lazarus/languages/lazaruside.ru.po

msgid ""
msgstr ""
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Project-Id-Version: lazaruside\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2008-09-25 03:49+0300\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"

#: lazarusidestrconsts:srkmcommand1
msgid "    command1 \""
msgstr "   команда1 \""

#: lazarusidestrconsts:srkmcommand2
msgid "    command2 \""
msgstr "   команда2 \""

#: lazarusidestrconsts:liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Элемент %s%s%s уже существует! "

#: lazarusidestrconsts:srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "Клавиша \"%s\" уже сопоставлена с \"%s\"."

#: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Каталог вывода должен быть отдельным и не содержать файлов исходного кода."

#: lazarusidestrconsts:srkmconflicw
msgid " conflicts with "
msgstr " конфликтует с "

#: lazarusidestrconsts:liscompiling
msgid "%s (compiling ...)"
msgstr "%s (идёт компиляция ...)"

#: lazarusidestrconsts:lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (идёт отладка ...)"

#: lazarusidestrconsts:liscovarious
msgid "%s (various)"
msgstr "%s (другое)"

#: lazarusidestrconsts:lisnewproject
msgid "%s - (new project)"
msgstr "%s - (новый проект)"

#: lazarusidestrconsts:lislazarusversionstring
msgid "%s beta"
msgstr "%s бета"

#: lazarusidestrconsts:lisuidbytes
msgid "%s bytes"
msgstr "%s байт"

#: lazarusidestrconsts:liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "Каталог %s"

#: lazarusidestrconsts:lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s не существует: %s"

#: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s не содержит ни одного корректного пути LazDoc.%sНевозможно создать файл FPDoc для %s"

#: lazarusidestrconsts:lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s является %s.%sТакая круговая зависимость не разрешена."

#: lazarusidestrconsts:lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s - уже часть проекта."

#: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s - абстрактный класс, он имеет %s абстрактных методов."

#: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Каталог проекта %s"

#: lazarusidestrconsts:lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "модуль %s в пакете %s%s"

#: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s - некорректное имя проекта.%sВыберите другое (например, project1.lpi)"

#: lazarusidestrconsts:lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s - некорректный идентификатор."

#: lazarusidestrconsts:lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s - некорректное название модуля"

#: lazarusidestrconsts:liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sНажмите OK если уверены."

#: lazarusidestrconsts:lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sИмя файла: %s%s%s"

#: lazarusidestrconsts:lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sНевозможно изменить класс %s на %s"

#: lazarusidestrconsts:lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sИмя модуля: %s%s%s"

#: lazarusidestrconsts:lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Страница: %s"

#: lazarusidestrconsts:liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, автосоздан"

#: lazarusidestrconsts:liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, связан с проектом"

#: lazarusidestrconsts:lisuereadonly
msgid "%s/ReadOnly"
msgstr "%s/только чтение"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sДобавление новой зависимости пакета %s: пакет %s%s"

#: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sДобавление новой зависимости проекта %s: пакет %s%s"

#: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОба пакета связаны. Это значит, что либо один из них использует другой, либо оба они используются третьим пакетом."

#: lazarusidestrconsts:lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sОписание: %s"

#: lazarusidestrconsts:lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sСуществующий файл: %s%s%s"

#: lazarusidestrconsts:lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sСм. Проект -> Инспектор проекта"

#: lazarusidestrconsts:lispckexplstate
msgid "%sState: "
msgstr "%sСостояние: "

#: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sСледующие модули будут добавлены к секции uses %s%s:%s%s%s"

#: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sЭтот пакет установлен, но файл lpk не найден"

#: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sЭтот пакет был создан автоматически"

#: lazarusidestrconsts:lisnone
msgid "%snone"
msgstr "%sнет"

#: lazarusidestrconsts:lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sпереопределить компилятор по умолчанию, например, ppc386 ppcx64 ppcppc и т. д. Значение по умолчанию хранится в environmentoptions.xml"

#: lazarusidestrconsts:lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sпереопределить целевое семейство процессоров проекта, например, i386 x86_64 powerpc powerpc_64 и т. д. Значение по умолчанию: %s"

#: lazarusidestrconsts:lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sпереопределить операционную систему проекта, например, win32 linux. Значение по умолчанию: %s"

#: lazarusidestrconsts:lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sпереопределить библиотеку виджетов проекта, например, gtk gtk2 qt win32 carbon. Значение по умолчанию: %s"

#: lazarusidestrconsts:liswladd
msgid "&Add"
msgstr "&Добавить"

#: lazarusidestrconsts:uemaddbreakpoint
msgid "&Add Breakpoint"
msgstr "&Добавить точку останова"

#: lazarusidestrconsts:lisapplicationclassname
msgid "&Application class name"
msgstr "&Название класса приложения"

#: lazarusidestrconsts:lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Назад"

#: lazarusidestrconsts:dlgcasesensitive
msgid "&Case Sensitive"
msgstr "&Учитывать регистр"

#: lazarusidestrconsts:lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Учитывать регистр"

#: lazarusidestrconsts:lisclose
msgid "&Close"
msgstr "&Закрыть"

#: lazarusidestrconsts:uemclosepage
msgid "&Close Page"
msgstr "&Закрыть страницу"

#: lazarusidestrconsts:lismenuviewcomponents
msgid "&Components"
msgstr "&Компоненты"

#: lazarusidestrconsts:liswldelete
msgid "&Delete"
msgstr "&Удалить"

#: lazarusidestrconsts:lisdeleteall
msgid "&Delete All"
msgstr "&Удалить все"

#: lazarusidestrconsts:lismenuedit
msgid "&Edit"
msgstr "&Правка"

#: lazarusidestrconsts:lisenableall
msgid "&Enable All"
msgstr "&Включить все"

#: lazarusidestrconsts:liswlenabled
msgid "&Enabled"
msgstr "&Включить"

#: lazarusidestrconsts:dlgentirescope
msgid "&Entire Scope"
msgstr "С начала &фрагмента"

#: lazarusidestrconsts:lismenufile
msgid "&File"
msgstr "&Файл"

#: lazarusidestrconsts:lismenufind2
msgid "&Find ..."
msgstr "&Найти ..."

#: lazarusidestrconsts:uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Найти объявление"

#: lazarusidestrconsts:dlgfromcursor
msgid "&From Cursor"
msgstr "От &курсора"

#: lazarusidestrconsts:dlgglobal
msgid "&Global"
msgstr "Во всём т&ексте"

#: lazarusidestrconsts:uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Переход по закладке"

#: lazarusidestrconsts:lismenuhelp
msgid "&Help"
msgstr "&Справка"

#: lazarusidestrconsts:lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Многострочный &шаблон"

#: lazarusidestrconsts:lisplistobjects
msgid "&Objects"
msgstr "&Объекты"

#: lazarusidestrconsts:lisok
msgid "&Ok"
msgstr "&ОК"

#: lazarusidestrconsts:uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Открыть файл у курсора"

#: lazarusidestrconsts:lismenupackage
msgid "&Package"
msgstr "П&акет"

#: lazarusidestrconsts:lismenuproject
msgid "&Project"
msgstr "Про&ект"

#: lazarusidestrconsts:dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "Спрашивать при &замене"

#: lazarusidestrconsts:liswlproperties
msgid "&Properties"
msgstr "&Свойства"

#: lazarusidestrconsts:dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Регулярные выражения"

#: lazarusidestrconsts:lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Регулярные выражения"

#: lazarusidestrconsts:rsremove
msgid "&Remove"
msgstr "&Удалить"

#: lazarusidestrconsts:lismenureplace2
msgid "&Replace ..."
msgstr "&Заменить ..."

#: lazarusidestrconsts:dlgreplacewith
msgid "&Replace With"
msgstr "&Заменить на"

#: lazarusidestrconsts:lismenurun
msgid "&Run"
msgstr "&Запуск"

#: lazarusidestrconsts:uemruntocursor
msgid "&Run to Cursor"
msgstr "За&пуск до курсора"

#: lazarusidestrconsts:lismenusearch
msgid "&Search"
msgstr "П&оиск"

#: lazarusidestrconsts:dlgselectedtext
msgid "&Selected Text"
msgstr "В вы&деленном"

#: lazarusidestrconsts:uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Установить закладку"

#: lazarusidestrconsts:lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "&Точка останова в исходном коде"

#: lazarusidestrconsts:dlgtexttofing
msgid "&Text to Find"
msgstr "&Найти текст"

#: lazarusidestrconsts:listitle
msgid "&Title"
msgstr "&Заголовок"

#: lazarusidestrconsts:lismenutools
msgid "&Tools"
msgstr "Се&рвис"

#: lazarusidestrconsts:lismenuview
msgid "&View"
msgstr "&Вид"

#: lazarusidestrconsts:lismenuviewsource
msgid "&View Source"
msgstr "&Просмотреть исходный код проекта"

#: lazarusidestrconsts:dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&Только целые слова"

#: lazarusidestrconsts:lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "&Только целые слова"

#: lazarusidestrconsts:lismenuwindow
msgid "&Window"
msgstr "Ок&но"

#: lazarusidestrconsts:liscefilter
msgid "(Filter)"
msgstr "(Фильтр)"

#: lazarusidestrconsts:lisfilter2
msgid "(filter)"
msgstr "(фильтр)"

#: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(не найдено унаследованного описания)"

#: lazarusidestrconsts:dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(нет подкаталога)"

#: lazarusidestrconsts:liscodehelpnodocumentation
msgid "(none)"
msgstr "(нет)"

#: lazarusidestrconsts:listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(неизвестный макрос: %s)"

#: lazarusidestrconsts:lisplistall
msgid "<All>"
msgstr "<Все>"

#: lazarusidestrconsts:liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<НЕТ>"

#: lazarusidestrconsts:lisplistnone
msgid "<None>"
msgstr "<Нет>"

#: lazarusidestrconsts:lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<выберите существующий файл>"

#: lazarusidestrconsts:lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts:lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts:lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts:lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не выбрано переменных>"

#: lazarusidestrconsts:lisoff
msgid "? (Off)"
msgstr "? (Выкл.)"

#: lazarusidestrconsts:lison
msgid "? (On)"
msgstr "? (Вкл.)"

#: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s не может содержать компоненты TControl.%sВ него можно помещать только невизуальные компоненты."

#: lazarusidestrconsts:lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Файл %s%s%s уже существует.%s Заменить?"

#: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля должен иметь расширение .pp или .pas"

#: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Требуемый пакет не найден. См. диаграмму пакетов."

#: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Файл простой программы на Паскале.%sМожет использоваться для тестирования наспех.%sЛучше создайте новый проект."

#: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Корректное средство обязательно должно иметь заголовок и имя файла."

#: lazarusidestrconsts:lisabandonchanges
msgid "Abandon changes?"
msgstr "Отбросить изменения?"

#: lazarusidestrconsts:lisinfobuildmakeabort
msgid "Abort"
msgstr "Прервать"

#: lazarusidestrconsts:lismenuabortbuild
msgid "Abort Build"
msgstr "Прервать сборку"

#: lazarusidestrconsts:lisabortall
msgid "Abort all"
msgstr "Прервать все"

#: lazarusidestrconsts:lisabortallloading
msgid "Abort all loading"
msgstr "Прервать все загрузки"

#: lazarusidestrconsts:liskmabortbuilding
msgid "Abort building"
msgstr "Прервать сборку"

#: lazarusidestrconsts:lisabortloadingproject
msgid "Abort loading project"
msgstr "Прервать загрузку проекта"

#: lazarusidestrconsts:lisabortwholeloading
msgid "Abort whole loading"
msgstr "Прервать всю загрузку"

#: lazarusidestrconsts:lisinfobuildabort
msgid "Aborted..."
msgstr "Прервано..."

#: lazarusidestrconsts:lismenutemplateabout
msgid "About"
msgstr "О проекте"

#: lazarusidestrconsts:lisaboutlazarus
msgid "About Lazarus"
msgstr "О проекте Lazarus"

#: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Абстрактные методы - ещё не замещены"

#: lazarusidestrconsts:lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Абстрактные методы %s"

#: lazarusidestrconsts:lissortselsort
msgid "Accept"
msgstr "Accept"

#: lazarusidestrconsts:lisacknowledgements
msgid "Acknowledgements"
msgstr "Благодарности"

#: lazarusidestrconsts:lislazbuildaboaction
msgid "Action"
msgstr "Действие"

#: lazarusidestrconsts:liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Действие: %s"

#: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Активировать синтаксис регулярных выражений для текста и замены (почти как в perl)"

#: lazarusidestrconsts:lisactivefilter
msgid "Active Filter"
msgstr "Текущий фильтр"

#: lazarusidestrconsts:liscodetempladd
msgid "Add"
msgstr "Добавить"

#: lazarusidestrconsts:lisaddtoproject
msgid "Add %s to project?"
msgstr "Добавить %s к проекту?"

#: lazarusidestrconsts:uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Добавить &наблюдение у курсора"

#: lazarusidestrconsts:lisa2paddfile
msgid "Add File"
msgstr "Добавить файл"

#: lazarusidestrconsts:lisa2paddfiles
msgid "Add Files"
msgstr "Добавить файлы"

#: lazarusidestrconsts:rsaddinverse
msgid "Add Inverse"
msgstr "Добавить инверсию"

#: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Добавить LFM, LRS файлы, если есть"

#: lazarusidestrconsts:lisa2paddunit
msgid "Add Unit"
msgstr "Добавить модуль"

#: lazarusidestrconsts:lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Добавить активный модуль к проекту"

#: lazarusidestrconsts:liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Добавить текущий модуль к проекту"

#: lazarusidestrconsts:lispckeditaddanitem
msgid "Add an item"
msgstr "Добавить элемент"

#: lazarusidestrconsts:dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Добавить оператор присваивания :="

#: lazarusidestrconsts:liskmaddbreakpoint
msgid "Add break point"
msgstr "Добавить точку останова"

#: lazarusidestrconsts:lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Добавить точку останова"

#: lazarusidestrconsts:liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Добавить шаблон кода"

#: lazarusidestrconsts:lisadddirectory
msgid "Add directory"
msgstr "Добавить каталог"

#: lazarusidestrconsts:lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Добавить файл редактора в проект"

#: lazarusidestrconsts:lisprojaddeditorfile
msgid "Add editor files"
msgstr "Добавить файлы редактора"

#: lazarusidestrconsts:lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Добавить файл к пакету"

#: lazarusidestrconsts:lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Добавить файл к проекту"

#: lazarusidestrconsts:lisprojaddfiles
msgid "Add files"
msgstr "Добавить файлы"

#: lazarusidestrconsts:lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Добавить файлы каталога"

#: lazarusidestrconsts:lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Добавить файлы к пакету"

#: lazarusidestrconsts:srkmecaddjumppoint
msgid "Add jump point"
msgstr "Добавить точку перехода"

#: lazarusidestrconsts:lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Добавить точку перехода в историю"

#: lazarusidestrconsts:liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Добавить ссылку"

#: lazarusidestrconsts:lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Добавить ссылку на унаследованное"

#: lazarusidestrconsts:lisaddnewset
msgid "Add new set"
msgstr "Добавить новый набор"

#: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Добавление параметров к зависимым пакетам и проектам"

#: lazarusidestrconsts:podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Добавлять модуль пакета в секцию uses"

#: lazarusidestrconsts:liscodehelpaddpathbutton
msgid "Add path"
msgstr "Добавить путь"

#: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Добавление путей к зависимым пакетам и проектам"

#: lazarusidestrconsts:dlgaddsemicolon
msgid "Add semicolon"
msgstr "Добавить точку с запятой"

#: lazarusidestrconsts:lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Добавить свойства в избранное"

#: lazarusidestrconsts:lisa2paddtopackage
msgid "Add to package"
msgstr "Добавить к пакету"

#: lazarusidestrconsts:lisprojaddtoproject
msgid "Add to project"
msgstr "Добавить к проекту"

#: lazarusidestrconsts:lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Добавить к путям поиска модулей?"

#: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Добавить модуль в выражение uses пакета. Отключить это только для модулей, которые не должны компилироваться во всех случаях."

#: lazarusidestrconsts:liskmaddwatch
msgid "Add watch"
msgstr "Добавить наблюдение"

#: lazarusidestrconsts:lismenuaddwatch
msgid "Add watch ..."
msgstr "Добавить наблюдение..."

#: lazarusidestrconsts:dlgedadd
msgid "Add..."
msgstr "Добавить..."

#: lazarusidestrconsts:lisadditionalinformation
msgid "Additional Information"
msgstr "Дополнительная информация"

#: lazarusidestrconsts:dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Дополнительные пути к исходным кодам для всех проектов (.pp;.pas)"

#: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Дополнительные параметры компилятора, унаследованные от пакетов"

#: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Дополнительные файлы для поиска (напр. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts:rsadditionalinfo
msgid "Additional info"
msgstr "Дополнительно"

#: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Дополнительный путь поиска"

#: lazarusidestrconsts:dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Выровнять верхнюю строку по комментарию"

#: lazarusidestrconsts:lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Расширенные параметры сборки"

#: lazarusidestrconsts:rslanguageafrikaans
msgid "Afrikaans"
msgstr "Африкаанс"

#: lazarusidestrconsts:fdmalignword
msgid "Align"
msgstr "Выравнивание"

#: lazarusidestrconsts:lisalignment
msgid "Alignment"
msgstr "Выравнивание"

#: lazarusidestrconsts:lisemdall
msgid "All"
msgstr "Все"

#: lazarusidestrconsts:lisallfiles
msgid "All Files"
msgstr "Все файлы"

#: lazarusidestrconsts:lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Все блоки выглядят нормально."

#: lazarusidestrconsts:dlgallfiles
msgid "All files"
msgstr "Все файлы"

#: lazarusidestrconsts:lisedtdefallpackages
msgid "All packages"
msgstr "Все пакеты"

#: lazarusidestrconsts:lisedtdefsallprojects
msgid "All projects"
msgstr "Все проекты"

#: lazarusidestrconsts:lisccotestssuccess
msgid "All tests succeeded."
msgstr "Все тесты прошли успешно."

#: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Все ваши изменения в %s%s%s%sбудут утеряны и файл откроется повторно."

#: lazarusidestrconsts:lisallowfunctio
msgid "Allow Function Calls"
msgstr "Разрешить вызовы функций"

#: lazarusidestrconsts:dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Разрешить LABEL и GOTO"

#: lazarusidestrconsts:lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Разрешить поиск для нескольких строк"

#: lazarusidestrconsts:dlgalphabetically
msgid "Alphabetically"
msgstr "По алфавиту"

#: lazarusidestrconsts:lisedtexttoolalt
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts:dlgaltsetclmode
msgid "Alt-Key sets column mode"
msgstr "Кнопка Alt изменяет режим колонок"

#: lazarusidestrconsts:lisalternativekey
msgid "Alternative key"
msgstr "Альтернативная клавиша"

#: lazarusidestrconsts:lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Альтернативная клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts:srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Альтернативная клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts:lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Всегда собирать перед запуском"

#: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Собирать всегда (даже при отсутствии изменений)"

#: lazarusidestrconsts:dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Всегда видимый курсор"

#: lazarusidestrconsts:lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Неясный тип предка"

#: lazarusidestrconsts:lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Неясное имя класса"

#: lazarusidestrconsts:lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Двусмысленное имя модуля"

#: lazarusidestrconsts:lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Найден модуль с тем же именем"

#: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Найден дополнительный файл настроек компилятора с тем же именем"

#: lazarusidestrconsts:lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Дублирующийся компилятор"

#: lazarusidestrconsts:dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Неясное действие с файлом:"

#: lazarusidestrconsts:lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Найдены разные файлы"

#: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Найден неправильный файл: %s%s%s%sОн может быть перепутан с %s%s%s%s%sУдалить этот файл?"

#: lazarusidestrconsts:lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Найдены разные файлы"

#: lazarusidestrconsts:lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Найден дублирующийся модуль"

#: lazarusidestrconsts:lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Найдены модули с одинаково опознаваемыми именами"

#: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Во время загрузки %s при последнем запуске произошла ошибка!%s%sЗагрузить проект снова?"

#: lazarusidestrconsts:lisa2pancestortype
msgid "Ancestor Type"
msgstr "Тип предка"

#: lazarusidestrconsts:lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Редактор привязок - не выбран компонент"

#: lazarusidestrconsts:lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Привязка к нижней части соседа, сохранять зазор"

#: lazarusidestrconsts:lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Привязка к левой части соседа, сохранять зазор"

#: lazarusidestrconsts:lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Привязка к правой части соседа, сохранять зазор"

#: lazarusidestrconsts:lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Привязка к верхней части соседа, сохранять зазор"

#: lazarusidestrconsts:lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Привязки выбранных компонентов"

#: lazarusidestrconsts:lismakeresstrappendtosection
msgid "Append to section"
msgstr "Добавить к секции"

#: lazarusidestrconsts:dlgpoapplication
msgid "Application"
msgstr "Приложение"

#: lazarusidestrconsts:dlgapplicationsettings
msgid "Application Settings"
msgstr "Параметры приложения"

#: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra
msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgstr "Приложение%sГрафическая программа на LCL/FreePascal. Программный файл автоматически поддерживается lazarus."

#: lazarusidestrconsts:dlgbutapply
msgid "Apply"
msgstr "Применить"

#: lazarusidestrconsts:lispckeditapplychanges
msgid "Apply changes"
msgstr "Применить"

#: lazarusidestrconsts:rslanguagearabic
msgid "Arabic"
msgstr "Арабский"

#: lazarusidestrconsts:dlgcoasis
msgid "As-Is"
msgstr "Как-есть"

#: lazarusidestrconsts:lissortselascending
msgid "Ascending"
msgstr "Наследуемый"

#: lazarusidestrconsts:dlgenvask
msgid "Ask"
msgstr "Спросить"

#: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Спросить перед заменой каждого фрагмента"

#: lazarusidestrconsts:dlgcoasmstyle
msgid "Assembler style:"
msgstr "Стиль ассемблера:"

#: lazarusidestrconsts:liscodetoolsoptsat
msgid "At"
msgstr "At"

#: lazarusidestrconsts:lispckoptsauthor
msgid "Author:"
msgstr "Автор"

#: lazarusidestrconsts:liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Автозавершение при обнаружении..."

