#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr ""
#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr ""
#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr ""
#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr ""
#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr ""
#: lazarusidestrconsts:lisbegins
msgid "begins"
msgstr ""
#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr ""
#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr ""
#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr ""
#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "väri vasemmalla ja ylhäällä"
#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "väri oikealla ja alhaalla"
#: lazarusidestrconsts:lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""
#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr ""
#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr ""
#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr ""
#: lazarusidestrconsts:liscontains
msgid "contains"
msgstr ""
#: lazarusidestrconsts:lisccocontains
msgid "contains "
msgstr ""
#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr ""
#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""
#: lazarusidestrconsts:lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""
#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr ""
#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr ""
#: lazarusidestrconsts:lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""
#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr "FreePascal ohjelma joka käyttää TCustomApplication luokkaa. Sillä on helppo tarkastaa komentoriviltä annetut parametrit ja poikkeukset. Ohjelman tekoa hallitaan Lazaruksella."
#: lazarusidestrconsts:lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr ""
#: lazarusidestrconsts:dlgpoi18n
msgid "i18n"
msgstr ""
#: lazarusidestrconsts:rsi18noptions
msgid "i18n Options"
msgstr ""
#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "Projektissa:"
#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr ""
#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr "vain käytössä oleva lähdekoodiyksikkö (unit)"
#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr "kaikista tämän projektin tiedostoista"
#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr ""
#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr ""
#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr ""
#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr ""
#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr ""
#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr ""
#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr ""
#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyonlinebreak
msgid "line break"
msgstr ""
#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr ""
#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "Pienet kirjaimet"
#: lazarusidestrconsts:lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr ""
#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr ""
#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr ""
#: lazarusidestrconsts:lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""
#: lazarusidestrconsts:lisnew
msgid "new"
msgstr ""
#: lazarusidestrconsts:lisccohasnewline
msgid "new line symbols"
msgstr ""
#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "ei"
#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr "Ei automaattista uudelleen nimeämistä"
#: lazarusidestrconsts:lisccdnoclass
msgid "no class"
msgstr ""
#: lazarusidestrconsts:liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""
#: lazarusidestrconsts:lisccononascii
msgid "non ASCII"
msgstr ""
#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr ""
#: lazarusidestrconsts:lisnone2
msgid "none"
msgstr "Ei mikään"
#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr ""
#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr ""
#: lazarusidestrconsts:lisold
msgid "old"
msgstr "vanha"
#: lazarusidestrconsts:lisor
msgid "or"
msgstr "tai"
#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr ""
#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr ""
#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr ""
#: lazarusidestrconsts:lisctpleaseselectamacro
msgid "please select a macro"
msgstr ""
#: lazarusidestrconsts:lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""
#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr ""
#: lazarusidestrconsts:srkmecquickcompile
msgid "quick compile, no linking"
msgstr ""
#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr ""
#: lazarusidestrconsts:lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""
#: lazarusidestrconsts:lisremove
msgid "remove"
msgstr ""
#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr ""
#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr ""
#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr ""
#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr ""
#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr ""
#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr ""
#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr ""
#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Hae kaikista avoinna olevista tiedostoista"
#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Hae projektin kaikista tiedostoista"
#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Etsi kansioista"
#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr ""
#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr ""
#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr ""
#: lazarusidestrconsts:lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyonspace
msgid "space"
msgstr ""
#: lazarusidestrconsts:lisccospaces
msgid "spaces"
msgstr ""
#: lazarusidestrconsts:lisccospecialcharacters
msgid "special characters"
msgstr ""
#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr ""
#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr ""
#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr ""
#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr ""
#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr ""
#: lazarusidestrconsts:lisccounusualchars
msgid "unusual characters"
msgstr ""
#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr ""
#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr ""
#: lazarusidestrconsts:lisautomaticallyonwordend
msgid "word end"
msgstr ""
#: lazarusidestrconsts:lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""
#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "kyllä"