#: lazarusidestrconsts:dlgautoform
msgid "Auto create form when opening unit"
msgstr "Автосоздание форм при открытии модуля"

#: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Автосоздаваемые элементы не могут ни редактироваться,%s ни содержать неавтосоздаваемые дочерние элементы"

#: lazarusidestrconsts:dlgautodel
msgid "Auto delete file"
msgstr "Автоматически удалить файл"

#: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Автосоздаваемые элементы не могут редактироваться."

#: lazarusidestrconsts:dlgautoident
msgid "Auto indent"
msgstr "Автоматический отступ"

#: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Автоматически пересобирать при пересборке всех"

#: lazarusidestrconsts:dlgautoren
msgid "Auto rename file lowercase"
msgstr "Переименовать в нижний регистр"

#: lazarusidestrconsts:dlgautosave
msgid "Auto save"
msgstr "Автосохранение"

#: lazarusidestrconsts:lisautoshowobjectinspector
msgid "Auto show Object Inspector"
msgstr "Показывать инспектор объектов автоматически"

#: lazarusidestrconsts:dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автосоздаваемые формы:"

#: lazarusidestrconsts:lispckexplautocreated
msgid "AutoCreated"
msgstr "Автосоздан"

#: lazarusidestrconsts:rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Автоматически (или английский)"

#: lazarusidestrconsts:lisautomaticfeatures
msgid "Automatic features"
msgstr "Автоматические функции"

#: lazarusidestrconsts:rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Автоматически наращивать номер сборки"

#: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Автоматически увеличивать версию при сборке"

#: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автоустановленные пакеты"

#: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Автоматически пересобирать по необходимости"

#: lazarusidestrconsts:dlgavailableforms
msgid "Available forms:"
msgstr "Доступные формы:"

#: lazarusidestrconsts:lisavailablepackages
msgid "Available packages"
msgstr "Доступные пакеты"

#: lazarusidestrconsts:rsavailablescanners
msgid "Available scanners"
msgstr "Доступные лексические анализаторы"

#: lazarusidestrconsts:dlgedback
msgid "Back"
msgstr "Назад"

#: lazarusidestrconsts:fdmorderbackone
msgid "Back one"
msgstr "На один назад"

#: lazarusidestrconsts:dlgbackcolor
msgid "Background"
msgstr "Фон"

#: lazarusidestrconsts:dlgenvbckup
msgid "Backup"
msgstr "Резервирование"

#: lazarusidestrconsts:lisbackupfilefailed
msgid "Backup file failed"
msgstr "Резервирование не удалось"

#: lazarusidestrconsts:dlgbehindmethods
msgid "Behind methods"
msgstr "После методов"

#: lazarusidestrconsts:lispkgfiletypebinary
msgid "Binary"
msgstr "Двоичный"

#: lazarusidestrconsts:liscodetoolsdefsblock
msgid "Block"
msgstr "Блок"

#: lazarusidestrconsts:dlgblockindent
msgid "Block indent"
msgstr "Отступ блока"

#: lazarusidestrconsts:dlgedbold
msgid "Bold"
msgstr "Жирный"

#: lazarusidestrconsts:uembookmarkn
msgid "Bookmark"
msgstr "Закладка"

#: lazarusidestrconsts:lisborderspace
msgid "BorderSpace"
msgstr "Зазор"

#: lazarusidestrconsts:lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Зазор вокруг компонента. Остальные четыре значения зазоров добавляются к этому."

#: lazarusidestrconsts:lisbottom
msgid "Bottom"
msgstr "Вниз"

#: lazarusidestrconsts:lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Нижняя привязка"

#: lazarusidestrconsts:lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Нижний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства под компонентом."

#: lazarusidestrconsts:lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Равномерно по нижним краям"

#: lazarusidestrconsts:lisbottoms
msgid "Bottoms"
msgstr "Нижние края"

#: lazarusidestrconsts:dlgbrachighlight
msgid "Bracket highlighting"
msgstr "Подсветка скобок"

#: lazarusidestrconsts:lisbreak
msgid "Break"
msgstr "Останов"

#: lazarusidestrconsts:lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Разбить строки в выделенном"

#: lazarusidestrconsts:srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Разорвать строку, сдвинуть курсор"

#: lazarusidestrconsts:srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Разорвать строку, оставить курсор"

#: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions
msgid "Break on Lazarus Exceptions"
msgstr "Останов при исключениях Lazarus"

#: lazarusidestrconsts:lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Точки останова"

#: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Точка останова"

#: lazarusidestrconsts:lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Нарушенные зависимости"

#: lazarusidestrconsts:lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Нарушенная зависимость"

#: lazarusidestrconsts:lispatheditbrowse
msgid "Browse"
msgstr "Обзор"

#: lazarusidestrconsts:lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Обзор (поиск компилятора) (%s)"

#: lazarusidestrconsts:lismenubuild
msgid "Build"
msgstr "Собрать"

#: lazarusidestrconsts:lislazbuildqbobuildall
msgid "Build All"
msgstr "Собрать все"

#: lazarusidestrconsts:lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Собрать CodeTools"

#: lazarusidestrconsts:lisbfbuildcommand
msgid "Build Command"
msgstr "Команда Собрать"

#: lazarusidestrconsts:lismenubuildfile
msgid "Build File"
msgstr "Собрать файл"

#: lazarusidestrconsts:lislazbuildbuildide
msgid "Build IDE"
msgstr "Собрать IDE"

#: lazarusidestrconsts:lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "Собрать IDE с пакетами"

#: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "Собрать IDE без пакетов"

#: lazarusidestrconsts:lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Собрать JITForm"

#: lazarusidestrconsts:lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "Собрать LCL"

#: lazarusidestrconsts:lismenubuildlazarus
msgid "Build Lazarus"
msgstr "Собрать Lazarus"

#: lazarusidestrconsts:lisbuildnumber
msgid "Build Number"
msgstr "Номер сборки"

#: lazarusidestrconsts:lislazbuildbuildoptions
msgid "Build Options"
msgstr "Параметры сборки"

#: lazarusidestrconsts:lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Собрать SynEdit"

#: lazarusidestrconsts:lismenubuildall
msgid "Build all"
msgstr "Собрать все"

#: lazarusidestrconsts:liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Собрать все файлы проекта/программы"

#: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Собрать компоненты (SynEdit, CodeTools)"

#: lazarusidestrconsts:lislazbuildbuildexamples
msgid "Build examples"
msgstr "Собрать примеры"

#: lazarusidestrconsts:srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Собрать lazarus"

#: lazarusidestrconsts:lisbuildnewproject
msgid "Build new project"
msgstr "Собрать новый проект"

#: lazarusidestrconsts:liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Собрать проект/программу"

#: lazarusidestrconsts:rsbuild
msgid "Build:"
msgstr "Сборка:"

#: lazarusidestrconsts:dlgcmacro
msgid "C Style Macros (global)"
msgstr "Макросы в стиле C (глобально)"

#: lazarusidestrconsts:dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Операторы в стиле C (*=, +=, /= and -=)"

#: lazarusidestrconsts:dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE в стиле C++"

#: lazarusidestrconsts:lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Ключ CVS"

#: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Вызвать процедуру %sRegister%s выбранного модуля"

#: lazarusidestrconsts:lismenuviewcallstack
msgid "Call Stack"
msgstr "Стек вызовов"

#: lazarusidestrconsts:liscocallon
msgid "Call on:"
msgstr "Вызов:"

#: lazarusidestrconsts:liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Вызов %s для создания Makefile из %s не удался."

#: lazarusidestrconsts:liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Невозможно скопировать компонент верхнего уровня."

#: lazarusidestrconsts:liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Невозможно создать файл %s%s%s"

#: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Невозможно зарегистрировать компоненты без модуля"

#: lazarusidestrconsts:liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Возможно только изменить класс TComponents."

#: lazarusidestrconsts:dlgcancel
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts:liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Отменить загрузку этого компонента"

#: lazarusidestrconsts:liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Отменить загрузку модуля"

#: lazarusidestrconsts:liscancelrenaming
msgid "Cancel renaming"
msgstr "Отменить переименование"

#: lazarusidestrconsts:lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Невозможно найти список участников"

#: lazarusidestrconsts:liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Невозможно найти пускатель lazarus:%s%s"

#: lazarusidestrconsts:lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Игнорировать регистр"

#: lazarusidestrconsts:rslanguagecatalan
msgid "Catalan"
msgstr "Каталанский"

#: lazarusidestrconsts:liscecategories
msgid "Categories"
msgstr "Категории"

#: lazarusidestrconsts:listtodolcategory
msgid "Category"
msgstr "Категория"

#: lazarusidestrconsts:dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Курсор в центре"

#: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Расположить компонент по центру по горизонтали относительно данного"

#: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Расположить компонент по центру по вертикали относительно данного"

#: lazarusidestrconsts:liscenterinwindow
msgid "Center in window"
msgstr "Центр окна"

#: lazarusidestrconsts:liscenters
msgid "Centers"
msgstr "Центры"

#: lazarusidestrconsts:liscodetemplchange
msgid "Change"
msgstr "Изменить"

#: lazarusidestrconsts:lischangeclass
msgid "Change Class"
msgstr "Изменить класс"

#: lazarusidestrconsts:lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Изменить класс %s"

#: lazarusidestrconsts:lischangeencoding
msgid "Change Encoding"
msgstr "Смена кодировки"

#: lazarusidestrconsts:lisplistchangefont
msgid "Change Font"
msgstr "Сменить шрифт"

#: lazarusidestrconsts:lischangefile
msgid "Change file"
msgstr "Изменить файл"

#: lazarusidestrconsts:lischangeparent
msgid "Change parent ..."
msgstr "Сменить родителя ..."

#: lazarusidestrconsts:lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Элемент ChangeLog"

#: lazarusidestrconsts:lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Изменённые файлы:"

#: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Изменение имени пакета или версии нарушит зависимости. Изменить ли эти зависимости?%sВыберите Да для замены всех перечисленных зависимостей.%sПропуск - для разрыва зависимостей и продолжения."

#: lazarusidestrconsts:srkmecchar
msgid "Char"
msgstr "Символ"

#: lazarusidestrconsts:lischaracter
msgid "Character"
msgstr "Символ"

#: lazarusidestrconsts:lischaractermap
msgid "Character Map"
msgstr "Таблица символов"

#: lazarusidestrconsts:rscharacterset
msgid "Character set:"
msgstr "Набор символов:"

#: lazarusidestrconsts:lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Проверить файл LFM в редакторе"

#: lazarusidestrconsts:lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Проверять изменения на диске при загрузке"

#: lazarusidestrconsts:dlgcheckconsistency
msgid "Check consistency"
msgstr "Целостность?"

#: lazarusidestrconsts:lischeckoptions
msgid "Check options"
msgstr "Проверка параметров"

#: lazarusidestrconsts:dlgccocaption
msgid "Checking compiler options"
msgstr "Проверка параметров компилятора"

#: lazarusidestrconsts:dlgcochecks
msgid "Checks:"
msgstr "Проверки"

#: lazarusidestrconsts:rslanguagechinese
msgid "Chinese"
msgstr "Китайский"

#: lazarusidestrconsts:lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Выбрать каталог файлов .po"

#: lazarusidestrconsts:lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Выберите пакет Delphi (*.dpk)"

#: lazarusidestrconsts:lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Выберите проект Delphi (*.dpr)"

#: lazarusidestrconsts:lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Выберите модуль Delphi (*.pas)"

#: lazarusidestrconsts:lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Выберите каталог"

#: lazarusidestrconsts:lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Выберите каталог исходного кода FPC"

#: lazarusidestrconsts:liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Выберите схему привязки клавиш"

#: lazarusidestrconsts:lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Выберите каталог Lazarus"

#: lazarusidestrconsts:lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Выбрать схему"

#: lazarusidestrconsts:lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Выбор ссылки FPDoc"

#: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Выберите базовый класс для избранного свойства %s%s%s."

#: lazarusidestrconsts:lischooseadifferentname
msgid "Choose a different name"
msgstr "Выберите другое имя"

#: lazarusidestrconsts:lischooseakey
msgid "Choose a key ..."
msgstr "Выберите клавишу ..."

#: lazarusidestrconsts:dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Выберите файл шаблонов кода (*.dci)"

#: lazarusidestrconsts:lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Выберите имя компилятора (%s)"

#: lazarusidestrconsts:lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Выберите имя отладчика"

#: lazarusidestrconsts:lischoosedirectory
msgid "Choose directory"
msgstr "Выбор каталога"

#: lazarusidestrconsts:lischoosemakepath
msgid "Choose make path"
msgstr "Выберите путь make"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Выберите один из этих элементов для создания нового файла"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Выберите один из этих элементов для создания нового пакета"

#: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Выберите один из этих элементов для создания нового проекта"

#: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Выберите один из этих элементов для наследования от уже существующего"

#: lazarusidestrconsts:lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Выберите каталог для вывода исполнимого файла IDE "

#: lazarusidestrconsts:lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Выберите файл исходного кода программы (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts:lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Выберите структуру для заключения в неё выделения"

#: lazarusidestrconsts:lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Выберите каталог для проб"

#: lazarusidestrconsts:lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Циклическая зависимость пакетов"

#: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Класс %s%s%s - не зарегистрированный класс компонента.%sНе могу вставить."

#: lazarusidestrconsts:lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Класс %s%s%s не найден."

#: lazarusidestrconsts:lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Класс %s%s%s метода %s%s%s не найден."

#: lazarusidestrconsts:lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Имя класса уже существует"

#: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Класс конфликтует с файлом .lfm:%sМодуль %s%sиспользует модуль %s,%sкоторый содержит класс %s,%sно файл .lfm уже содержит другой класс. %sВ модуле может быть только один такой класс. %sПереместите %s в другой модуль."

#: lazarusidestrconsts:lisclassnotfound
msgid "Class not found"
msgstr "Класс не найден"

#: lazarusidestrconsts:dlgcdtclassorder
msgid "Class order"
msgstr "В порядке классов"

#: lazarusidestrconsts:dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Политика вставки частей класса"

#: lazarusidestrconsts:liskmclassic
msgid "Classic"
msgstr "Классическая"

#: lazarusidestrconsts:liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистить каталог"

#: lazarusidestrconsts:liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистить каталог исходного кода Lazarus"

#: lazarusidestrconsts:lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Очистить + Собрать все"

#: lazarusidestrconsts:lislazbuildcleanall
msgid "Clean all"
msgstr "Очистить все"

#: lazarusidestrconsts:lismenucleandirectory
msgid "Clean directory ..."
msgstr "Очистить каталог ..."

#: lazarusidestrconsts:liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистить подкаталоги"

#: lazarusidestrconsts:liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Очистить путь к модулям?"

#: lazarusidestrconsts:lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Очистить+Собрать"

#: lazarusidestrconsts:lisuidclear
msgid "Clear"
msgstr "Очистить"

#: lazarusidestrconsts:liscleardirectory
msgid "Clear Directory?"
msgstr "Очистить каталог?"

#: lazarusidestrconsts:lispckeditcleardependencydefaultfilename
msgid "Clear dependency filename"
msgstr "Очистить имя файла зависимости"

#: lazarusidestrconsts:lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Очистить кэш включаемых файлов"

#: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Очищать протокол при запуске"

#: lazarusidestrconsts:lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Щёлкните здесь для выбора файла"

#: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Выберите один из элементов выше, чтобы увидеть разницу"

#: lazarusidestrconsts:lismenuclose
msgid "Close"
msgstr "Закрыть"

#: lazarusidestrconsts:liskmcloseall
msgid "Close All"
msgstr "Закрыть всё"

#: lazarusidestrconsts:lismenucloseproject
msgid "Close Project"
msgstr "Закрыть проект"

#: lazarusidestrconsts:lismenucloseall
msgid "Close all editor files"
msgstr "Закрыть все файлы редактора"

#: lazarusidestrconsts:lissrclosepage
msgid "Close page"
msgstr "Закрыть страницу"

#: lazarusidestrconsts:liskmcloseproject
msgid "Close project"
msgstr "Закрыть проект"

#: lazarusidestrconsts:dlgcodegeneration
msgid "Code"
msgstr "Код"

#: lazarusidestrconsts:lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Браузер кода"

#: lazarusidestrconsts:dlgcodecreation
msgid "Code Creation"
msgstr "Создание кода"

#: lazarusidestrconsts:lismenuviewcodeexplorer
msgid "Code Explorer"
msgstr "Обозреватель кода"

#: lazarusidestrconsts:lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Шаблоны кода ..."

#: lazarusidestrconsts:dlgcodetoolstab
msgid "Code Tools"
msgstr "CodeTools"

#: lazarusidestrconsts:liscodebrowser
msgid "Code browser"
msgstr "Браузер кода"

#: lazarusidestrconsts:dlgusecodefolding
msgid "Code folding"
msgstr "Сворачивание кода"

#: lazarusidestrconsts:liscodegenerationoptions
msgid "Code generation options"
msgstr "Параметры генерации кода"

#: lazarusidestrconsts:dlgedcodeparams
msgid "Code parameters"
msgstr "Параметры кода"

#: lazarusidestrconsts:srkmecautocompletion
msgid "Code template completion"
msgstr "Завершение шаблонов кода"

#: lazarusidestrconsts:dlgedcodetempl
msgid "Code templates"
msgstr "Шаблоны кода"

#: lazarusidestrconsts:lisceocodeexplorer
msgid "CodeExplorer Options"
msgstr "Параметры обозревателя кода"

#: lazarusidestrconsts:liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - средства и функции для разбора, просмотра и редактирования исходного кода на Паскале"

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Просмотр определений CodeTools"

#: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметры каталогов CodeTools"

#: lazarusidestrconsts:dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Параметры CodeTools"

#: lazarusidestrconsts:lismenucodetoolsoptions
msgid "CodeTools Options ..."
msgstr "Параметры CodeTools ..."

#: lazarusidestrconsts:srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команды CodeTools"

#: lazarusidestrconsts:liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts:lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Редактор определений CodeTools ..."

#: lazarusidestrconsts:liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Параметры CodeTools"

#: lazarusidestrconsts:srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts:srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Параметры Codetools"

#: lazarusidestrconsts:liscollapseallclasses
msgid "Collapse all classes"
msgstr "Свернуть все классы"

#: lazarusidestrconsts:liscollapseallpackages
msgid "Collapse all packages"
msgstr "Свернуть все пакеты"

#: lazarusidestrconsts:liscollapseallunits
msgid "Collapse all units"
msgstr "Свернуть все модули"

#: lazarusidestrconsts:lismenucollectpofil
msgid "Collect .po files"
msgstr "Собрать файлы .po"

#: lazarusidestrconsts:liscodetoolsoptscolon
msgid "Colon"
msgstr "Колонка"

#: lazarusidestrconsts:dlgedcolor
msgid "Color"
msgstr "Цвет"

#: lazarusidestrconsts:dlgclrscheme
msgid "Color Scheme"
msgstr "Цветовая схема"

#: lazarusidestrconsts:dlgenvcolors
msgid "Colors"
msgstr "Цвета"

#: lazarusidestrconsts:srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим выбора колонки"

#: lazarusidestrconsts:liscodetoolsoptscomma
msgid "Comma"
msgstr "Запятая"

#: lazarusidestrconsts:liscommandafter
msgid "Command after"
msgstr "Команда после"

#: lazarusidestrconsts:liscommandafterinvalid
msgid "Command after invalid"
msgstr "Команда \"после\" некорректна"

#: lazarusidestrconsts:liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Команда после установки модуля"

#: lazarusidestrconsts:srkmcatcmdcmd
msgid "Command commands"
msgstr "Управляющие команды"

#: lazarusidestrconsts:dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Параметры командной строки"

#: lazarusidestrconsts:dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметры командной строки (без имени приложения)"

#: lazarusidestrconsts:liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметры командной строки программы"

#: lazarusidestrconsts:liscocommand
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts:lismenucommentselection
msgid "Comment selection"
msgstr "Закомментировать"

#: lazarusidestrconsts:liscodetemplcomment
msgid "Comment:"
msgstr "Комментарий:"

#: lazarusidestrconsts:liscomments
msgid "Comments:"
msgstr "Комментарии:"

#: lazarusidestrconsts:liscompany
msgid "Company:"
msgstr "Компания:"

#: lazarusidestrconsts:dlgcocompilation
msgid "Compilation"
msgstr "Компиляция"

#: lazarusidestrconsts:liscocalloncompile
msgid "Compile"
msgstr "Компилировать"

#: lazarusidestrconsts:liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Компиляция IDE (без сборки)"

#: lazarusidestrconsts:lisinfobuildcaption
msgid "Compile Project"
msgstr "Компиляция проекта"

#: lazarusidestrconsts:lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Собрать всё?"

#: lazarusidestrconsts:lispckeditcompilepackage
msgid "Compile package"
msgstr "Собрать пакет"

#: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "добавление CompiledSrcPath"

#: lazarusidestrconsts:liscompiler
msgid "Compiler"
msgstr "Компилятор"

#: lazarusidestrconsts:dlgcompileroptions
msgid "Compiler Options"
msgstr "Параметры компилятора"

#: lazarusidestrconsts:lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Параметры компилятора ..."

#: lazarusidestrconsts:lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Параметры компилятора для пакета %s"

#: lazarusidestrconsts:liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Параметры компилятора для проекта: %s"

#: lazarusidestrconsts:liscompilererror
msgid "Compiler error"
msgstr "Ошибка компилятора"

#: lazarusidestrconsts:liscompilerfilename
msgid "Compiler filename"
msgstr "Имя файла компилятора"

#: lazarusidestrconsts:liskmcompileroptions
msgid "Compiler options"
msgstr "Параметры компилятора"

#: lazarusidestrconsts:dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Путь компилятора (%s)"

#: lazarusidestrconsts:lisinfobuildcomplile
msgid "Compiling..."
msgstr "Компиляция..."

#: lazarusidestrconsts:lismenucompletecode
msgid "Complete Code"
msgstr "Завершить код"

#: lazarusidestrconsts:srkmeccompletecode
msgid "Complete code"
msgstr "Завершить код"

#: lazarusidestrconsts:dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершать свойства"

#: lazarusidestrconsts:liscomponent
msgid "Component"
msgstr "Компонент"

#: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Класс компонента %s%s%s уже определён"

#: lazarusidestrconsts:liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Имя компонента %s%s%s зарезервировано"

#: lazarusidestrconsts:liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Имя компонента %s%s%s - некорректный идентификатор"

#: lazarusidestrconsts:lisfpcomponents
msgid "Components"
msgstr "Компоненты"

#: lazarusidestrconsts:liscondition
msgid "Condition"
msgstr "Условие"

#: lazarusidestrconsts:rsconditionaldefines
msgid "Conditional defines"
msgstr "Условные определения"

#: lazarusidestrconsts:liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Параметры %sсборки файла%s"

#: lazarusidestrconsts:dlgconfigfiles
msgid "Config Files:"
msgstr "Файлы настроек"

#: lazarusidestrconsts:lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Параметры сборки Lazarus"

#: lazarusidestrconsts:lisconfigurebuild
msgid "Configure Build %s"
msgstr "Параметры сборки %s"

#: lazarusidestrconsts:lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Параметры сборки+запуска ..."

#: lazarusidestrconsts:liskmconfigurehelp
msgid "Configure Help"
msgstr "Параметры справки"

#: lazarusidestrconsts:lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Параметры справки ..."

#: lazarusidestrconsts:lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Параметры сборки Lazarus ..."

#: lazarusidestrconsts:liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Настройка пользовательских компонентов"

#: lazarusidestrconsts:lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Настройка пользовательских компонентов ..."

#: lazarusidestrconsts:lismenusettings
msgid "Configure custom tools ..."
msgstr "Настройка пользовательских средств ..."

#: lazarusidestrconsts:liskmconfigureinstalledpackages
msgid "Configure installed packages"
msgstr "Настройка установленных пакетов"

#: lazarusidestrconsts:lismenueditinstallpkgs
msgid "Configure installed packages ..."
msgstr "Настройка установленных пакетов ..."

#: lazarusidestrconsts:lislazbuildconfirmbuild
msgid "Confirm before rebuilding Lazarus"
msgstr "Спросить перед пересборкой Lazarus"

#: lazarusidestrconsts:lisconfirmchanges
msgid "Confirm changes"
msgstr "Подтвердить изменения"

#: lazarusidestrconsts:lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Подтвердите удаление зависимости"

#: lazarusidestrconsts:lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Подтвердите новый набор пакетов для IDE"

#: lazarusidestrconsts:lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Подтвердите удаление файла"

#: lazarusidestrconsts:liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Подтвердите замену"

#: lazarusidestrconsts:srkmconflic
msgid "Conflict "
msgstr "Конфликт "

#: lazarusidestrconsts:lispeconflictfound
msgid "Conflict found"
msgstr "Найден конфликт"

#: lazarusidestrconsts:lisconsoleapplication
msgid "Console application"
msgstr "Консольное приложение"

#: lazarusidestrconsts:lisceconstants
msgid "Constants"
msgstr "Константы"

#: lazarusidestrconsts:lisconstructorcode
msgid "Constructor code"
msgstr "Код конструктора"

#: lazarusidestrconsts:dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор должен быть 'init' (деструктор - 'done')"

#: lazarusidestrconsts:lismenutemplatecontents
msgid "Contents"
msgstr "Содержание"

#: lazarusidestrconsts:lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Справка, зависимая от контекста"

#: lazarusidestrconsts:liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Контекстно-зависимая справка"

#: lazarusidestrconsts:liscontinue
msgid "Continue"
msgstr "Продолжить"

#: lazarusidestrconsts:liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Продолжить, не загружая форму"

#: lazarusidestrconsts:liscontributors
msgid "Contributors"
msgstr "Участники"

#: lazarusidestrconsts:liscontrolneedsparent
msgid "Control needs parent"
msgstr "Элемент управления требует \"родителя\""

#: lazarusidestrconsts:lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Параметры преобразований"

#: lazarusidestrconsts:lisconversionerror
msgid "Conversion error"
msgstr "Ошибка преобразования"

#: lazarusidestrconsts:lisconvert
msgid "Convert"
msgstr "Преобразовать"

#: lazarusidestrconsts:liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Преобразовать файл DFM в LFM"

#: lazarusidestrconsts:lismenuconvertdfmtolfm
msgid "Convert DFM file to LFM ..."
msgstr "Преобразовать файл DFM в LFM ..."

#: lazarusidestrconsts:lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Преобразовать проект Delphi"

#: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Преобразовать пакет Delphi в пакет Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Преобразовать пакет Delphi в пакет Lazarus ..."

#: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Преобразовать проект Delphi в проект Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Преобразовать проект Delphi в проект Lazarus ..."

#: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Преобразовать модуль Delphi в модуль Lazarus"

#: lazarusidestrconsts:lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Преобразовать модуль Delphi в Lazarus ..."

#: lazarusidestrconsts:lisconvertencoding
msgid "Convert encoding"
msgstr "Преобразование кодировки"

#: lazarusidestrconsts:lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Преобразовать кодировку проектов/пакетов"

#: lazarusidestrconsts:lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Преобразовать кодировку проектов/пакетов ..."

#: lazarusidestrconsts:liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Преобразовать элемент"

#: lazarusidestrconsts:lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Преобразование проекта либо пакета"

#: lazarusidestrconsts:srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"

#: lazarusidestrconsts:lismenucopy
msgid "Copy"
msgstr "Копировать"

#: lazarusidestrconsts:liscopyall
msgid "Copy All"
msgstr "Копировать все"

#: lazarusidestrconsts:liscopyerror
msgid "Copy Error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard
msgid "Copy all and hidden messages to clipboard"
msgstr "Копировать все (и скрытые тоже) сообщения в буфер обмена"

#: lazarusidestrconsts:liscopyallmessagestoclipboard
msgid "Copy all messages to clipboard"
msgstr "Скопировать все сообщения в буфер"

#: lazarusidestrconsts:liscopyerror2
msgid "Copy error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts:uemcopyfilename
msgid "Copy filename"
msgstr "Копировать имя файла"

#: lazarusidestrconsts:lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Копировать из унаследованного"

#: lazarusidestrconsts:lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Копировать имя метода в буфер обмена"

#: lazarusidestrconsts:lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Копировать вывод в буфер обмена"

#: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Копировать выбранные компоненты в буфер обмена"

#: lazarusidestrconsts:lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Копировать выбранные компоненты в буфер"

#: lazarusidestrconsts:liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Копировать выделенные сообщения в буфер обмена"

#: lazarusidestrconsts:srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Копировать выделение в буфер"

#: lazarusidestrconsts:lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Копировать информацию о версии в буфер обмена"

#: lazarusidestrconsts:dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Копировать слово при пустом выделении"

#: lazarusidestrconsts:liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копирование всей формы не реализовано."

#: lazarusidestrconsts:rscopyright
msgid "Copyright:"
msgstr "Копирайт:"

#: lazarusidestrconsts:dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Счетчик (.pp;1)"

#: lazarusidestrconsts:lisnpcreate
msgid "Create"
msgstr "Создать"

#: lazarusidestrconsts:lismenucreatepofile
msgid "Create .po files"
msgstr "Создать файлы .po"

#: lazarusidestrconsts:dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Создать Application Bundle"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Создать определения для кталога %s"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Создать определения для проекта %s"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Создать определения для компилятора FreePascal"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Создать определения для исходного кода  FreePascal из SVN"

#: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Создать определения для каталога Lazarus"

#: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Создать макросы FPC и пути к каталогу проекта FPC"

#: lazarusidestrconsts:lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Создать файлы FPDoc"

#: lazarusidestrconsts:liscreatehelpnode
msgid "Create Help node"
msgstr "Создать элемент справки"

#: lazarusidestrconsts:dlgcocreatemakefile
msgid "Create Makefile"
msgstr "Создать Makefile"

#: lazarusidestrconsts:lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Создать подменю"

#: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgstr "Создать новое приложение cgi.%sФайл программы поддерживается Lazarus"

#: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Создать новый файл редактора.%s Выберите тип."

#: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Создать новый пустой текстовый файл."

#: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication
msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgstr "Создать новое графическое приложение.%sЭта программа поддерживается Lazarus."

#: lazarusidestrconsts:lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Создать модуль Паскаля."

#: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Создать программу."

#: lazarusidestrconsts:lisnewdlgcreateanewprogram
msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgstr "Создать программу.%sФайл программы поддерживается Lazarus."

#: lazarusidestrconsts:lisnpcreateanewproject
msgid "Create a new project"
msgstr "Создать новый проект"

#: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Создать проект.%sВыберите тип."

#: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Создать стандартный пакет%sПакет - это набор модулей и компонентов."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Создать модуль с формой LCL."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Создать модуль с модулем данных."

#: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame"
msgstr "Создать новый модуль с фреймом"

#: lazarusidestrconsts:liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Создайте сперва проект!"

#: lazarusidestrconsts:liscreatedirectory
msgid "Create directory?"
msgstr "Создать каталог?"

#: lazarusidestrconsts:liscodehelpcreatebutton
msgid "Create help item"
msgstr "Создать элемент справки"

#: lazarusidestrconsts:liscreateit
msgid "Create it"
msgstr "Создать его"

#: lazarusidestrconsts:rscreatenewdefine
msgid "Create new define"
msgstr "Создать новое определение"

#: lazarusidestrconsts:lisa2pcreatenewfile
msgid "Create new file"
msgstr "Создать новый файл"

#: lazarusidestrconsts:liscreatenewproject
msgid "Create new project"
msgstr "Создать новый проект"

#: lazarusidestrconsts:dlgruberbandcreationcolor
msgid "Creation"
msgstr "Создание"

#: lazarusidestrconsts:lisedtexttoolctrl
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts:liscurrent
msgid "Current"
msgstr "Текущий"

#: lazarusidestrconsts:lisedtdefcurrentproject
msgid "Current Project"
msgstr "Текущий проект"

#: lazarusidestrconsts:lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Каталог текущего проекта"

#: lazarusidestrconsts:lismenuinsertdatetime
msgid "Current date and time"
msgstr "Текущие дата и время"

#: lazarusidestrconsts:lismenuinsertusername
msgid "Current username"
msgstr "Текущее имя пользователя"

#: lazarusidestrconsts:dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Курсор вне конца строки"

#: lazarusidestrconsts:liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Колонка курсора в этом редакторе"

#: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Курсор не находится на объявлении класса"

#: lazarusidestrconsts:srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команды перемещения курсора"

#: lazarusidestrconsts:liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Ряд курсора в этом редакторе"

#: lazarusidestrconsts:dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Курсор пропускает выделенное"

#: lazarusidestrconsts:lispckoptscustom
msgid "Custom"
msgstr "Пользовательские"

#: lazarusidestrconsts:liscustomprogram
msgid "Custom Program"
msgstr "Программа пользователя"

#: lazarusidestrconsts:liscustomprogramafreepascalprogram
msgid "Custom Program%sA freepascal program."
msgstr "Программа пользователя%sПрограмма на языке FreePascal"

#: lazarusidestrconsts:liskeycatcustom
msgid "Custom commands"
msgstr "Команды пользователя"

#: lazarusidestrconsts:lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Пользовательский ID"

#: lazarusidestrconsts:liscustomoptions2
msgid "Custom options"
msgstr "Параметры пользователя"

#: lazarusidestrconsts:rsiwpcustomposition
msgid "Custom position"
msgstr "Пользовательская позиция"

#: lazarusidestrconsts:srkmeccustomtool
msgid "Custom tool %d"
msgstr "Средство пользователя %d"

#: lazarusidestrconsts:lismenucut
msgid "Cut"
msgstr "Вырезать"

#: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер обмена"

#: lazarusidestrconsts:lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер"

#: lazarusidestrconsts:srkmeccut
msgid "Cut selection to clipboard"
msgstr "Вырезать выделение в буфер"

#: lazarusidestrconsts:liswldisableall
msgid "D&isable All"
msgstr "О&тключить все"

#: lazarusidestrconsts:lishlpoptsdatabases
msgid "Databases"
msgstr "Базы данных"

#: lazarusidestrconsts:lisdate
msgid "Date"
msgstr "Дата"

#: lazarusidestrconsts:liswldeleteall
msgid "De&lete All"
msgstr "У&далить все"

#: lazarusidestrconsts:uemdebugword
msgid "Debug"
msgstr "Отладка"

#: lazarusidestrconsts:lismenuviewdebugoutput
msgid "Debug output"
msgstr "Вывод отладчика"

#: lazarusidestrconsts:lismenudebugwindows
msgid "Debug windows"
msgstr "Окна отладки"

#: lazarusidestrconsts:lismendebuggeroptions
msgid "Debugger Options ..."
msgstr "Параметры отладчика ..."

#: lazarusidestrconsts:lisdebuggererror
msgid "Debugger error"
msgstr "Ошибка отладчика"

#: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Ошибка отладчика%sОп, отладчик находится в нерабочем состоянии%sСохраните работу!%sНажмите Стоп и надейтесь на лучшее!"

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Общие параметры отладчика"

#: lazarusidestrconsts:lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неправильный отладчик"

#: lazarusidestrconsts:dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Дополнения к путям отладчика (нет):"

#: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Частные параметры отладчика (зависят от типа отладчика)"

#: lazarusidestrconsts:dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип отладчика и путь"

#: lazarusidestrconsts:dlgcodebugging
msgid "Debugging:"
msgstr "Отладка"

#: lazarusidestrconsts:lisdecimal
msgid "Decimal"
msgstr "Десятичное"

#: lazarusidestrconsts:dlgassemblerdefault
msgid "Default"
msgstr "По умолчанию"

#: lazarusidestrconsts:dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Шрифт редактора по умолчанию"

#: lazarusidestrconsts:dlgpasext
msgid "Default pascal extension"
msgstr "Стандартное расширение Паскаля"

#: lazarusidestrconsts:dlgdefvaluecolor
msgid "Default value"
msgstr "Значение по умолчанию"

#: lazarusidestrconsts:liscodetoolsdefsdefine
msgid "Define"
msgstr "Определение"

#: lazarusidestrconsts:liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Определить рекурсивно"

#: lazarusidestrconsts:lisctdefdefinetemplates
msgid "Define templates"
msgstr "Задать шаблоны"

#: lazarusidestrconsts:dlgeddelay
msgid "Delay"
msgstr "Задержка"

#: lazarusidestrconsts:dlgeddelete
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts:lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Удалить все в том же файле исходного кода"

#: lazarusidestrconsts:lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Удалить шаблон формы..."

#: lazarusidestrconsts:lismenueditordeleteitem
msgid "Delete Item"
msgstr "Удалить элемент"

#: lazarusidestrconsts:srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Удалить последний символ"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Удалить старый файл пакета?"

#: lazarusidestrconsts:lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Удалить все точки останова в файле %s%s%s?"

#: lazarusidestrconsts:lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Удалить все точки останова?"

#: lazarusidestrconsts:lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Удалить все выбранные точки останова?"

#: lazarusidestrconsts:lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Удалить все эти файлы?"

#: lazarusidestrconsts:lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Удалить файл с подобным именем?"

#: lazarusidestrconsts:lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Удалить точку останова в%s\"%s\" на строке %d?"

#: lazarusidestrconsts:srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Удалить символ у курсора"

#: lazarusidestrconsts:srkmecdeleteline
msgid "Delete current line"
msgstr "Удалить текущую строку"

#: lazarusidestrconsts:lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Удалить зависимость для %s?"

#: lazarusidestrconsts:lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Удаление не удалось"

#: lazarusidestrconsts:lisdeletefilefailed
msgid "Delete file failed"
msgstr "Удаление файла не удалось"

#: lazarusidestrconsts:liskmdeletelastchar
msgid "Delete last char"
msgstr "Удалить последний символ"

#: lazarusidestrconsts:liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Удалить ссылку"

#: lazarusidestrconsts:liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Удалить элемент"

#: lazarusidestrconsts:lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Удалить старый файл %s%s%s?"

#: lazarusidestrconsts:lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Удалить старый файл?"

#: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Удалить старый файл пакета %s%s%s?"

#: lazarusidestrconsts:lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Удалить выбранные файлы"

#: lazarusidestrconsts:fdmdeleteselection
msgid "Delete selection"
msgstr "Удалить выбранное"

#: lazarusidestrconsts:dlgdeltemplate
msgid "Delete template "
msgstr "Удалить шаблон "

#: lazarusidestrconsts:srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Удалить до начала строки"

#: lazarusidestrconsts:srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Удалить до конца строки"

#: lazarusidestrconsts:srkmecdeleteword
msgid "Delete to end of word"
msgstr "Удалить до конца слова"

#: lazarusidestrconsts:srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Удалить до начала слова"

#: lazarusidestrconsts:srkmecclearall
msgid "Delete whole text"
msgstr "Удалить весь текст"

#: lazarusidestrconsts:lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Удаление файла  %s%s%s не удалось."

#: lazarusidestrconsts:lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts:dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Расширения Delphi 2"

#: lazarusidestrconsts:dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Совместимость с Delphi"

#: lazarusidestrconsts:lisdelphiproject
msgid "Delphi project"
msgstr "Проект Delphi"

#: lazarusidestrconsts:lisa2pdependency
msgid "Dependency"
msgstr "Зависимость"

#: lazarusidestrconsts:lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Свойства зависимости"

#: lazarusidestrconsts:lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Зависимость уже есть"

#: lazarusidestrconsts:lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Зависимость без владельца:%s"

#: lazarusidestrconsts:lissortseldescending
msgid "Descending"
msgstr "По убыванию"

#: lazarusidestrconsts:listodoldescription
msgid "Description"
msgstr "Описание"

#: lazarusidestrconsts:lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Описание или аннотация"

#: lazarusidestrconsts:liscodetoolsdefsdescription
msgid "Description:"
msgstr "Описание:"

#: lazarusidestrconsts:lisoipdescription
msgid "Description:  "
msgstr "Описание: "

#: lazarusidestrconsts:liskeycatdesigner
msgid "Designer commands"
msgstr "Команды дизайнера"

#: lazarusidestrconsts:lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Времени разработки и выполнения"

#: lazarusidestrconsts:lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Только времени разработки"

#: lazarusidestrconsts:dlgdesktop
msgid "Desktop"
msgstr "Рабочий стол"

#: lazarusidestrconsts:dlgdesktopfiles
msgid "Desktop files"
msgstr "Файлы рабочего стола"

#: lazarusidestrconsts:lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Пакет назначения"

#: lazarusidestrconsts:lisdestinationdirectory
msgid "Destination directory"
msgstr "Каталог назначения"

#: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Каталог %s%s%s некорркетен.%sВыберите путь к компилятору."

#: lazarusidestrconsts:lisdestructorcode
msgid "Destructor code"
msgstr "Код деструктора"

#: lazarusidestrconsts:lismenudiff
msgid "Diff"
msgstr "Разница Diff"

#: lazarusidestrconsts:liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Сравнить открытые в редакторе файлы"

#: lazarusidestrconsts:lisdigits
msgid "Digits:"
msgstr "Разряды:"

#: lazarusidestrconsts:dlgdirection
msgid "Direction"
msgstr "Направление"

#: lazarusidestrconsts:lisdirectives
msgid "Directives"
msgstr "Директивы"

#: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Каталог"

#: lazarusidestrconsts:dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Каталог не существует"

#: lazarusidestrconsts:dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Каталог для сборки пробных проектов"

#: lazarusidestrconsts:lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Каталог не найден"

#: lazarusidestrconsts:lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Параметры каталогов"

#: lazarusidestrconsts:lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Отключить все в том же файле исходного кода"

#: lazarusidestrconsts:lisdisablegroup
msgid "Disable Group"
msgstr "Отключить группу"

#: lazarusidestrconsts:lisdisabled
msgid "Disabled"
msgstr "Отключено"

#: lazarusidestrconsts:lisdiscardchanges
msgid "Discard changes"
msgstr "Отбросить изменения"

#: lazarusidestrconsts:dlgeddisplay
msgid "Display"
msgstr "Отображение"

#: lazarusidestrconsts:dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts:dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Выдать номера строк в ошибках времени исполнения"

#: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Различать регистр букв, например, А и а"

#: lazarusidestrconsts:dlgcfdividerdrawlevel
msgid "Divider Draw Level"
msgstr "Уровень изображения разделителя"

#: lazarusidestrconsts:lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Не закрывать  IDE"

#: lazarusidestrconsts:lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Не закрывать проект"

#: lazarusidestrconsts:lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Не сохранять информацию о сеансе работы"

#: lazarusidestrconsts:lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Не показывать начальную заставку"

#: lazarusidestrconsts:lisuedonotsho
msgid "Do not show this message again."
msgstr "Не показывать это сообщение снова."

#: lazarusidestrconsts:dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Не разрывать строку перед:"

#: lazarusidestrconsts:dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Не разрывать строку после:"

#: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Вы действительно хотите сбросить все изменения в пакете %s и загрузить его из файла?"

#: lazarusidestrconsts:lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus?"
msgstr "Вы хотите пересобрать Lazarus?"

#: lazarusidestrconsts:rsiwpdocked
msgid "Docked"
msgstr "Прикреплён"

#: lazarusidestrconsts:lismvdocking
msgid "Docking"
msgstr "Стыковка"

#: lazarusidestrconsts:lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Редактор документации"

#: lazarusidestrconsts:lissortseldomain
msgid "Domain"
msgstr "Домен"

#: lazarusidestrconsts:listodoldone
msgid "Done"
msgstr "Готово"

#: lazarusidestrconsts:dlgdoubleclickline
msgid "Double click line"
msgstr "Выделять строку двойным щелчком"

#: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick
msgid "Double click on messages jumps (otherwise: single click)"
msgstr "Двойной щелчок на переходах по сообщениям (иначе - одинарный)"

#: lazarusidestrconsts:dlgdownword
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts:dlgdragdroped
msgid "Drag Drop editing"
msgstr "Редактирование Drag and Drop"

#: lazarusidestrconsts:dlgdropfiles
msgid "Drop files"
msgstr "Перетаскивание файлов в редактор"

#: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Дублирующееся имя: Компонент с именем %s%s%s уже существует в унаследованном компоненте %s"

#: lazarusidestrconsts:rslanguagedutch
msgid "Dutch"
msgstr "Голландский"

#: lazarusidestrconsts:liswlenableall
msgid "E&nable All"
msgstr "В&ключить все"

#: lazarusidestrconsts:lismenuenvironent
msgid "E&nvironment"
msgstr "Окру&жение"

#: lazarusidestrconsts:lisccoerrormsg
msgid "ERROR: "
msgstr "ОШИБКА: "

#: lazarusidestrconsts:liscodetoolsdefsedit
msgid "Edit"
msgstr "Правка"

#: lazarusidestrconsts:liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Редактировать шаблоны кода"

#: lazarusidestrconsts:lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Изменить общие параметры"

#: lazarusidestrconsts:srkmeditkeys
msgid "Edit Keys"
msgstr "Изменить клавиши"

#: lazarusidestrconsts:lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Изменить параметры компиляции пакета"

#: lazarusidestrconsts:lisedtexttooledittool
msgid "Edit Tool"
msgstr "Параметры пользовательского средства"

#: lazarusidestrconsts:lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Редактировать виртуальный модуль"

#: lazarusidestrconsts:liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Править шаблоны кода"

#: lazarusidestrconsts:liseditcontexthelp
msgid "Edit context help"
msgstr "Редактировать контекстную справку"

#: lazarusidestrconsts:lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Редактировать контекстную справку"

#: lazarusidestrconsts:liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Редактировать контекстную справку"

#: lazarusidestrconsts:liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Настройка пользовательских сканеров (%s)"

#: lazarusidestrconsts:srkmeditforcmd
msgid "Edit keys of command"
msgstr "Редактирование клавиш вызова команды"

#: lazarusidestrconsts:lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Редактировать виртуальный модуль"

#: lazarusidestrconsts:dlgededit
msgid "Edit..."
msgstr "Правка"

#: lazarusidestrconsts:dlgedfiles
msgid "Editor files"
msgstr "Файлы редактора"

#: lazarusidestrconsts:dlgeditorfont
msgid "Editor font"
msgstr "Шрифт редактора"

#: lazarusidestrconsts:dlgeditorfontheight
msgid "Editor font height"
msgstr "Высота шрифта"

#: lazarusidestrconsts:liskmeditoroptions
msgid "Editor options"
msgstr "Параметры редактора"

#: lazarusidestrconsts:lismenueditoroptions
msgid "Editor options ..."
msgstr "Параметры редактора ..."

#: lazarusidestrconsts:uemeditorproperties
msgid "Editor properties"
msgstr "Свойства редактора"

#: lazarusidestrconsts:dlgedelement
msgid "Element"
msgstr "Элемент"

#: lazarusidestrconsts:liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts:liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts:lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Пустые методы"

#: lazarusidestrconsts:lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Включить все в том же файле исходного кода"

#: lazarusidestrconsts:lisenablegroup
msgid "Enable Group"
msgstr "Включить группу"

#: lazarusidestrconsts:lisenablemacros
msgid "Enable Macros"
msgstr "Включить макросы"

#: lazarusidestrconsts:rsenablei18n
msgid "Enable i18n"
msgstr "Включить i18n"

#: lazarusidestrconsts:lisenabled
msgid "Enabled"
msgstr "Включить"

#: lazarusidestrconsts:lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Включена = Добавить %s к привязкам"

#: lazarusidestrconsts:lisenclose
msgid "Enclose"
msgstr "Заключить"

#: lazarusidestrconsts:uemencloseselection
msgid "Enclose Selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts:liskmencloseselection
msgid "Enclose selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts:lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Заключить выделение в ..."

#: lazarusidestrconsts:uemencoding
msgid "Encoding"
msgstr "Кодировка"

#: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Кодировка файла %s%s%s%sна диске - %s. Новой кодировкой будет %s."

#: lazarusidestrconsts:rslanguageenglish
msgid "English"
msgstr "Английский"

#: lazarusidestrconsts:lismacropromptenterdata
msgid "Enter data"
msgstr "Введите данные"

#: lazarusidestrconsts:lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введите параметры запуска"

#: lazarusidestrconsts:lisentertransla
msgid "Enter translation language"
msgstr "Введите язык перевода"

#: lazarusidestrconsts:dlgrunoenvironment
msgid "Environment"
msgstr "Окружение"

#: lazarusidestrconsts:srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Команды меню Окружение"

#: lazarusidestrconsts:lismenugeneraloptions
msgid "Environment options ..."
msgstr "Параметры окружения ..."

#: lazarusidestrconsts:lisccoerrorcaption
msgid "Error"
msgstr "Ошибка"

#: lazarusidestrconsts:lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Ошибка чтения пакета"

#: lazarusidestrconsts:lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Ошибка записи пакета"

#: lazarusidestrconsts:lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Ошибка доступа к XML"

#: lazarusidestrconsts:lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Ошибка доступа к файлу XML %s%s%s:%s%s"

#: lazarusidestrconsts:liserrorcreatingfile
msgid "Error creating file"
msgstr "Ошибка создания файла"

#: lazarusidestrconsts:liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Ошибка создания lrs"

#: lazarusidestrconsts:liserrordeletingfile
msgid "Error deleting file"
msgstr "Ошибка удаления файла"

#: lazarusidestrconsts:liserrorin
msgid "Error in %s"
msgstr "Ошибка в %s"

#: lazarusidestrconsts:lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Ошибка в регулярном выражении"

#: lazarusidestrconsts:liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Ошибка инициализации программы %s%s%s%s%sОшибка: %s"

#: lazarusidestrconsts:liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Ошибка при загрузке %s из%s%s%s%s"

#: lazarusidestrconsts:liserrorloadingfile
msgid "Error loading file"
msgstr "Ошибка загрузки файла"

#: lazarusidestrconsts:lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Ошибка загрузки XML"

#: lazarusidestrconsts:lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Ошибка загрузки файла XML %s%s%s:%s%s"

#: lazarusidestrconsts:liserrormovingcomponent
msgid "Error moving component"
msgstr "Ошибка перемещения компонента"

#: lazarusidestrconsts:liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Ошибка перемещения компонента %s:%s"

#: lazarusidestrconsts:lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Во время создания Application Bundle произошла ошибка: "

#: lazarusidestrconsts:liserroropeningcomponent
msgid "Error opening component"
msgstr "Ошибка при открытии компонента"

#: lazarusidestrconsts:liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Ошибка разбора потока компонента lfm."

#: lazarusidestrconsts:liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Ошибка чтения %s%s%s%s%s"

#: lazarusidestrconsts:liserrorreadingxml
msgid "Error reading XML"
msgstr "Ошибка чтения XML"

#: lazarusidestrconsts:lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Ошибка чтения файла"

#: lazarusidestrconsts:lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Ошибка чтения файла: %s"

#: lazarusidestrconsts:liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Ошибка чтения списка пакетов из файла%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Ошибка чтения файла сведений проекта %s%s%s%s%s"

#: lazarusidestrconsts:liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Ошибка чтения файла XML %s%s%s%s%s"

#: lazarusidestrconsts:liserrorrenamingfile
msgid "Error renaming file"
msgstr "Ошибка переименования файла"

#: lazarusidestrconsts:liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Ошибка при сохранении %s в%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Ошибка записи %s%s%s%s%s"

#: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Ошибка записи проекта в файл %s%s%s%s%s"

#: lazarusidestrconsts:lislazbuilderrorwritingfile
msgid "Error writing file"
msgstr "Ошибка записи файла"

#: lazarusidestrconsts:liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Ошибка записи списка пакетов в файл%s%s%s%s"

#: lazarusidestrconsts:lisinfobuilderror
msgid "Error..."
msgstr "Ошибка..."

#: lazarusidestrconsts:liserror
msgid "Error: "
msgstr "Ошибка:"

#: lazarusidestrconsts:liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Ошибка: неправильный компилятор:%s"

#: lazarusidestrconsts:liserrors
msgid "Errors"
msgstr "Ошибки"

#: lazarusidestrconsts:lisinfobuilderrors
msgid "Errors:"
msgstr "Ошибок:"

#: lazarusidestrconsts:liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Рассчитать/Изменить"

#: lazarusidestrconsts:lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Вычислить/Изменить..."

#: lazarusidestrconsts:lisdebugoptionsfrmeventlog
msgid "Event Log"
msgstr "Протокол событий"

#: lazarusidestrconsts:liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Каждый n-ный номер строки:"

#: lazarusidestrconsts:liscodehelpexampletag
msgid "Example"
msgstr "Пример"

#: lazarusidestrconsts:lisexamples
msgid "Examples"
msgstr "Примеры"

#: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Примеры:%s<Идентификатор>%sTMyEnum.<Перечисление>%s<Имя модуля>.<Идентификатор>%s#<Имя пакета>.<Имя модуля>.<Идентификатор>"

#: lazarusidestrconsts:lisexcludefilter
msgid "Exclude Filter"
msgstr "Исключающий фильтр"

#: lazarusidestrconsts:lisexcludefilter2
msgid "Exclude filter"
msgstr "Исключающий фильтр"

#: lazarusidestrconsts:liscoexecuteafter
msgid "Execute after"
msgstr "Выполнить после"

#: lazarusidestrconsts:liscoexecutebefore
msgid "Execute before"
msgstr "Выполнить перед"

#: lazarusidestrconsts:lisexecutingcommandafter
msgid "Executing command after"
msgstr "Выполнить команду после"

#: lazarusidestrconsts:lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Выполнить команду до"

#: lazarusidestrconsts:lisexecutionpaused
msgid "Execution paused"
msgstr "Выполнение приостановлено"

#: lazarusidestrconsts:lisexecutionpausedadress
msgid "Execution paused%s  Adress: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Выполнение остановлено%s Адрес: %s%s Процедура: %s%s Файл: %s%s(Когда-нибудь здесь появится окно ассемблера :)%s"

#: lazarusidestrconsts:lisexecutionstopped
msgid "Execution stopped"
msgstr "Выполнение остановлено"

#: lazarusidestrconsts:lisexecutionstoppedon
msgid "Execution stopped%s"
msgstr "Выполнение остановлено %s"

#: lazarusidestrconsts:lispldexists
msgid "Exists"
msgstr "Имеется"

#: lazarusidestrconsts:liscodetoolsdefsexit
msgid "Exit"
msgstr "Выход"

#: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Выход без сохранения"

#: lazarusidestrconsts:lisexpandallclasses
msgid "Expand all classes"
msgstr "Развернуть все классы"

#: lazarusidestrconsts:lisexpandallpackages
msgid "Expand all packages"
msgstr "Развернуть все пакеты"

#: lazarusidestrconsts:lisexpandallunits
msgid "Expand all units"
msgstr "Развернуть все модули"

#: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Полное имя файла в данном редакторе"

#: lazarusidestrconsts:lisexport
msgid "Export ..."
msgstr "Экспортировать ..."

#: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Файл экспорта %s%s%s уже существует.%sОткрыть его и заменить только параметры компилятора?%s(Остальные параметры не будут затронуты.)"

#: lazarusidestrconsts:lisiecoexportfileexists
msgid "Export file exists"
msgstr "Файл экспорта уже существует"

#: lazarusidestrconsts:lisexportlist
msgid "Export list"
msgstr "Список экспорта"

#: lazarusidestrconsts:liswlexpression
msgid "Expression"
msgstr "Выражение"

#: lazarusidestrconsts:lisexpression
msgid "Expression:"
msgstr "Выражение:"

#: lazarusidestrconsts:lisextendunitpath
msgid "Extend unit path?"
msgstr "Расширить пути к модулям?"

#: lazarusidestrconsts:liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Настройка внешних средств"

#: lazarusidestrconsts:srkmecexttool
msgid "External tool %d"
msgstr "Внешнее средство %d"

#: lazarusidestrconsts:lisexttoolexternaltools
msgid "External tools"
msgstr "Внешние средства"

#: lazarusidestrconsts:srkmecexttoolsettings
msgid "External tools settings"
msgstr "Параметры внешних средств"

#: lazarusidestrconsts:dlgextracharspacing
msgid "Extra char spacing"
msgstr "Дополнительные символы отступа"

#: lazarusidestrconsts:dlgextralinespacing
msgid "Extra line spacing"
msgstr "Межстрочный интервал"

#: lazarusidestrconsts:lisextract
msgid "Extract"
msgstr "Извлечь"

#: lazarusidestrconsts:uemextractproc
msgid "Extract Procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts:srkmecextractproc
msgid "Extract procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts:lismenuextractproc
msgid "Extract procedure ..."
msgstr "Выделить процедуру ..."

#: lazarusidestrconsts:lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Путь к  HTML-документации FPC"

#: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Каталог исходного кода  FreePascal из SVN"

#: lazarusidestrconsts:lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Ошибка каталога исходного кода FPC"

#: lazarusidestrconsts:lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Версия FPC (например, 2.2.2)"

#: lazarusidestrconsts:lisfpcversion
msgid "FPC Version: "
msgstr "Версия FPC: "

#: lazarusidestrconsts:dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Каталог исходного кода FPC"

#: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Каталог исходного кода FPC \"%s\" не найден."

#: lazarusidestrconsts:lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "путь к модулям FPC содержит файлы исходного кода: "

#: lazarusidestrconsts:lismenufpdoceditor
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts:lisfpdoceditor
msgid "FPDoc editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation
msgid "FPDoc files path"
msgstr "Путь к файлам FPDoc"

#: lazarusidestrconsts:lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Не удалось запустить средство"

#: lazarusidestrconsts:dlgcofast
msgid "Faster Code"
msgstr "Быстрый код"

#: lazarusidestrconsts:lismenutemplatefile
msgid "File"
msgstr "Файл"

#: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Файл %s%s%s уже есть в проекте."

#: lazarusidestrconsts:lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Файл %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Файл %s%s%s виртуальный."

#: lazarusidestrconsts:lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Файл %s%s%s не найден."

#: lazarusidestrconsts:lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Файл %s%s%s не найден.%s"

#: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Файл %s%s%s не найден.%sСоздать его?%s"

#: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне похож на текстовый.%sВсё равно открыть?"

#: lazarusidestrconsts:lispckeditfileproperties
msgid "File Properties"
msgstr "Свойства файла"

#: lazarusidestrconsts:lisfilesettings
msgid "File Settings ..."
msgstr "Параметры файла"

#: lazarusidestrconsts:lisaf2pfiletype
msgid "File Type"
msgstr "Тип файла"

#: lazarusidestrconsts:lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл уже существует"

#: lazarusidestrconsts:lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Файл уже в пакете"

#: lazarusidestrconsts:lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Расширение файла программы"

#: lazarusidestrconsts:dlgfileexts
msgid "File extensions"
msgstr "Расширения файлов"

#: lazarusidestrconsts:lisfilefilter
msgid "File filter"
msgstr "Фильтр файлов"

#: lazarusidestrconsts:lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл уже есть в пакете"

#: lazarusidestrconsts:lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл в проекте"

#: lazarusidestrconsts:lisfileisnotwritable
msgid "File is not writable"
msgstr "В файл нельзя писать"

#: lazarusidestrconsts:uefilerocap
msgid "File is readonly"
msgstr "Файл только для чтения"

#: lazarusidestrconsts:lisfileissymlink
msgid "File is symlink"
msgstr "Файл является символической ссылкой"

#: lazarusidestrconsts:lisa2pfileisused
msgid "File is used"
msgstr "Файл используется"

#: lazarusidestrconsts:lisfilelinkerror
msgid "File link error"
msgstr "Ошибочная ссылка на файл"

#: lazarusidestrconsts:lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Маска файла (*;*.*;*.bak?)"

#: lazarusidestrconsts:srkmcatfilemenu
msgid "File menu commands"
msgstr "Команды меню Файл"

#: lazarusidestrconsts:lisa2pfilename
msgid "File name:"
msgstr "Имя файла:"

#: lazarusidestrconsts:lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не исполняемый"

#: lazarusidestrconsts:lisfilenotfound
msgid "File not found"
msgstr "Файл не найден"

#: lazarusidestrconsts:lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижнем регистре"

#: lazarusidestrconsts:lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не сохранён"

#: lazarusidestrconsts:lisfilenottext
msgid "File not text"
msgstr "Файл не текстовый"

#: lazarusidestrconsts:lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл - не модуль"

#: lazarusidestrconsts:lisa2pfilename2
msgid "Filename"
msgstr "Имя файла"

#: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Имя файла отличается от имени пакета"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Имя файла использовано другим пакетом"

#: lazarusidestrconsts:lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Имя файла использовано проектом"

#: lazarusidestrconsts:lisfilenameaddress
msgid "Filename/Address"
msgstr "Имя файла/Адрес"

#: lazarusidestrconsts:lispefilename
msgid "Filename:"
msgstr "Имя файла:"

#: lazarusidestrconsts:lisoipfilename
msgid "Filename:  %s"
msgstr "Имя файла: %s"

#: lazarusidestrconsts:dlgenvfiles
msgid "Files"
msgstr "Файлы"

#: lazarusidestrconsts:lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Файлы в кодировке ASCII либо UTF-8"

#: lazarusidestrconsts:lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Файлы не в кодировке ASCII и не в UTF-8"

#: lazarusidestrconsts:lisfilter
msgid "Filter"
msgstr "Фильтр"

#: lazarusidestrconsts:lisfiltersets
msgid "Filter Sets"
msgstr "Наборы фильтров"

#: lazarusidestrconsts:lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Фильтровать по любой части метода"

#: lazarusidestrconsts:lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Фильтровать по началу метода"

#: lazarusidestrconsts:lismenufind
msgid "Find"
msgstr "Найти"

#: lazarusidestrconsts:lismenufindnext
msgid "Find &Next"
msgstr "Найти следующее"

#: lazarusidestrconsts:lismenufindprevious
msgid "Find &Previous"
msgstr "Найти предыдущее"

#: lazarusidestrconsts:lismenufindinfiles
msgid "Find &in files ..."
msgstr "Найти в &файлах ..."

#: lazarusidestrconsts:lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Найти объявление под курсором"

#: lazarusidestrconsts:uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts:lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Найти ссылки на идентификатор ..."

#: lazarusidestrconsts:lismenutemplatefindnext
msgid "Find Next"
msgstr "Найти далее"

#: lazarusidestrconsts:lisfrifindreferences
msgid "Find References"
msgstr "Найти ссылки"

#: lazarusidestrconsts:srkmecfindblockotherend
msgid "Find block other end"
msgstr "Найти другой конец блока"

#: lazarusidestrconsts:srkmecfindblockstart
msgid "Find block start"
msgstr "Найти начало блока"

#: lazarusidestrconsts:lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Найти начало блока кода"

#: lazarusidestrconsts:liscomppalfindcomponent
msgid "Find component"
msgstr "Найти компонент"

#: lazarusidestrconsts:srkmecfinddeclaration
msgid "Find declaration"
msgstr "Найти объявление"

#: lazarusidestrconsts:srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts:srkmecfindinfiles
msgid "Find in files"
msgstr "Найти в файлах"

#: lazarusidestrconsts:liskmfindincremental
msgid "Find incremental"
msgstr "Найти далее"

#: lazarusidestrconsts:lisfindkeycombination
msgid "Find key combination"
msgstr "Найти комбинацию клавиш"

#: lazarusidestrconsts:srkmecfindnext
msgid "Find next"
msgstr "Найти далее"

#: lazarusidestrconsts:srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Найти следующее вхождение слова"

#: lazarusidestrconsts:lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Найти или переименовать идентификатор"

#: lazarusidestrconsts:lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Найти другой конец блока кода"

#: lazarusidestrconsts:lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Найти компонент на палитре"

#: lazarusidestrconsts:srkmecfindprevious
msgid "Find previous"
msgstr "Найти предыдущее"

#: lazarusidestrconsts:srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Найти предыдущее вхождение слова"

#: lazarusidestrconsts:srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Найти описание процедуры"

#: lazarusidestrconsts:srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Найти метод процедуры"

#: lazarusidestrconsts:srkmecfind
msgid "Find text"
msgstr "Найти текст"

#: lazarusidestrconsts:dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Поиск текста под курсором"

#: lazarusidestrconsts:rslanguagefinnish
msgid "Finnish"
msgstr "Финский"

#: lazarusidestrconsts:lispefixfilescase
msgid "Fix Files Case"
msgstr "Исправить регистр файлов"

#: lazarusidestrconsts:lisfixlfmfile
msgid "Fix LFM file"
msgstr "Исправить файл LFM"

#: lazarusidestrconsts:lisfloatingpoin
msgid "Floating Point"
msgstr "С плавающей точкой"

#: lazarusidestrconsts:dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Перевести фокус в окно сообщений после компиляции"

#: lazarusidestrconsts:srkmecjumptoeditor
msgid "Focus to source editor"
msgstr "Перевести фокус в редактор исходного кода"

#: lazarusidestrconsts:liscefollowcursor
msgid "Follow cursor"
msgstr "Следовать за курсором"

#: lazarusidestrconsts:lisuefontwith
msgid "Font without UTF-8"
msgstr "Шрифт без UTF-8"

#: lazarusidestrconsts:lisforcerenaming
msgid "Force renaming"
msgstr "Переименовать принудительно"

#: lazarusidestrconsts:dlgforecolor
msgid "Foreground color"
msgstr "Цвет текста"

#: lazarusidestrconsts:dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"

#: lazarusidestrconsts:rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Файл данных формы (*.dfm)|*.dfm"

#: lazarusidestrconsts:lisformloaderror
msgid "Form load error"
msgstr "Ошибка загрузки формы"

#: lazarusidestrconsts:lisformaterror
msgid "Format error"
msgstr "Ошибка форматирования"

#: lazarusidestrconsts:dlgpofroms
msgid "Forms"
msgstr "Формы"

#: lazarusidestrconsts:lismenuviewforms
msgid "Forms..."
msgstr "Формы..."

#: lazarusidestrconsts:lisfrforwardsearch
msgid "Forwar&d search"
msgstr "&Вперёд"

#: lazarusidestrconsts:lisvsrforwardsearch
msgid "Forward Search"
msgstr "Найти следующее"

#: lazarusidestrconsts:fdmorderforwardone
msgid "Forward one"
msgstr "На один вперёд"

#: lazarusidestrconsts:lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Найденные пустые методы:"

#: lazarusidestrconsts:lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts:lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Компилятор FreePascal не найден"

#: lazarusidestrconsts:lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Не найден исходный код FreePascal"

#: lazarusidestrconsts:lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Файл исходного кода FreePascal"

#: lazarusidestrconsts:lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Каталог исходного кода FreePascal"

#: lazarusidestrconsts:rslanguagefrench
msgid "French"
msgstr "Французский"

#: lazarusidestrconsts:lisfunction
msgid "Function"
msgstr "Функция"

#: lazarusidestrconsts:listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Функция: добавить разделитель путей"

#: lazarusidestrconsts:listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Функция: убрать разделитель путей"

#: lazarusidestrconsts:listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Функция: извлечь расширение файла"

#: lazarusidestrconsts:listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Функция: извлечь только имя файла"

#: lazarusidestrconsts:listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Функция: извлечь имя файла с расширением"

#: lazarusidestrconsts:listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Функция: извлечь путь файла"

#: lazarusidestrconsts:dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Совместимость с GPC (GNU Pascal Compiler)"

#: lazarusidestrconsts:lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Заметка о GPL"

#: lazarusidestrconsts:lismenuinsertgeneral
msgid "General"
msgstr "Общие"

#: lazarusidestrconsts:lispckeditgeneraloptions
msgid "General Options"
msgstr "Общие параметры"

#: lazarusidestrconsts:srkmecenvironmentoptions
msgid "General environment options"
msgstr "Общие параметры окружения"

#: lazarusidestrconsts:dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Генерировать информацию для DBX (замедляет сборку)"

#: lazarusidestrconsts:dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Генерировать информацию для GDB (замедляет сборку)"

#: lazarusidestrconsts:dlggprof
msgid "Generate code for gprof"
msgstr "Создать код для gprof"

#: lazarusidestrconsts:dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Создать код для valgrind"

#: lazarusidestrconsts:dlgcogenerate
msgid "Generate:"
msgstr "Кодогенерация"

#: lazarusidestrconsts:rslanguagegerman
msgid "German"
msgstr "Немецкий"

#: lazarusidestrconsts:dlggetposition
msgid "Get position"
msgstr "Принять позицию"

#: lazarusidestrconsts:lispldglobal
msgid "Global"
msgstr "Глобальные"

#: lazarusidestrconsts:lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Добавляемый глобальный путь к исходному коду"

#: lazarusidestrconsts:srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Переход к маркеру %d"

#: lazarusidestrconsts:srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Переход к редактору %d"

#: lazarusidestrconsts:srkmecgotolinenumber
msgid "Go to line number"
msgstr "Переход к строке номер"

#: lazarusidestrconsts:liskmgotomarker0
msgid "Go to marker 0"
msgstr "Переход к маркеру 0"

#: lazarusidestrconsts:liskmgotomarker1
msgid "Go to marker 1"
msgstr "Переход к маркеру 1"

#: lazarusidestrconsts:liskmgotomarker2
msgid "Go to marker 2"
msgstr "Переход к маркеру 2"

#: lazarusidestrconsts:liskmgotomarker3
msgid "Go to marker 3"
msgstr "Переход к маркеру 3"

#: lazarusidestrconsts:liskmgotomarker4
msgid "Go to marker 4"
msgstr "Переход к маркеру 4"

#: lazarusidestrconsts:liskmgotomarker5
msgid "Go to marker 5"
msgstr "Переход к маркеру 5"

#: lazarusidestrconsts:liskmgotomarker6
msgid "Go to marker 6"
msgstr "Переход к маркеру 6"

#: lazarusidestrconsts:liskmgotomarker7
msgid "Go to marker 7"
msgstr "Переход к маркеру 7"

#: lazarusidestrconsts:liskmgotomarker8
msgid "Go to marker 8"
msgstr "Переход к маркеру 8"

#: lazarusidestrconsts:liskmgotomarker9
msgid "Go to marker 9"
msgstr "Переход к маркеру 9"

#: lazarusidestrconsts:srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Переход к парной скобке"

#: lazarusidestrconsts:srkmecnexteditor
msgid "Go to next editor"
msgstr "Переход к следующему редактору"

#: lazarusidestrconsts:srkmecpreveditor
msgid "Go to prior editor"
msgstr "Переход к предыдущему редактору"

#: lazarusidestrconsts:liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Переход к редактору исходного кода 1"

#: lazarusidestrconsts:liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Переход к редактору исходного кода 10"

#: lazarusidestrconsts:liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Переход к редактору исходного кода 2"

#: lazarusidestrconsts:liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Переход к редактору исходного кода 3"

#: lazarusidestrconsts:liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Переход к редактору исходного кода 4"

#: lazarusidestrconsts:liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Переход к редактору исходного кода 5"

#: lazarusidestrconsts:liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Переход к редактору исходного кода 6"

#: lazarusidestrconsts:liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Переход к редактору исходного кода 7"

#: lazarusidestrconsts:liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Переход к редактору исходного кода 8"

#: lazarusidestrconsts:liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Переход к редактору исходного кода 9"

#: lazarusidestrconsts:srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Переход по директиве include текущего включаемого файла"

#: lazarusidestrconsts:listodogoto
msgid "Goto"
msgstr "Переход"

#: lazarusidestrconsts:srkmecgotoxy
msgid "Goto XY"
msgstr "Переход по координате"

#: lazarusidestrconsts:lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Перейти по директиве $I"

#: lazarusidestrconsts:lismenugotoline
msgid "Goto line ..."
msgstr "Перейти к строке ..."

#: lazarusidestrconsts:lisuegotoline
msgid "Goto line :"
msgstr "Строка :"

#: lazarusidestrconsts:uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Перейти к следующей закладке"

#: lazarusidestrconsts:uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Перейти к предыдущей закладке"

#: lazarusidestrconsts:listodolistgotoline
msgid "Goto selected source line"
msgstr "Переход к выделенной строке исходного кода"

#: lazarusidestrconsts:srkmgrabkey
msgid "Grab key"
msgstr "Захватить клавишу"

#: lazarusidestrconsts:srkmgrabsecondkey
msgid "Grab second key"
msgstr "Захватить вторую клавишу"

#: lazarusidestrconsts:dlggrabbercolor
msgid "Grabber color"
msgstr "Цвет выделения"

#: lazarusidestrconsts:dlgenvgrid
msgid "Grid"
msgstr "Сетка"

#: lazarusidestrconsts:dlggridcolor
msgid "Grid color"
msgstr "Цвет сетки"

#: lazarusidestrconsts:dlggridx
msgid "Grid size X"
msgstr "Размер X сетки"

#: lazarusidestrconsts:dlggridy
msgid "Grid size Y"
msgstr "Размер Y сетки"

#: lazarusidestrconsts:lisgroup
msgid "Group"
msgstr "Группа"

#: lazarusidestrconsts:dlggroupundo
msgid "Group Undo"
msgstr "Групповая отмена"

#: lazarusidestrconsts:lisgrowtolarges
msgid "Grow to Largest"
msgstr "Увеличить до наибольшего"

#: lazarusidestrconsts:srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Предположить отсутствие $IFDEF"

#: lazarusidestrconsts:lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Исправить несоответствие IFDEF/ENDIF"

#: lazarusidestrconsts:lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Исправить незаконченный блок"

#: lazarusidestrconsts:dlgenvlguidelines
msgid "Guide lines"
msgstr "Линии позиционирования"

#: lazarusidestrconsts:dlgguttercolor
msgid "Gutter color"
msgstr "Цвет поля (лев)"

#: lazarusidestrconsts:dlggutterwidth
msgid "Gutter width"
msgstr "Ширина поля (лев)"

#: lazarusidestrconsts:lisccohintmsg
msgid "HINT: "
msgstr "ПОДСКАЗКА: "

#: lazarusidestrconsts:dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на половину страницы"

#: lazarusidestrconsts:lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Обработать событие OnClick"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Обрабатывается"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Обрабатывается отладчиком"

#: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Обрабатывается программой"

#: lazarusidestrconsts:lishashelp
msgid "Has Help"
msgstr "Имеет справку"

#: lazarusidestrconsts:lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Имеет процедуру Register"

#: lazarusidestrconsts:lisheadercommentforclass
msgid "Header comment for class"
msgstr "Комментарий-заголовок для класса"

#: lazarusidestrconsts:dlgheapsize
msgid "Heap Size"
msgstr "Размер кучи"

#: lazarusidestrconsts:rslanguagehebrew
msgid "Hebrew"
msgstr "Иврит"

#: lazarusidestrconsts:dlgheightpos
msgid "Height:"
msgstr "Высота:"

#: lazarusidestrconsts:lispckedithelp
msgid "Help"
msgstr "Справка"

#: lazarusidestrconsts:lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметры справки"

#: lazarusidestrconsts:lishelpentries
msgid "Help entries"
msgstr "Элементы справки"

#: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Справка по сообщениям компилятора FreePascal"

#: lazarusidestrconsts:srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команды меню Справка"

#: lazarusidestrconsts:lishelpselectordialog
msgid "Help selector"
msgstr "Выбор справки..."

#: lazarusidestrconsts:lishexadecimal
msgid "Hexadecimal"
msgstr "Шестнадцатеричное"

#: lazarusidestrconsts:dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Скрыть окна IDE при пуске"

#: lazarusidestrconsts:uemhighlighter
msgid "Highlighter"
msgstr "Подсветка синтаксиса"

#: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Подсказка: проверьте, содержат ли два пакета модули с одинаковым именем."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите только строковое выражение и попробуйте снова."

#: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите выражение и попробуйте снова."

#: lazarusidestrconsts:dlgedhintcommand
msgid "Hint: click on the command you want to edit"
msgstr "Подсказка: щёлкните по команде, которая Вам нужна"

#: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Подсказка: Вы можете задать путь компилятора в Окружение->Параметры окружения->Файлы->Путь компилятора"

#: lazarusidestrconsts:dlgpalhints
msgid "Hints for component palette"
msgstr "Подсказки палитры компонентов"

#: lazarusidestrconsts:dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Подсказки командных кнопок (открыть, сохранить и т.д.)"

#: lazarusidestrconsts:lisinfobuildhint
msgid "Hints:"
msgstr "Подсказок:"

#: lazarusidestrconsts:dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home переводит к началу текста в строке"

#: lazarusidestrconsts:lishorizontal
msgid "Horizontal"
msgstr "Горизонтально"

#: lazarusidestrconsts:dlggridxhint
msgid "Horizontal grid step size"
msgstr "Шаг сетки по горизонтали"

#: lazarusidestrconsts:dlghostapplication
msgid "Host application"
msgstr "Главное приложение"

#: lazarusidestrconsts:uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Вам сказано - не реализовано"

#: lazarusidestrconsts:lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts:liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts:lispckoptsideintegration
msgid "IDE Integration"
msgstr "Встраивание в IDE"

#: lazarusidestrconsts:lisideintf
msgid "IDE Interface"
msgstr "Интерфейс IDE"

#: lazarusidestrconsts:lisideoptions
msgid "IDE Options:"
msgstr "Параметры IDE:"

#: lazarusidestrconsts:lismenuideinternals
msgid "IDE internals"
msgstr "Внутреннее состояние IDE"

#: lazarusidestrconsts:lissamideisbusy
msgid "IDE is busy"
msgstr "IDE занята"

#: lazarusidestrconsts:uepins
msgid "INS"
msgstr "ВСТ"

#: lazarusidestrconsts:liscodetoolsoptsidentifier
msgid "Identifier"
msgstr "Идентификатор"

#: lazarusidestrconsts:lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Идентификатор начинается с ..."

#: lazarusidestrconsts:dlgedidcomlet
msgid "Identifier completion"
msgstr "Завершение идентификаторов"

#: lazarusidestrconsts:lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Идентификатор содержит ..."

#: lazarusidestrconsts:lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Длина идентификатора:"

#: lazarusidestrconsts:dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Политика идентификаторов"

#: lazarusidestrconsts:lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Префикс идентификатора:"

#: lazarusidestrconsts:lisfriidentifier
msgid "Identifier: %s"
msgstr "Идентификатор: %s"

#: lazarusidestrconsts:liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts:uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Если Вы можете помочь нам реализовать эту функцию, пишите на lazarus@miraclec.com"

#: lazarusidestrconsts:liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts:liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts:dlgignoreverb
msgid "Ignore"
msgstr "Пропуск"

#: lazarusidestrconsts:lissortselignorespace
msgid "Ignore Space"
msgstr "Игнорировать пробелы"

#: lazarusidestrconsts:lisignoreall
msgid "Ignore all"
msgstr "Игнорировать все"

#: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Игнорировать количество пробелов"

#: lazarusidestrconsts:lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Игнорировать и продолжить"

#: lazarusidestrconsts:lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Игнорировать и немедленно сохранить пакет."

#: lazarusidestrconsts:lisignorebinaries
msgid "Ignore binaries"
msgstr "Игнорировать двоичные файлы"

#: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Игнорировать разные концы строк (например, #10 = #13#10)"

#: lazarusidestrconsts:lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Игнорировать изменения на диске"

#: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Игнорировать добавление/удаление пустых строк"

#: lazarusidestrconsts:lisignoremissingfile
msgid "Ignore missing file"
msgstr "Игнорировать отсутствующие файлы"

#: lazarusidestrconsts:lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Игнорировать пробелы (без учёта символов перевода строки)"

#: lazarusidestrconsts:lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Игнорировать пробелы в конце строки"

#: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Игнорировать пробелы в начале строки"

#: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Игнорировать эти исключения"

#: lazarusidestrconsts:lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Игнорировать, использовать TForm как предка"

#: lazarusidestrconsts:srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts:lisimportlist
msgid "Import list"
msgstr "Список импорта"

#: lazarusidestrconsts:dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"

#: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Для создания очищенной копии проекта/пакета все файлы в следующем каталоге будут удалены, и всё их содержимое будет утеряно.%s%sУдалить все файлы в %s%s%s?"

#: lazarusidestrconsts:lispckoptsinclude
msgid "Include"
msgstr "Включаемый"

#: lazarusidestrconsts:dlgassertcode
msgid "Include Assertion Code"
msgstr "Включить код Assert"

#: lazarusidestrconsts:dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Включаемые файлы (-Fi):"

#: lazarusidestrconsts:lisincludefilter
msgid "Include Filter"
msgstr "Включающий фильтр"

#: lazarusidestrconsts:rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Добавлять информацию о версии в исполнимый файл"

#: lazarusidestrconsts:lispkgfiletypeinclude
msgid "Include file"
msgstr "Включаемый файл:"

#: lazarusidestrconsts:lisincludepaths
msgid "Include paths"
msgstr "Пути включаемых"

#: lazarusidestrconsts:lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Искать в подкаталогах"

#: lazarusidestrconsts:dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включить системные переменные"

#: lazarusidestrconsts:lisuidincludedby
msgid "Included by:"
msgstr "Включён:"

#: lazarusidestrconsts:lismenuincrementalfind
msgid "Incremental Find"
msgstr "Найти с нарастанием"

#: lazarusidestrconsts:srkmecblockindent
msgid "Indent block"
msgstr "Отделить блок"

#: lazarusidestrconsts:dlgindentcodeto
msgid "Indent code to"
msgstr "Выровнять код по"

#: lazarusidestrconsts:lismenuindentselection
msgid "Indent selection"
msgstr "Сдвинуть блок вправо"

#: lazarusidestrconsts:lisindex
msgid "Index"
msgstr "Индекс"

#: lazarusidestrconsts:rslanguageindonesian
msgid "Indonesian"
msgstr "Индонезийский"

#: lazarusidestrconsts:lisinformationaboutunit
msgid "Information about %s"
msgstr "Информация о %s"

#: lazarusidestrconsts:lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "Унаследовать от существующего компонента."

#: lazarusidestrconsts:liscmplstinheritance
msgid "Inheritance"
msgstr "Наследование"

#: lazarusidestrconsts:dlgcoinherited
msgid "Inherited"
msgstr "Унаследованное"

#: lazarusidestrconsts:lisinheriteditem
msgid "Inherited Item"
msgstr "Унаследованный элемент"

#: lazarusidestrconsts:lisedtexttoolinsert
msgid "Insert"
msgstr "Вставить"

#: lazarusidestrconsts:liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Вставить $IFDEF"

#: lazarusidestrconsts:lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Вставить $IFDEF..."

#: lazarusidestrconsts:srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставить ключевое слово CVS Author"

#: lazarusidestrconsts:srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставить ключевое слово CVS Date"

#: lazarusidestrconsts:srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставить ключевое слово CVS Header"

#: lazarusidestrconsts:srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставить ключевое слово CVS ID"

#: lazarusidestrconsts:srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставить ключевое слово CVS Log"

#: lazarusidestrconsts:srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставить ключевое слово CVS Name"

#: lazarusidestrconsts:srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставить ключевое слово CVS Revision"

#: lazarusidestrconsts:srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставить ключевое слово CVS Source"

#: lazarusidestrconsts:srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставить элемент ChangeLog"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставить шаблон каталога Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставить шаблон проекта Delphi 5"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставить шаблон каталога Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставить шаблон проекта Delphi 6"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставить шаблон каталога Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставить шаблон проекта Delphi 7"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставить шаблон компилятора FreePascal"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставить шаблон проекта FreePascal"

#: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Вставить шаблон SVN-кода FreePascal "

#: lazarusidestrconsts:lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Вставить шаблон формы..."

#: lazarusidestrconsts:srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставить заметку о GPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставить шаблон компилятора Kylix 3"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставить шаблон каталога Kylix 3"

#: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставить шаблон проекта Kylix 3"

#: lazarusidestrconsts:srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставить заметку о LGPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Вставить шаблон каталога Lazarus"

#: lazarusidestrconsts:lisctinsertmacro
msgid "Insert Macro"
msgstr "Вставить макрос"

#: lazarusidestrconsts:srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"

#: lazarusidestrconsts:lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Вставить новый пункт (после)"

#: lazarusidestrconsts:lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Вставить новый пункт (перед)"

#: lazarusidestrconsts:liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставить шаблон"

#: lazarusidestrconsts:listddinserttodo
msgid "Insert ToDo"
msgstr "Элемент списка ToDo"

#: lazarusidestrconsts:ueminserttodo
msgid "Insert Todo"
msgstr "Элемент списка ToDo"

#: lazarusidestrconsts:srkmecinsertguid
msgid "Insert a GUID"
msgstr "GUID"

#: lazarusidestrconsts:liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Вставить ссылку ..."

#: lazarusidestrconsts:lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставить по алфавиту"

#: lazarusidestrconsts:liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Вставить тег форматирования для полужирного шрифта"

#: lazarusidestrconsts:liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Вставить тег форматирования для кода"

#: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставить с учётом контекста"

#: lazarusidestrconsts:srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставить текущие дату и время"

#: lazarusidestrconsts:srkmecinsertusername
msgid "Insert current username"
msgstr "Вставить текущее имя пользователя"

#: lazarusidestrconsts:liskminsertdateandtime
msgid "Insert date and time"
msgstr "Вставить дату и время"

#: lazarusidestrconsts:lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts:srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts:liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Вставить тег форматирования для курсива"

#: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Вставить заметку о модифицированной LGPL"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставить элемент как дочерний"

#: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставить элемент ниже"

#: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Вставить тег форматирования для абзаца"

#: lazarusidestrconsts:liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Вставить тег форматирования для замечания"

#: lazarusidestrconsts:dlginsspaceafter
msgid "Insert space after"
msgstr "Вставлять пробелы после"

#: lazarusidestrconsts:dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставлять пробелы перед"

#: lazarusidestrconsts:lismenuinserttext
msgid "Insert text"
msgstr "Вставить текст"

#: lazarusidestrconsts:liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Вставить тег форматирования для подчёркнутого шрифта"

#: lazarusidestrconsts:liskminsertusername
msgid "Insert username"
msgstr "Вставить имя пользователя"

#: lazarusidestrconsts:liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Вставить тег форматирования для имени переменной"

#: lazarusidestrconsts:liskminspect
msgid "Inspect"
msgstr "Просмотреть"

#: lazarusidestrconsts:lismenuinspect
msgid "Inspect ..."
msgstr "Просмотреть ..."

#: lazarusidestrconsts:lispckeditinstall
msgid "Install"
msgstr "Установить"

#: lazarusidestrconsts:lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Установить при след. запуске"

#: lazarusidestrconsts:lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Установить пакет в IDE"

#: lazarusidestrconsts:lisinstallselection
msgid "Install selection"
msgstr "Установить выбранное"

#: lazarusidestrconsts:lisinstallationfailed
msgid "Installation failed"
msgstr "Установка не удалась"

#: lazarusidestrconsts:lispckexplinstalled
msgid "Installed"
msgstr "Установлен"

#: lazarusidestrconsts:lisinstalledpackages
msgid "Installed Packages"
msgstr "Установленные пакеты"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "При установке пакета %s автоматически установится пакет:"

#: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "При установке пакета %s автоматически установятся эти пакеты:"

#: lazarusidestrconsts:lisdebugoptionsfrminterface
msgid "Interface"
msgstr "Интерфейс"

#: lazarusidestrconsts:lisinternalname
msgid "Internal Name:"
msgstr "Внутреннее имя:"

#: lazarusidestrconsts:listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Внутренняя ошибка компилятора! (%d)"

#: lazarusidestrconsts:dlgintvinsec
msgid "Interval in secs"
msgstr "Интервал в сек"

#: lazarusidestrconsts:lisinvalidoff
msgid "Invalid (Off)"
msgstr "Неверная (Выкл.)"

#: lazarusidestrconsts:lisinvalidon
msgid "Invalid (On)"
msgstr "Неверная (Вкл.)"

#: lazarusidestrconsts:lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неправильный тип предка"

#: lazarusidestrconsts:lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Неправильный цикл"

#: lazarusidestrconsts:lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неправильное имя класса"

#: lazarusidestrconsts:lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Неправильное имя файла компилятора"

#: lazarusidestrconsts:lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Неправильный фильтр исключений"

#: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Неправильный каталог исходого кода FreePascal"

#: lazarusidestrconsts:lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некорректный идентификатор"

#: lazarusidestrconsts:lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Неправильный фильтр включений"

#: lazarusidestrconsts:lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неправильные версии (минимальная/максимальная)"

#: lazarusidestrconsts:lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неправильный пакет"

#: lazarusidestrconsts:lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некорректный идентификатор Паскаля"

#: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неправильная секция Resourcestring"

#: lazarusidestrconsts:lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Неверный тестовый каталог"

#: lazarusidestrconsts:lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неправильное имя модуля"

#: lazarusidestrconsts:lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Неправильное имя модуля: %s"

#: lazarusidestrconsts:lisinvalidcircle
msgid "Invalid circle"
msgstr "Неверная круговая зависимость"

#: lazarusidestrconsts:lisinvalidcommand
msgid "Invalid command"
msgstr "Неправильная команда"

#: lazarusidestrconsts:lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Неверный компилятор"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Некорректное имя компилятора"

#: lazarusidestrconsts:lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Неправильный класс компонента"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некорректное имя отладчика"

#: lazarusidestrconsts:lisinvaliddelete
msgid "Invalid delete"
msgstr "Недопустимое удаление"

#: lazarusidestrconsts:lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Неправильный каталог назначения"

#: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неправильное выражение.%sПодсказка: функция \"Создать строку ресурсов\" требует строковую константу в одном файле. Выделите выражение и попробуйте ещё."

#: lazarusidestrconsts:lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Неверное выражение:%s%s%s%s"

#: lazarusidestrconsts:lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неправильный файл"

#: lazarusidestrconsts:lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неправильное расширение файла"

#: lazarusidestrconsts:lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неправильное имя файла"

#: lazarusidestrconsts:lisinvalidfilter
msgid "Invalid filter"
msgstr "Неверный фильтр"

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Неправильное имя файла make"

#: lazarusidestrconsts:lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неправильная максимальная версия"

#: lazarusidestrconsts:lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неправильная минимальная версия"

#: lazarusidestrconsts:lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неправильный множественный выбор"

#: lazarusidestrconsts:liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Неверный параметр в позиции %d: \"%s\""

#: lazarusidestrconsts:lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Неправильный идентификатор пакета: %s%s%s"

#: lazarusidestrconsts:lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неправильное расширение файла пакета"

#: lazarusidestrconsts:lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неправильное имя файла пакета"

#: lazarusidestrconsts:lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неправильный тип пакета"

#: lazarusidestrconsts:lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Неправильное имя пакета"

#: lazarusidestrconsts:liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неправильный \"предок\""

#: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неправильный родительский элемент"

#: lazarusidestrconsts:lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Неправильное имя модуля Паскаля"

#: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неправильный предыдущий элемент"

#: lazarusidestrconsts:lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неправильное имя процедуры"

#: lazarusidestrconsts:lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неправильное имя файла проекта"

#: lazarusidestrconsts:lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Неверный каталог публикации"

#: lazarusidestrconsts:lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Неверный путь поиска"

#: lazarusidestrconsts:lisinvalidselection
msgid "Invalid selection"
msgstr "Неправильное выделение"

#: lazarusidestrconsts:lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Неверное имя файла модуля"

#: lazarusidestrconsts:lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Неправильное имя модуля"

#: lazarusidestrconsts:lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неправильное имя переменной"

#: lazarusidestrconsts:lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неправильная версия"

#: lazarusidestrconsts:dlgedinvert
msgid "Invert"
msgstr "Обратить"

#: lazarusidestrconsts:ueminvertassignment
msgid "Invert Assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts:srkmecinvertassignment
msgid "Invert assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts:lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Файл XML нюансов"

#: lazarusidestrconsts:rslanguageitalian
msgid "Italian"
msgstr "Итальянский"

#: lazarusidestrconsts:dlgedital
msgid "Italic"
msgstr "Курсив"

#: lazarusidestrconsts:dlgoiitemheight
msgid "Item height"
msgstr "Высота элемента"

#: lazarusidestrconsts:lisjitform
msgid "JIT Form"
msgstr "JIT Form"

#: lazarusidestrconsts:rslanguagejapanese
msgid "Japanese"
msgstr "Японский"

#: lazarusidestrconsts:lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Перейти к выбранному"

#: lazarusidestrconsts:lismenujumpback
msgid "Jump back"
msgstr "Перейти назад"

#: lazarusidestrconsts:lismenujumpforward
msgid "Jump forward"
msgstr "Перейти вперёд"

#: lazarusidestrconsts:lismenujumpto
msgid "Jump to"
msgstr "Перейти к"

#: lazarusidestrconsts:lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Перейти к следующей закладке"

#: lazarusidestrconsts:lismenujumptonexterror
msgid "Jump to next error"
msgstr "Перейти к следующей ошибке"

#: lazarusidestrconsts:lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Перейти к предыдущей закладке"

#: lazarusidestrconsts:lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Перейти к предыдущей ошибке"

#: lazarusidestrconsts:dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Переход (например, по методу)"

#: lazarusidestrconsts:liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Оставить все текстовые файлы"

#: lazarusidestrconsts:dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Хранить отдельные переменные в регистрах"

#: lazarusidestrconsts:dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Сохранять позицию курсора по оси X"

#: lazarusidestrconsts:liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Сохранить файлы по фильтру"

#: lazarusidestrconsts:liskeepname
msgid "Keep name"
msgstr "Сохранить имя"

#: lazarusidestrconsts:dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Сохранять порядок процедур"

#: lazarusidestrconsts:liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Оставить их и продолжить"

#: lazarusidestrconsts:lisedtexttoolkey
msgid "Key"
msgstr "Клавиша"

#: lazarusidestrconsts:liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts:srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts:dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Схема раскладки клавиш"

#: lazarusidestrconsts:dlgkeymapping
msgid "Key Mappings"
msgstr "Привязки клавиш"

#: lazarusidestrconsts:dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Ошибки привязок клавиш"

#: lazarusidestrconsts:liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Схема привязки клавиш"

#: lazarusidestrconsts:liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключевое слово"

#: lazarusidestrconsts:dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Политика ключевых слов"

#: lazarusidestrconsts:lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Параметры LCL, зависящие от интерфейса:"

#: lazarusidestrconsts:lislclwidgettype
msgid "LCL Widget Type"
msgstr "Библиотека виджетов LCL"

#: lazarusidestrconsts:lislazbuildlclinterface
msgid "LCL interface"
msgstr "Интерфейс LCL"

#: lazarusidestrconsts:lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Отсутствует путь модуля LCL"

#: lazarusidestrconsts:lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - текст формы Lazarus"

#: lazarusidestrconsts:lislfmfile
msgid "LFM file"
msgstr "Файл LFM"

#: lazarusidestrconsts:lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Файл LFM повреждён"

#: lazarusidestrconsts:lislfmfilenotfound
msgid "LFM file not found"
msgstr "Файл LFM не найден"

#: lazarusidestrconsts:lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Заметка о LGPL"

#: lazarusidestrconsts:lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - ресурс Lazarus"

#: lazarusidestrconsts:dlgenvlanguage
msgid "Language"
msgstr "Язык"

#: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Исключения языка"

#: lazarusidestrconsts:rslanguageoptions
msgid "Language options"
msgstr "Параметры языка"

#: lazarusidestrconsts:rslanguageselection
msgid "Language selection:"
msgstr "Выбор языка:"

#: lazarusidestrconsts:dlgcdtlast
msgid "Last"
msgstr "Последним"

#: lazarusidestrconsts:dlglast
msgid "Last (i.e. at end of source)"
msgstr "Последний (т.е. в конце исходного кода)"

#: lazarusidestrconsts:lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Запускающее приложение"

#: lazarusidestrconsts:lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Запускающее приложение недопустимо"

#: lazarusidestrconsts:lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командная строка для запуска"

#: lazarusidestrconsts:lispkgmanglazarus
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts:lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Установки Рабочего Стола Lazarus"

#: lazarusidestrconsts:liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts:lislazarusfile
msgid "Lazarus File"
msgstr "Файл Lazarus"

#: lazarusidestrconsts:lislazaruside
msgid "Lazarus IDE"
msgstr "IDE Lazarus"

#: lazarusidestrconsts:lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts:lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Файл информации проекта Lazarus"

#: lazarusidestrconsts:lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Каталог конфигурации Lazarus"

#: lazarusidestrconsts:lislazarusdirectory
msgid "Lazarus directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts:dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Каталог Lazarus (общий для всех проектов)"

#: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Каталог Lazarus \"%s\" не найден."

#: lazarusidestrconsts:lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Каталог Lazarus не найден"

#: lazarusidestrconsts:lislazarusform
msgid "Lazarus form"
msgstr "Форма Lazarus"

#: lazarusidestrconsts:lislazarusinclude
msgid "Lazarus include file"
msgstr "Включаемый файл Lazarus"

#: lazarusidestrconsts:lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID языка Lazarus (напр.: en, de, br, fi)"

#: lazarusidestrconsts:lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Название языка Lazarus (напр.: английский, немецкий)"

#: lazarusidestrconsts:lislazaruspackage
msgid "Lazarus package"
msgstr "Пакет Lazarus"

#: lazarusidestrconsts:lislazarusproject
msgid "Lazarus project"
msgstr "Проект Lazarus"

#: lazarusidestrconsts:lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Исходный код проекта Lazarus"

#: lazarusidestrconsts:lislazarusunit
msgid "Lazarus unit"
msgstr "Модуль Lazarus"

#: lazarusidestrconsts:lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Оставьте пустым для файла .po по умолчанию"

#: lazarusidestrconsts:lisleft
msgid "Left"
msgstr "Стрелка влево"

#: lazarusidestrconsts:lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Левая привязка"

#: lazarusidestrconsts:lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Левый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства слева от компонента."

#: lazarusidestrconsts:lisleftsides
msgid "Left sides"
msgstr "Левые края"

#: lazarusidestrconsts:lisleftspaceequally
msgid "Left space equally"
msgstr "Равномерно по левым краям"

#: lazarusidestrconsts:dlgleftpos
msgid "Left:"
msgstr "Слева:"

#: lazarusidestrconsts:lislegaltrademarks
msgid "Legal Trademarks:"
msgstr "Торговые марки:"

#: lazarusidestrconsts:dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Уровень 0 (без особой оптимизации)"

#: lazarusidestrconsts:dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Уровень 1 (быстро и дружественно к отладчику)"

#: lazarusidestrconsts:dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Уровень 2 (Уровень 1 + быстрые оптимизации)"

#: lazarusidestrconsts:dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Уровень 3 (Уровень 3 + медленные оптимизации)"

#: lazarusidestrconsts:lislevels
msgid "Levels"
msgstr "Уровни"

#: lazarusidestrconsts:dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Библиотеки (-Fl):"

#: lazarusidestrconsts:lispckoptslibrary
msgid "Library"
msgstr "Библиотека"

#: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgstr "Библиотека%sБиблиотека FreePascal (.dll в Windows, .so в Linux, .dylib в MacOS X). Файл исходного кода библиотеки автоматически управляется Lazarus."

#: lazarusidestrconsts:lispckoptslicense
msgid "License:"
msgstr "Лицензия"

#: lazarusidestrconsts:lisaboutlazarusmsg
msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Лицензия: GPL/LGPL%sLazarus - это IDE для создания (графических и консольных) приложений при помощи компилятора FreePascal. FreePascal - это компилятор языков Pascal и Object Pascal, распространяемый под лицензией (L)GPL, и работающий под Windows, Linux, Mac OS X, FreeBSD, и не только.%sLazarus - это недостающий элемент, который позволит вам разрабатывать программы для всех вышеперечисленных платформ в Delphi-подобном окружении. Эта IDE является инструментом RAD, включающим в себя дизайнер форм.%sТак как проект Lazarus растёт, он нуждается в большем количестве разработчиков."

#: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Максимальное число строк"

#: lazarusidestrconsts:listodolline
msgid "Line"
msgstr "Строка"

#: lazarusidestrconsts:dlglinesplitting
msgid "Line Splitting"
msgstr "Разрыв строк"

#: lazarusidestrconsts:srkmeclineselect
msgid "Line selection mode"
msgstr "Режим выбора строк"

#: lazarusidestrconsts:lislinelength
msgid "Line/Length"
msgstr "Строка/Длина"

#: lazarusidestrconsts:lissortsellines
msgid "Lines"
msgstr "Строки"

#: lazarusidestrconsts:lisinfobuildlines
msgid "Lines:"
msgstr "Строк:"

#: lazarusidestrconsts:dlglinksmart
msgid "Link Smart"
msgstr "Умное связывание"

#: lazarusidestrconsts:dlglinklibraries
msgid "Link Style:"
msgstr "Стиль связывания"

#: lazarusidestrconsts:lislinktarget
msgid "Link target"
msgstr "Объект ссылки"

#: lazarusidestrconsts:lislink
msgid "Link:"
msgstr "Ссылка:"

#: lazarusidestrconsts:lispckoptslinker
msgid "Linker"
msgstr "Компоновщик"

#: lazarusidestrconsts:dlgcolinking
msgid "Linking"
msgstr "Связывание"

#: lazarusidestrconsts:liscmplstlist
msgid "List"
msgstr "Список"

#: lazarusidestrconsts:rslanguagelithuanian
msgid "Lithuanian"
msgstr "Литовский"

#: lazarusidestrconsts:dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Загрузить рабочий стол из файла"

#: lazarusidestrconsts:lisiecoloadfromfile
msgid "Load from file"
msgstr "Загрузить из файла"

#: lazarusidestrconsts:dlgcoloadsave
msgid "Load/Save"
msgstr "Загрузка/сохранение"

#: lazarusidestrconsts:lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Загруженные пакеты:"

#: lazarusidestrconsts:lisloadingfailed
msgid "Loading %s failed."
msgstr "Загрузка %s не удалась."

#: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Загрузка пакета %s заменит пакет %s%sиз файла %s.%sСтарый пакет изменён. Сохранить старый пакет %s?"

#: lazarusidestrconsts:dlgrunolocal
msgid "Local"
msgstr "Локальные"

#: lazarusidestrconsts:lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Локальные переменные"

#: lazarusidestrconsts:lislocals
msgid "Locals"
msgstr "Локальные"

#: lazarusidestrconsts:lislogo
msgid "Logo"
msgstr "Логотип"

#: lazarusidestrconsts:lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Нижний регистр выделения"

#: lazarusidestrconsts:dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Только 1я буква заглавная"

#: lazarusidestrconsts:liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (стиль Apple)"

#: lazarusidestrconsts:liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (стиль Lazarus)"

#: lazarusidestrconsts:lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"

#: lazarusidestrconsts:lisedtexttoolmacros
msgid "Macros"
msgstr "Макросы"

#: lazarusidestrconsts:dlgmainmenu
msgid "Main Menu"
msgstr "Главное меню"

#: lazarusidestrconsts:lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Главный модуль имеет выражения Application.CreateForm"

#: lazarusidestrconsts:lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Главный модуль имеет выражение Application.Title"

#: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Главный модуль имеет секцию uses, включающую все модули проекта"

#: lazarusidestrconsts:lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Главный модуль - исходый код на Паскале"

#: lazarusidestrconsts:lispckoptsmajor
msgid "Major"
msgstr "Старшая"

#: lazarusidestrconsts:rsmajorrevision
msgid "Major revision:"
msgstr "Старшая рев.:"

#: lazarusidestrconsts:lismakeexe
msgid "Make Executable"
msgstr "Создать исполняемый"

#: lazarusidestrconsts:lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Создать строку ресурсов ..."

#: lazarusidestrconsts:lismakeresourcestring
msgid "Make ResourceString"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts:lismakenotfound
msgid "Make not found"
msgstr "Не найден Make"

#: lazarusidestrconsts:dlgmakepath
msgid "Make path"
msgstr "Путь к Make"

#: lazarusidestrconsts:srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ручная компиляция (не автоматически)"

#: lazarusidestrconsts:dlgmargingutter
msgid "Margin and gutter"
msgstr "Границы"

#: lazarusidestrconsts:dlgmarkercolor
msgid "Marker color"
msgstr "Цвет маркера"

#: lazarusidestrconsts:lissmatches
msgid "Matches"
msgstr "Соответствия"

#: lazarusidestrconsts:lismaxs
msgid "Max %d"
msgstr "Макс. %d"

#: lazarusidestrconsts:dlgmaxlinelength
msgid "Max line length:"
msgstr "max длина строки:"

#: lazarusidestrconsts:dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Максимальное количество недавних файлов"

#: lazarusidestrconsts:dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Максимальное количество недавних проектов"

#: lazarusidestrconsts:lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Достигнут максимум количества средств"

#: lazarusidestrconsts:lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Макс. версия (по выбору):"

#: lazarusidestrconsts:lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Макс. версия"

#: lazarusidestrconsts:dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимальный счетчик"

#: lazarusidestrconsts:lismemorydump
msgid "Memory Dump"
msgstr "Дамп памяти"

#: lazarusidestrconsts:lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"

#: lazarusidestrconsts:lismenuviewmessages
msgid "Messages"
msgstr "Сообщения"

#: lazarusidestrconsts:lismessageseditor
msgid "Messages Editor"
msgstr "Редактор сообщений"

#: lazarusidestrconsts:lismethodclassnotfound
msgid "Method class not found"
msgstr "Класс метода не найден"

#: lazarusidestrconsts:dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Политика вставки методов"

#: lazarusidestrconsts:dlgminimizeallonminimizemain
msgid "Minimize all on minimize main"
msgstr "Минимизировать все при минимизации главной"

#: lazarusidestrconsts:lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Миним. версия (по выбору):"

#: lazarusidestrconsts:lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Миним. версия:"

#: lazarusidestrconsts:lispckoptsminor
msgid "Minor"
msgstr "Младшая"

#: lazarusidestrconsts:rsminorrevision
msgid "Minor revision:"
msgstr "Младшая рев.:"

#: lazarusidestrconsts:fdmmirrorhorizontal
msgid "Mirror horizontal"
msgstr "Отразить по горизонтали"

#: lazarusidestrconsts:fdmmirrorvertical
msgid "Mirror vertical"
msgstr "Отразить по вертикали"

#: lazarusidestrconsts:dlgenvmisc
msgid "Miscellaneous"
msgstr "Разное"

#: lazarusidestrconsts:lismissingevents
msgid "Missing Events"
msgstr "Отсутствующие события"

#: lazarusidestrconsts:lismissingpackages
msgid "Missing Packages"
msgstr "Отсутствующие пакеты"

#: lazarusidestrconsts:lismissingidentifiers
msgid "Missing identifiers"
msgstr "Отсутствующие идентификаторы"

#: lazarusidestrconsts:lisccomissingunit
msgid "Missing unit"
msgstr "Модуль отсутствует"

#: lazarusidestrconsts:dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Смешивать методы и свойства"

#: lazarusidestrconsts:uemodified
msgid "Modified"
msgstr "Изменён"

#: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Заметка о модифицированной LGPL"

#: lazarusidestrconsts:lispckeditmodified
msgid "Modified: %s"
msgstr "Изменён: %s"

#: lazarusidestrconsts:listodolfile
msgid "Module"
msgstr "Модуль"

#: lazarusidestrconsts:lismore
msgid "More"
msgstr "Больше"

#: lazarusidestrconsts:lispckeditmore
msgid "More ..."
msgstr "Больше..."

#: lazarusidestrconsts:dlgmouselinks
msgid "Mouse links"
msgstr "Ссылки под курсором мыши"

#: lazarusidestrconsts:lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Переместить вниз (или направо)"

#: lazarusidestrconsts:uemmoveeditorleft
msgid "Move Editor Left"
msgstr "Передвинуть страницу влево"

#: lazarusidestrconsts:uemmoveeditorleftmost
msgid "Move Editor Leftmost"
msgstr "Поместить страницу слева"

#: lazarusidestrconsts:uemmoveeditorright
msgid "Move Editor Right"
msgstr "Передвинуть страницу вправо"

#: lazarusidestrconsts:uemmoveeditorrightmost
msgid "Move Editor Rightmost"
msgstr "Поместить страницу справа"

#: lazarusidestrconsts:lismovepage
msgid "Move Page ..."
msgstr "Переместить страницу"

#: lazarusidestrconsts:lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Переместить вверх (или налево)"

#: lazarusidestrconsts:lisdsgorderbackone
msgid "Move component one back"
msgstr "Переместить компонент на один назад"

#: lazarusidestrconsts:lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Переместить компонент на один вперёд"

#: lazarusidestrconsts:lisdsgordermovetoback
msgid "Move component to back"
msgstr "Переместить компонент назад"

#: lazarusidestrconsts:lisdsgordermovetofront
msgid "Move component to front"
msgstr "Переместить компонент вперёд"

#: lazarusidestrconsts:srkmecpagedown
msgid "Move cursor down one page"
msgstr "Переместить курсор вниз на 1 страницу"

#: lazarusidestrconsts:srkmecpageleft
msgid "Move cursor left one page"
msgstr "Переместить курсор влево на 1 страницу"

#: lazarusidestrconsts:srkmecpageright
msgid "Move cursor right one page"
msgstr "Переместить курсор вправо на 1 страницу"

#: lazarusidestrconsts:srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Переместить курсор в самое начало"

#: lazarusidestrconsts:srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Переместить курсор в самый конец"

#: lazarusidestrconsts:srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Переместить курсор в конец страницы"

#: lazarusidestrconsts:srkmeclineend
msgid "Move cursor to line end"
msgstr "Переместить курсор в конец строки"

#: lazarusidestrconsts:srkmeclinestart
msgid "Move cursor to line start"
msgstr "Переместить курсор в начало строки"

#: lazarusidestrconsts:srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Переместить курсор в начало страницы"

#: lazarusidestrconsts:srkmecpageup
msgid "Move cursor up one page"
msgstr "Переместить курсор вверх на одну страницу"

#: lazarusidestrconsts:srkmecwordleft
msgid "Move cursor word left"
msgstr "Переместить курсор на слово влево"

#: lazarusidestrconsts:srkmecwordright
msgid "Move cursor word right"
msgstr "Переместить курсор на слово вправо"

#: lazarusidestrconsts:lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Зависимость - вниз"

#: lazarusidestrconsts:lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Зависимость - вверх"

#: lazarusidestrconsts:srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Сместить редактор влево"

#: lazarusidestrconsts:srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Поместить редактор слева"

#: lazarusidestrconsts:srkmecmoveeditorright
msgid "Move editor right"
msgstr "Сместить редактор вправо"

#: lazarusidestrconsts:srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Поместить редактор справа"

#: lazarusidestrconsts:lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Переместить в унаследованное"

#: lazarusidestrconsts:lispemovefiledown
msgid "Move file down"
msgstr "Переместить файл вниз"

#: lazarusidestrconsts:lispemovefileup
msgid "Move file up"
msgstr "Переместить файл вверх"

#: lazarusidestrconsts:liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Переместить элемент вниз"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Переместить элемент на уровень вниз"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Переместить элемент на уровень вверх"

#: lazarusidestrconsts:liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Переместить элемент вверх"

#: lazarusidestrconsts:lispatheditmovepathdown
msgid "Move path down"
msgstr "Путь - вниз"

#: lazarusidestrconsts:lispatheditmovepathup
msgid "Move path up"
msgstr "Путь - вверх"

#: lazarusidestrconsts:fdmordermovetoback
msgid "Move to back"
msgstr "Переместить назад"

#: lazarusidestrconsts:fdmordermovetofront
msgid "Move to front"
msgstr "Переместить вперёд"

#: lazarusidestrconsts:dlgmultiselect
msgid "Multi Select"
msgstr "Множественное выделение"

#: lazarusidestrconsts:fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Множественный выбор компонентов должен быть на одной форме"

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода FreePascal"

#: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода Lazarus"

#: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАМЕТКА: файл настроек CodeTools не найден - используем умолчания"

#: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАМЕТКА: грузим старый файл настроек CodeTools: "

#: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "ПРИМЕЧАНИЕ: в настоящий момент поддерживаются только абсолютные пути"

#: lazarusidestrconsts:lisdebugoptionsfrmname
msgid "Name"
msgstr "Имя"

#: lazarusidestrconsts:lisnameconflict
msgid "Name conflict"
msgstr "Конфликт имён"

#: lazarusidestrconsts:lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Имя новой процедуры"

#: lazarusidestrconsts:liscodetoolsdefsname
msgid "Name:"
msgstr "Имя:"

#: lazarusidestrconsts:dlgnaming
msgid "Naming"
msgstr "Именование"

#: lazarusidestrconsts:lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Никогда, только вручную"

#: lazarusidestrconsts:lismenutemplatenew
msgid "New"
msgstr "Создать"

#: lazarusidestrconsts:lismenunewother
msgid "New ..."
msgstr "Создать ..."

#: lazarusidestrconsts:lisnewancestors
msgid "New Ancestors"
msgstr "Новые Предки"

#: lazarusidestrconsts:lisnewclass
msgid "New Class"
msgstr "Новый Класс"

#: lazarusidestrconsts:lisa2pnewcomponent
msgid "New Component"
msgstr "Новый компонент"

#: lazarusidestrconsts:lisa2pnewfile
msgid "New File"
msgstr "Новый Файл"

#: lazarusidestrconsts:lismenunewform
msgid "New Form"
msgstr "Создать форму"

#: lazarusidestrconsts:lispwnewproject
msgid "New Project"
msgstr "Новый проект"

#: lazarusidestrconsts:lismenunewproject
msgid "New Project ..."
msgstr "Создать проект ..."

#: lazarusidestrconsts:lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Создать проект из файла ..."

#: lazarusidestrconsts:lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Новое требование"

#: lazarusidestrconsts:lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Новое описание шаблона..."

#: lazarusidestrconsts:lismenunewunit
msgid "New Unit"
msgstr "Создать модуль"

#: lazarusidestrconsts:lisa2pnewclassname
msgid "New class name:"
msgstr "Новое имя класса:"

#: lazarusidestrconsts:lisnewconsoleapplication
msgid "New console application"
msgstr "Новое консольное приложение"

#: lazarusidestrconsts:lisnewencoding
msgid "New encoding:"
msgstr "Новая кодировка:"

#: lazarusidestrconsts:liskmnewpackage
msgid "New package"
msgstr "Новый пакет"

#: lazarusidestrconsts:lismenunewpackage
msgid "New package ..."
msgstr "Новый пакет ..."

#: lazarusidestrconsts:liskmnewproject
msgid "New project"
msgstr "Нрвый проект "

#: lazarusidestrconsts:liskmnewprojectfromfile
msgid "New project from file"
msgstr "Новый проект из файла"

#: lazarusidestrconsts:lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новый модуль не в пути поиска"

#: lazarusidestrconsts:liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новый элемент"

#: lazarusidestrconsts:lispkgmangnewpackage
msgid "NewPackage"
msgstr "Новый Пакет"

#: lazarusidestrconsts:liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новая строка"

#: lazarusidestrconsts:srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Следующая закладка"

#: lazarusidestrconsts:lisno
msgid "No"
msgstr "Нет"

#: lazarusidestrconsts:lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Окно IDE не выбрано"

#: lazarusidestrconsts:lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не найдено секции ResourceString"

#: lazarusidestrconsts:lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Абстрактных методов не найдено"

#: lazarusidestrconsts:lisnobackupfiles
msgid "No backup files"
msgstr "Без файлов резервных копий"

#: lazarusidestrconsts:lisnochange
msgid "No change"
msgstr "Без изменений"

#: lazarusidestrconsts:lisnocodeselected
msgid "No code selected"
msgstr "Не выбрано кода"

#: lazarusidestrconsts:lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не унаследовано параметров компилятора."

#: lazarusidestrconsts:lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Отладчик не указан"

#: lazarusidestrconsts:dlgednoerr
msgid "No errors in key mapping found."
msgstr "Ошибок в раскладке не найдено."

#: lazarusidestrconsts:lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не выделено элементов"

#: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Не найдено пакета для зависимости %s%s%s.%sВыберите существующий пакет."

#: lazarusidestrconsts:lisoipnopackageselected
msgid "No package selected"
msgstr "Не выбрано пакетов"

#: lazarusidestrconsts:lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Файла программы %s%s%s не найдено."

#: lazarusidestrconsts:lisnostringconstantfound
msgid "No string constant found"
msgstr "Не найдено строковой константы"

#: lazarusidestrconsts:lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Корректные пути LazDoc отсутствуют"

#: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Элемент и его \"потомки\" доступны только для этого проекта"

#: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Элемент только для чтения"

#: lazarusidestrconsts:dlgenvnone
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts:dlgconormal
msgid "Normal Code"
msgstr "Нормальный код"

#: lazarusidestrconsts:srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальный режим выбора"

#: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Обычно фильтр - это регулярное выражение. В Простом Синтаксисе . означает обычный символ, * означает любую последовательность, ? означает любой одиночный символ, запятая и точка с запятой являются разделителями. Например: *.pas;*.pp соответствует ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts:lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Не проект Delphi"

#: lazarusidestrconsts:lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Не модуль Delphi"

#: lazarusidestrconsts:lisuenotfound
msgid "Not found"
msgstr "Не найден"

#: lazarusidestrconsts:lisnotimplemented
msgid "Not implemented"
msgstr "Не реализовано"

#: lazarusidestrconsts:uenotimplcap
msgid "Not implemented yet"
msgstr "Еще не реализовано"

#: lazarusidestrconsts:lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Еще не реализовано."

#: lazarusidestrconsts:lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Ещё не реализовано:%s%s"

#: lazarusidestrconsts:lisnotnow
msgid "Not now"
msgstr "Не сейчас"

#: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme
msgid "Note: All keys will be set to the values of the choosen scheme."
msgstr "Примечание: Значения всех клавиш будут установлены в соответствии с выбранной схемой."

#: lazarusidestrconsts:lisinfobuildnote
msgid "Notes:"
msgstr "Заметок:"

#: lazarusidestrconsts:dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Внимание, файлы проекта - все файлы в его каталоге"

#: lazarusidestrconsts:liscodetoolsoptsnumber
msgid "Number"
msgstr "Число"

#: lazarusidestrconsts:lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Количество преобразуемых файлов: %s"

#: lazarusidestrconsts:lisifdok
msgid "OK"
msgstr "ОК"

#: lazarusidestrconsts:lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Исключения ОС"

#: lazarusidestrconsts:uepovr
msgid "OVR"
msgstr "ЗАМ"

#: lazarusidestrconsts:lispckoptsobject
msgid "Object"
msgstr "Объект"

#: lazarusidestrconsts:lismenuviewobjectinspector
msgid "Object Inspector"
msgstr "Инспектор объектов"

#: lazarusidestrconsts:liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Команды инспектора объектов"

#: lazarusidestrconsts:lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - по умолчанию"

#: lazarusidestrconsts:dlgedoff
msgid "Off"
msgstr "Выкл."

#: lazarusidestrconsts:lisokbtn
msgid "Ok"
msgstr "ОК"

#: lazarusidestrconsts:lisoldancestors
msgid "Old Ancestors"
msgstr "Старые предки"

#: lazarusidestrconsts:lisoldclass
msgid "Old Class"
msgstr "Старый класс"

#: lazarusidestrconsts:dlgedon
msgid "On"
msgstr "Вкл."

#: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "При сборке проекта выполнить 'Собрать Файл'"

#: lazarusidestrconsts:lisceoonidle
msgid "On idle"
msgstr "При простое"

#: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "При запуске проекта выполнить 'Запустить Файл'"

#: lazarusidestrconsts:lismenuonlinehelp
msgid "Online Help"
msgstr "Оперативная справка"

#: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Контекстная справка ещё не реализована"

#: lazarusidestrconsts:lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Только существующие файлы"

#: lazarusidestrconsts:lisemdonlypublished
msgid "Only published"
msgstr "Только published"

#: lazarusidestrconsts:lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Поиск только целых слов"

#: lazarusidestrconsts:lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Только выбранное"

#: lazarusidestrconsts:lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Только текстовые файлы"

#: lazarusidestrconsts:lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Используются только при отображении категориями"

#: lazarusidestrconsts:lishintopen
msgid "Open"
msgstr "Открыть"

#: lazarusidestrconsts:lisopenlfm
msgid "Open %s"
msgstr "Открыть %s"

#: lazarusidestrconsts:lismenuopen
msgid "Open ..."
msgstr "Открыть ..."

#: lazarusidestrconsts:lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Открыть Diff в редакторе"

#: lazarusidestrconsts:lisopenfile2
msgid "Open File ..."
msgstr "Открыть файл"

#: lazarusidestrconsts:liscpopenpackage
msgid "Open Package %s"
msgstr "Открыть пакет %s"

#: lazarusidestrconsts:lisopenpackagefile
msgid "Open Package File"
msgstr "Открыть файл пакета"

#: lazarusidestrconsts:lisopenpackage
msgid "Open Package?"
msgstr "Открыть пакет?"

#: lazarusidestrconsts:lisctdefsopenpreview
msgid "Open Preview"
msgstr "Открыть предпросмотр"

#: lazarusidestrconsts:lispwopenproject
msgid "Open Project"
msgstr "Открыть проект"

#: lazarusidestrconsts:lismenuopenproject
msgid "Open Project ..."
msgstr "Открыть проект ..."

#: lazarusidestrconsts:lisopenprojectfile
msgid "Open Project File"
msgstr "Открыть проект"

#: lazarusidestrconsts:lisopenproject
msgid "Open Project?"
msgstr "Открыть проект?"

#: lazarusidestrconsts:lismenutemplateopenrecent
msgid "Open Recent"
msgstr "Открыть недавнее"

#: lazarusidestrconsts:lismenuopenrecent
msgid "Open Recent ..."
msgstr "Открыть недавнее"

#: lazarusidestrconsts:lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Открыть недавний проект"

#: lazarusidestrconsts:liscpopenunit
msgid "Open Unit %s"
msgstr "Открыть модуль %s"

#: lazarusidestrconsts:lisopenasxmlfile
msgid "Open as XML file"
msgstr "Открыть как файл XML"

#: lazarusidestrconsts:lisopenexistingfile
msgid "Open existing file"
msgstr "Открыть существующий файл"

#: lazarusidestrconsts:lisopenfile
msgid "Open file"
msgstr "Открыть файл"

#: lazarusidestrconsts:srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Открыть файл у курсора"

#: lazarusidestrconsts:lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Открыть имя файла под курсором"

#: lazarusidestrconsts:dlgqopenlastprj
msgid "Open last project at start"
msgstr "Открывать последний проект при запуске"

#: lazarusidestrconsts:lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Открыть загруженный пакет"

#: lazarusidestrconsts:lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Открыть загруженный пакет ..."

#: lazarusidestrconsts:lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Открыть или загрузить параметры компилятора"

#: lazarusidestrconsts:liscomppalopenpackage
msgid "Open package"
msgstr "Открыть пакет"

#: lazarusidestrconsts:lisopenpackage2
msgid "Open package %s"
msgstr "Открыть пакет %s"

#: lazarusidestrconsts:liskmopenpackagefile
msgid "Open package file"
msgstr "Открыть файл пакета"

#: lazarusidestrconsts:lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Открыть файл пакета (.lpk) ..."

#: lazarusidestrconsts:lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Открыть пакет текущего модуля"

#: lazarusidestrconsts:lisopenproject2
msgid "Open project"
msgstr "Открыть проект"

#: lazarusidestrconsts:lisopenprojectagain
msgid "Open project again"
msgstr "Открыть проект снова"

#: lazarusidestrconsts:lisiecoopenrecent
msgid "Open recent"
msgstr "Открыть недавние"

#: lazarusidestrconsts:lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Открыть недавний пакет"

#: lazarusidestrconsts:lisopensymlink
msgid "Open symlink"
msgstr "Открыть символическую ссылку"

#: lazarusidestrconsts:lisopentarget
msgid "Open target"
msgstr "Открыть цель ссылки"

#: lazarusidestrconsts:lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Открыть файл как обычный исходный код"

#: lazarusidestrconsts:lisopenthepackage
msgid "Open the package %s?"
msgstr "Открыть пакет %s?"

#: lazarusidestrconsts:lisopentheproject
msgid "Open the project %s?"
msgstr "Открыть проект %s?"

#: lazarusidestrconsts:liscomppalopenunit
msgid "Open unit"
msgstr "Открыть модуль"

#: lazarusidestrconsts:dlgoptimiz
msgid "Optimizations:"
msgstr "Оптимизации"

#: lazarusidestrconsts:liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Параметр в позиции %d не разрешает аргумент: %s"

#: lazarusidestrconsts:liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Параметр в позиции %d требует аргумент: %s"

#: lazarusidestrconsts:fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр: Выровнять по сетке"

#: lazarusidestrconsts:fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр: Выровнять по линиям позиционирования"

#: lazarusidestrconsts:dlgfropts
msgid "Options"
msgstr "Параметры"

#: lazarusidestrconsts:lislazbuildoptions
msgid "Options:"
msgstr "Параметры:"

#: lazarusidestrconsts:dlgcoopts
msgid "Options: "
msgstr "Параметры"

#: lazarusidestrconsts:fdmorder
msgid "Order"
msgstr "Порядок"

#: lazarusidestrconsts:dlgsrorigin
msgid "Origin"
msgstr "Начинать"

#: lazarusidestrconsts:lisoriginalfilename
msgid "Original File Name:"
msgstr "Первое имя файла:"

#: lazarusidestrconsts:dlgcoother
msgid "Other"
msgstr "Другое"

#: lazarusidestrconsts:dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Другие исходные коды (файлы .pp/.pas, нужны только IDE, не компилятору)"

#: lazarusidestrconsts:dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Другие модули (-Fu) (разделитель - точка с запятой):"

#: lazarusidestrconsts:dlgenvotherfiles
msgid "Other files"
msgstr "Др. файлы"

#: lazarusidestrconsts:rsotherinfo
msgid "Other info"
msgstr "Прочие сведения"

#: lazarusidestrconsts:lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Вывод"

#: lazarusidestrconsts:dlgpooutputsettings
msgid "Output Settings"
msgstr "Параметры вывода"

#: lazarusidestrconsts:lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Каталог вывода"

#: lazarusidestrconsts:dlgcooverflow
msgid "Overflow"
msgstr "Переполнения"

#: lazarusidestrconsts:lissamoverrideallselected
msgid "Override all selected"
msgstr "Заместить все выделенные"

#: lazarusidestrconsts:lissamoverridefirstselected
msgid "Override first selected"
msgstr "Заместить первый выделенный"

#: lazarusidestrconsts:lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Переопределить язык. Например, --language=de. См. каталог languages, чтобы узнать возможные значения."

#: lazarusidestrconsts:lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Перекрыть системную переменную"

#: lazarusidestrconsts:srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим замены"

#: lazarusidestrconsts:lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Перезаписать файл на диске"

#: lazarusidestrconsts:lisoverwritefile
msgid "Overwrite file?"
msgstr "Переписать файл?"

#: lazarusidestrconsts:listodolowner
msgid "Owner"
msgstr "Владелец"

#: lazarusidestrconsts:rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Каталог вывода файлов PO:"

#: lazarusidestrconsts:lispackage
msgid "Package"
msgstr "Пакет"

#: lazarusidestrconsts:lispckeditpackage
msgid "Package %s"
msgstr "Пакет %s"

#: lazarusidestrconsts:lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Пакет %s не найден"

#: lazarusidestrconsts:lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Пакет %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Пакет %s%s%s изменён.%s Сохранить пакет?"

#: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Пакет %s%s%s не имеет правильного каталога вывода:%s%s%s%s"

#: lazarusidestrconsts:lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Пакет %s%s%s не найден"

#: lazarusidestrconsts:lismenupackagegraph
msgid "Package Graph ..."
msgstr "Диаграмма пакетов ..."

#: lazarusidestrconsts:lispackageinfo
msgid "Package Info"
msgstr "Информация о пакете"

#: lazarusidestrconsts:lispldpackagelinks
msgid "Package Links"
msgstr "Ссылки на пакеты"

#: lazarusidestrconsts:lisoippackagename
msgid "Package Name"
msgstr "Имя пакета"

#: lazarusidestrconsts:lisprojaddpackagename
msgid "Package Name:"
msgstr "Имя пакета:"

#: lazarusidestrconsts:lispckoptspackageoptions
msgid "Package Options"
msgstr "Параметры пакета"

#: lazarusidestrconsts:lispkgreg
msgid "Package Registration"
msgstr "Регистрация пакетов"

#: lazarusidestrconsts:lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Метка каталога исходного кода пакета"

#: lazarusidestrconsts:lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфликты пакетов"

#: lazarusidestrconsts:lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Файл пакета отсутствует"

#: lazarusidestrconsts:lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Файл пакета не найден"

#: lazarusidestrconsts:lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Файл пакета не сохранён"

#: lazarusidestrconsts:liskmpackagegraph
msgid "Package graph"
msgstr "Диаграмма пакетов"

#: lazarusidestrconsts:dlgpldpackagegroup
msgid "Package group"
msgstr "Группа пакетов"

#: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Пакет - не пакет разработки"

#: lazarusidestrconsts:lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакет только для чтения"

#: lazarusidestrconsts:lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Требуется пакет"

#: lazarusidestrconsts:lismenupackagelinks
msgid "Package links ..."
msgstr "Ссылки на пакеты ..."

#: lazarusidestrconsts:srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Команды меню Пакет"

#: lazarusidestrconsts:lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Имя пакета уже занято"

#: lazarusidestrconsts:lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Имя пакета начинается с ..."

#: lazarusidestrconsts:lispackagenamecontains
msgid "Package name contains ..."
msgstr "Имя пакета содержит ..."

#: lazarusidestrconsts:lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Пакет требует установки"

#: lazarusidestrconsts:lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакет не найден"

#: lazarusidestrconsts:lispkgmangpackage
msgid "Package: %s"
msgstr "Пакет: %s"

#: lazarusidestrconsts:lispckoptspackagetype
msgid "PackageType"
msgstr "Тип пакета"

#: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакеты должны иметь расширение .lpk"

#: lazarusidestrconsts:lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Пакеты для установки в IDE"

#: lazarusidestrconsts:lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Имя страницы слишком длинное"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Рисовать элементы дизайнеров только в паузах (уменьшает нагрузку на медленных машинах)"

#: lazarusidestrconsts:liscmplstpalette
msgid "Palette"
msgstr "Палитра"

#: lazarusidestrconsts:lisa2ppalettepage
msgid "Palette Page:"
msgstr "Страница палитры:"

#: lazarusidestrconsts:lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзацы"

#: lazarusidestrconsts:liscmparameter
msgid "Parameter"
msgstr "Параметр"

#: lazarusidestrconsts:lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметры:"

#: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Родительский элемент не может содержать дочерних."

#: lazarusidestrconsts:dlgcoparsing
msgid "Parsing"
msgstr "Обработка"

#: lazarusidestrconsts:lislazbuildabopart
msgid "Part"
msgstr "Часть"

#: lazarusidestrconsts:lispascalsourcefile
msgid "Pascal source file"
msgstr "Исходный код Паскаля"

#: lazarusidestrconsts:lispascalunit
msgid "Pascal unit"
msgstr "Модуль Паскаля"

#: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Модули Паскаля должны иметь расширение .pp или .pas"

#: lazarusidestrconsts:lispasscount
msgid "Pass Count"
msgstr "Число проходов"

#: lazarusidestrconsts:dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Передавать параметры компоновщику (отделять пробелами)"

#: lazarusidestrconsts:lismenupaste
msgid "Paste"
msgstr "Вставить"

#: lazarusidestrconsts:liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Вставить компоненты из буфера обмена"

#: lazarusidestrconsts:srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Вставить из буфера в текущую позицию"

#: lazarusidestrconsts:lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставить выбранные компоненты из буфера"

#: lazarusidestrconsts:lispath
msgid "Path"
msgstr "Путь"

#: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Редактор путей"

#: lazarusidestrconsts:lispatheditpathtemplates
msgid "Path templates"
msgstr "Шаблоны пути"

#: lazarusidestrconsts:listofpcpath
msgid "Path:"
msgstr "Путь:"

#: lazarusidestrconsts:dlgsearchpaths
msgid "Paths"
msgstr "Пути"

#: lazarusidestrconsts:lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Пути (только чтение)"

#: lazarusidestrconsts:lismenupause
msgid "Pause"
msgstr "Пауза"

#: lazarusidestrconsts:liskmpauseprogram
msgid "Pause program"
msgstr "Приостановить программу"

#: lazarusidestrconsts:dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Постоянный курсор"

#: lazarusidestrconsts:lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Проверьте тестовый каталог в %sОкружение -> Параметры окружения -> Файлы -> Каталог для сборки пробных проектов"

#: lazarusidestrconsts:lispleasecheckthecompilername
msgid "Please check the compiler name"
msgstr "Проверьте имя компилятора"

#: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory
msgid "Please check the freepascal source directory"
msgstr "Проверьте каталог исходного кода FreePascal"

#: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Выберите секцию resourcestring из списка."

#: lazarusidestrconsts:lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Откройте модуль перед запуском."

#: lazarusidestrconsts:srkmpresskey
msgid "Please press a key ..."
msgstr "Нажмите любую клавишу..."

#: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Сохраните файл перед добавлением в пакет."

#: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Сначала сохраните пакет."

#: lazarusidestrconsts:lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Выберите пакет"

#: lazarusidestrconsts:lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Выберите пакет, чтобы открыть"

#: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Выберите сначала элемент"

#: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Выделите некоторый код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts:liscodetoolsoptspoint
msgid "Point"
msgstr "Точка"

#: lazarusidestrconsts:lispointer
msgid "Pointer"
msgstr "Указатель"

#: lazarusidestrconsts:rslanguagepolish
msgid "Polish"
msgstr "Польский"

#: lazarusidestrconsts:rslanguagepolishwin
msgid "Polish(CP1250)"
msgstr "Польский (CP1250)"

#: lazarusidestrconsts:rslanguagepolishiso
msgid "Polish(ISO 8859-2)"
msgstr "Польский (ISO 8859-2)"

#: lazarusidestrconsts:rslanguageportugues
msgid "Portuguese"
msgstr "Португальский"

#: lazarusidestrconsts:lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Предпочтительный режим отображения"

#: lazarusidestrconsts:dlgwrdpreview
msgid "Preview"
msgstr "Предпросмотр"

#: lazarusidestrconsts:dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Предпросмотр(max длина=1)"

#: lazarusidestrconsts:srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Предыдущая закладка"

#: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Предыдущий элемент не может содержать дочерних."

#: lazarusidestrconsts:lisprint
msgid "Print"
msgstr "Печать"

#: lazarusidestrconsts:listodolistprintlist
msgid "Print todo items"
msgstr "Распечатать элементы ToDo"

#: lazarusidestrconsts:listodolpriority
msgid "Priority"
msgstr "Приоритет"

#: lazarusidestrconsts:lisprivate
msgid "Private"
msgstr "Private"

#: lazarusidestrconsts:lisprivatemethod
msgid "Private Method"
msgstr "Скрытый метод"

#: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgstr "Возможно, вам следует установить некоторые пакеты перед продолжением.%s%sВнимание:%sПроект зависит от некоторых пакетов, содержащих модули с процедурой Register. Эта процедура обычно используется для установки компонентов в IDE. Но следующие можули принадлежат пакетам, которые ещё не установлены в IDE. Если вы попытаетесь в IDE открыть форму, использующую эти компоненты, вы получите ошибки об отсутствующих компонентах, и загрузка формы, возможно, приведёт к очень неприятным результатам.%s%sЭто не оказывает влияния на открытие проекта и принадлежащего ему исходного кода.%s%sЭто значит только, что открытие форм для редактирования перед установкой отсутствующих компонентов является плохой идеей.%s%s"

#: lazarusidestrconsts:lisprocedure
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts:uemprocedurejump
msgid "Procedure Jump"
msgstr "Перейти к процедуре"

#: lazarusidestrconsts:srkmecprocedurelist
msgid "Procedure List ..."
msgstr "Список процедур ..."

#: lazarusidestrconsts:dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Политика вставки процедур"

#: lazarusidestrconsts:lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура с интерфейсом"

#: lazarusidestrconsts:lisceprocedures
msgid "Procedures"
msgstr "Процедуры"

#: lazarusidestrconsts:lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Процесс"

#: lazarusidestrconsts:lisproductname
msgid "Product Name:"
msgstr "Имя продукта:"

#: lazarusidestrconsts:lisproductversion
msgid "Product Version:"
msgstr "Версия продукта:"

#: lazarusidestrconsts:lisprogram
msgid "Program"
msgstr "Программа"

#: lazarusidestrconsts:lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Имя файла программы:"

#: lazarusidestrconsts:lisprogramdetected
msgid "Program detected"
msgstr "Обнаружена программа"

#: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Исходный код программы должен иметь расширение Паскаля, например, .pas, .pp или .lpr"

#: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic
msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgstr "Программа%sПрограмма FreePascal. Файл программы автоматически поддерживается lazarus."

#: lazarusidestrconsts:lisexeprograms
msgid "Programs"
msgstr "Программы"

#: lazarusidestrconsts:lispdprogress
msgid "Progress"
msgstr "Прогресс"

#: lazarusidestrconsts:dlgenvproject
msgid "Project"
msgstr "Проект"

#: lazarusidestrconsts:lisprojectsuccessfullybuilt
msgid "Project %s%s%s successfully built. :)"
msgstr "Проект %s%s%s успешно собран. :)"

#: lazarusidestrconsts:lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Путь вкл.проекта"

#: lazarusidestrconsts:lisprojectincpath
msgid "Project Include Path"
msgstr "Пути включений проекта"

#: lazarusidestrconsts:lisprojectinformation
msgid "Project Information"
msgstr "Информация о проекте"

#: lazarusidestrconsts:lismenuprojectinspector
msgid "Project Inspector"
msgstr "Инспектор проекта"

#: lazarusidestrconsts:lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Инспектор проекта - %s"

#: lazarusidestrconsts:dlgprojectoptions
msgid "Project Options"
msgstr "Параметры проекта"

#: lazarusidestrconsts:lismenuprojectoptions
msgid "Project Options ..."
msgstr "Параметры проекта ..."

#: lazarusidestrconsts:lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Метка каталога с исходным кодом проекта"

#: lazarusidestrconsts:lisprojectsrcpath
msgid "Project Src Path"
msgstr "Путь к исходному коду проекта"

#: lazarusidestrconsts:lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Путь к исходному коду проекта"

#: lazarusidestrconsts:lisprojectunitpath
msgid "Project Unit Path"
msgstr "Путь к модулям проекта"

#: lazarusidestrconsts:lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Путь к модулям проекта"

#: lazarusidestrconsts:lisprojectwizard
msgid "Project Wizard"
msgstr "Мастер создания проекта"

#: lazarusidestrconsts:lisprojectchanged
msgid "Project changed"
msgstr "Проект изменен"

#: lazarusidestrconsts:lisprojectdirectory
msgid "Project directory"
msgstr "Имя каталога проекта"

#: lazarusidestrconsts:lisprojectfilename
msgid "Project filename"
msgstr "Имя файла проекта"

#: lazarusidestrconsts:dlgprojfiles
msgid "Project files"
msgstr "Файлы проекта"

#: lazarusidestrconsts:lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Обнаружен файл сведений проекта"

#: lazarusidestrconsts:lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект является запускаемым"

#: lazarusidestrconsts:lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Свойства макросов проекта"

#: lazarusidestrconsts:srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команды меню Проект"

#: lazarusidestrconsts:lispkgmangproject
msgid "Project: %s"
msgstr "Проект: %s"

#: lazarusidestrconsts:lispromptforvalue
msgid "Prompt for value"
msgstr "Подсказка по значению"

#: lazarusidestrconsts:lisceproperties
msgid "Properties"
msgstr "Свойства"

#: lazarusidestrconsts:lishlpoptsproperties
msgid "Properties:"
msgstr "Свойства:"

#: lazarusidestrconsts:dlgpropertycompletion
msgid "Property completion"
msgstr "Завершение свойств"

#: lazarusidestrconsts:dlgpropnamecolor
msgid "Property name"
msgstr "Имя свойства"

#: lazarusidestrconsts:lisprotected
msgid "Protected"
msgstr "Protected"

#: lazarusidestrconsts:lisprotectedmethod
msgid "Protected Method"
msgstr "Защищённый метод"

#: lazarusidestrconsts:lispckoptsprovides
msgid "Provides"
msgstr "Возможности"

#: lazarusidestrconsts:lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts:lispublicmethod
msgid "Public Method"
msgstr "Общий метод"

#: lazarusidestrconsts:lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опубликовать пакет"

#: lazarusidestrconsts:lismenupublishproject
msgid "Publish Project ..."
msgstr "Опубликовать проект ..."

#: lazarusidestrconsts:liskmpublishproject
msgid "Publish project"
msgstr "Опубликовать проект"

#: lazarusidestrconsts:lispublishprojdir
msgid "Publish project directory"
msgstr "Каталог публикации проекта"

#: lazarusidestrconsts:lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts:lispublishedmethod
msgid "Published Method"
msgstr "Опубликованный метод"

#: lazarusidestrconsts:lislazbuildquickbuildoptions
msgid "Quick Build Options"
msgstr "Простые параметры сборки"

#: lazarusidestrconsts:lismenuquickcompile
msgid "Quick compile"
msgstr "Быстрая компиляция"

#: lazarusidestrconsts:liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Быстрая компиляция, без компоновки"

#: lazarusidestrconsts:lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Быстрая проверка синтаксиса"

#: lazarusidestrconsts:lismenuquit
msgid "Quit"
msgstr "Выход"

#: lazarusidestrconsts:lisquitlazarus
msgid "Quit Lazarus"
msgstr "Выход из Lazarus"

#: lazarusidestrconsts:dlgcorange
msgid "Range"
msgstr "Диапазона"

#: lazarusidestrconsts:lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Обновить зависимость"

#: lazarusidestrconsts:lispckeditreaddfile
msgid "Re-Add file"
msgstr "Обновить файл"

#: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпилировать"

#: lazarusidestrconsts:lisreaderror
msgid "Read Error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts:uemreadonly
msgid "Read Only"
msgstr "Только чтение"

#: lazarusidestrconsts:lispckeditreadonly
msgid "Read Only: %s"
msgstr "Только чтение:%s"

#: lazarusidestrconsts:liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts:dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префикс READ"

#: lazarusidestrconsts:uepreadonly
msgid "Readonly"
msgstr "Только чтение"

#: lazarusidestrconsts:lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Пересобрать Lazarus?"

#: lazarusidestrconsts:lisiecorecentfiles
msgid "Recent files"
msgstr "Недавние файлы"

#: lazarusidestrconsts:lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Требуется пересобрать все"

#: lazarusidestrconsts:lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Чистая пересборка"

#: lazarusidestrconsts:lisrecordstruct
msgid "Record/Structure"
msgstr "Запись/Структура"

#: lazarusidestrconsts:lismenuredo
msgid "Redo"
msgstr "Вернуть"

#: lazarusidestrconsts:lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Уменьшить прорисовку дизайнеров"

#: lazarusidestrconsts:uemrefactor
msgid "Refactoring"
msgstr "Переработка кода"

#: lazarusidestrconsts:dlgreferencecolor
msgid "Reference"
msgstr "Ссылка"

#: lazarusidestrconsts:dlgunitdeprefresh
msgid "Refresh"
msgstr "Обновить"

#: lazarusidestrconsts:lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Обновлять автоматически"

#: lazarusidestrconsts:listodolistrefresh
msgid "Refresh todo items"
msgstr "Обновить элементы ToDo"

#: lazarusidestrconsts:lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Процедура регистрации пуста"

#: lazarusidestrconsts:lispckeditregisterunit
msgid "Register unit"
msgstr "Зарегистрировать модуль"

#: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Был вызван RegisterUnit, но пакетов не зарегистрировано."

#: lazarusidestrconsts:lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зарегистрированные дополнения"

#: lazarusidestrconsts:lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Ошибка регистрации"

#: lazarusidestrconsts:lisregularexpression
msgid "Regular expression"
msgstr "Регулярное выражение"

#: lazarusidestrconsts:lisrelativepaths
msgid "Relative paths"
msgstr "Относительные пути"

#: lazarusidestrconsts:lispckoptsrelease
msgid "Release"
msgstr "Релиз"

#: lazarusidestrconsts:lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Перегрузить с диска"

#: lazarusidestrconsts:lisexttoolremove
msgid "Remove"
msgstr "Удалить"

#: lazarusidestrconsts:lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Удалить зависимость?"

#: lazarusidestrconsts:liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Удалить текущий модуль из проекта"

#: lazarusidestrconsts:lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Удалить все некорректные свойства"

#: lazarusidestrconsts:liskmremovebreakpoint
msgid "Remove break point"
msgstr "Удалить точку останова"

#: lazarusidestrconsts:lispckeditremovedependency
msgid "Remove dependency"
msgstr "Удалить зависимость"

#: lazarusidestrconsts:lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить зависимость %s%s%s%sиз пакета %s%s%s?"

#: lazarusidestrconsts:srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Удалить пустые методы"

#: lazarusidestrconsts:lispckeditremovefile
msgid "Remove file"
msgstr "Удалить файл"

#: lazarusidestrconsts:lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Удалить файл %s из проекта?"

#: lazarusidestrconsts:lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить файл %s%s%s%s из пакета %s%s%s?"

#: lazarusidestrconsts:lispckeditremovefile2
msgid "Remove file?"
msgstr "Удалить файл?"

#: lazarusidestrconsts:liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Удалить файлы по фильтру"

#: lazarusidestrconsts:lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Убрать из проекта ..."

#: lazarusidestrconsts:lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Удалить из избранных свойств"

#: lazarusidestrconsts:lisremovefromproject
msgid "Remove from project"
msgstr "Удалить из проекта"

#: lazarusidestrconsts:lisemdremovemethods
msgid "Remove methods"
msgstr "Удалить методы"

#: lazarusidestrconsts:liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Удалить путь"

#: lazarusidestrconsts:lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Удалить выбранный элемент"

#: lazarusidestrconsts:lisremovethem
msgid "Remove them"
msgstr "Удалить их"

#: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Удалённые файлы (эти элементы не сохранятся в lpk-файле)"

#: lazarusidestrconsts:lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Удалены требуемые пакеты"

#: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Удалены требуемые пакеты (они не сохранятся в lpk-файле)"

#: lazarusidestrconsts:lisfrirename
msgid "Rename"
msgstr "Переименовать"

#: lazarusidestrconsts:lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Переименовать файл в нижн.рег-ре?"

#: lazarusidestrconsts:uemrenameidentifier
msgid "Rename Identifier"
msgstr "Переименовать идентификатор"

#: lazarusidestrconsts:lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Переименовать идентификатор ..."

#: lazarusidestrconsts:lisfrirenameallreferences
msgid "Rename all References"
msgstr "Переименовать все ссылки"

#: lazarusidestrconsts:lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не удалось переименовать файл"

#: lazarusidestrconsts:lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Переименовать файл в пакете?"

#: lazarusidestrconsts:lisrenamefile
msgid "Rename file?"
msgstr "Переименовать файл?"

#: lazarusidestrconsts:srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Переименовать идентификатор"

#: lazarusidestrconsts:lisfrirenameto
msgid "Rename to"
msgstr "Переименовать в"

#: lazarusidestrconsts:lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Преобразовать в нижний регистр"

#: lazarusidestrconsts:lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Открыть с другой кодировкой"

#: lazarusidestrconsts:lisrepeatcount
msgid "Repeat Count:"
msgstr "Число повторов:"

#: lazarusidestrconsts:lismenureplace
msgid "Replace"
msgstr "Замена"

#: lazarusidestrconsts:dlgreplaceall
msgid "Replace &All"
msgstr "Заменить &Все"

#: lazarusidestrconsts:lispkgmangreplacefile
msgid "Replace File"
msgstr "Заменить файл"

#: lazarusidestrconsts:lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Заменить существующий файл %s%s%s?"

#: lazarusidestrconsts:srkmecreplace
msgid "Replace text"
msgstr "Заменить текст"

#: lazarusidestrconsts:lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Заменить %s%s%s%s на %s%s%s в этом месте?"

#: lazarusidestrconsts:lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Замена выделенного не удалась."

#: lazarusidestrconsts:dlgreport
msgid "Report"
msgstr "Отчёт"

#: lazarusidestrconsts:lismenureportingbug
msgid "Reporting a bug..."
msgstr "Сообщить об ошибке..."

#: lazarusidestrconsts:lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Требуемые пакеты"

#: lazarusidestrconsts:lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Пересмотреть каталог исходного кода FPC"

#: lazarusidestrconsts:lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Сброс результатов"

#: lazarusidestrconsts:lismenuresetdebugger
msgid "Reset debugger"
msgstr "Сброс отладчика"

#: lazarusidestrconsts:lisresourceloaderror
msgid "Resource load error"
msgstr "Ошибка загрузки ресурса"

#: lazarusidestrconsts:lisresourcesaveerror
msgid "Resource save error"
msgstr "Ошибка сохранения ресурса"

#: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Строка ресурсов уже существует"

#: lazarusidestrconsts:lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Секция Resourcestring:"

#: lazarusidestrconsts:lismenurestart
msgid "Restart"
msgstr "Перезапуск"

#: lazarusidestrconsts:lislazbuildrestartafterbuild
msgid "Restart after successful Build"
msgstr "Перезапустить после успешной сборки"

#: lazarusidestrconsts:rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Восстановить геометрию окна"

#: lazarusidestrconsts:rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Восстановить размер окна"

#: lazarusidestrconsts:lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Браузер ограничений"

#: lazarusidestrconsts:dlgccoresults
msgid "Results"
msgstr "Результаты"

#: lazarusidestrconsts:lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Продолжить"

#: lazarusidestrconsts:lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Продолжить при обработанных"

#: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Продолжить при необработанных"

#: lazarusidestrconsts:lismenurevert
msgid "Revert"
msgstr "Возвратить"

#: lazarusidestrconsts:lisrevertfailed
msgid "Revert failed"
msgstr "Возвращение не удалось"

#: lazarusidestrconsts:lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Возвратить пакет?"

#: lazarusidestrconsts:lisright
msgid "Right"
msgstr "Стрелка вправо"

#: lazarusidestrconsts:dlgrightclickselects
msgid "Right Click selects"
msgstr "Выбор правым щелчком"

#: lazarusidestrconsts:lisrightanchoring
msgid "Right anchoring"
msgstr "Правая привязка"

#: lazarusidestrconsts:lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Правый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства справа от компонента."

#: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Правый щелчок на элементе дерева даст меню со всеми доступными функциями пакета."

#: lazarusidestrconsts:dlgrightmargin
msgid "Right margin"
msgstr "Правая граница"

#: lazarusidestrconsts:dlgrightmargincolor
msgid "Right margin color"
msgstr "Цвет правой границы"

#: lazarusidestrconsts:dlgrightmousemovescursor
msgid "Right mouse moves cursor"
msgstr "Правая кнопка перемещает курсор"

#: lazarusidestrconsts:lisrightsides
msgid "Right sides"
msgstr "Правые края"

#: lazarusidestrconsts:lisrightspaceequally
msgid "Right space equally"
msgstr "Равномерно по правым краям"

#: lazarusidestrconsts:dlgrubberbandgroup
msgid "Rubber band"
msgstr "Поле заметок"

#: lazarusidestrconsts:lismenuprojectrun
msgid "Run"
msgstr "Запуск"

#: lazarusidestrconsts:lisbfruncommand
msgid "Run Command"
msgstr "Команда запуска"

#: lazarusidestrconsts:lismenurunfile
msgid "Run File"
msgstr "Запустить файл"

#: lazarusidestrconsts:lismenurunparameters
msgid "Run Parameters ..."
msgstr "Параметры запуска ..."

#: lazarusidestrconsts:srkmcatrunmenu
msgid "Run menu commands"
msgstr "Команды меню Запуск"

#: lazarusidestrconsts:dlgrunparameters
msgid "Run parameters"
msgstr "Параметры запуска"

#: lazarusidestrconsts:liskmrunprogram
msgid "Run program"
msgstr "Запустить программу"

#: lazarusidestrconsts:lismenuruntocursor
msgid "Run to cursor"
msgstr "Запуск до курсора"

#: lazarusidestrconsts:lisruntofailed
msgid "Run-to failed"
msgstr "Запуск-до не удался"

#: lazarusidestrconsts:lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Только времени выполнения"

#: lazarusidestrconsts:rslanguagerussian
msgid "Russian"
msgstr "Русский"

#: lazarusidestrconsts:lissvnrevision
msgid "SVN Revision: "
msgstr "Ревизия SVN:"

#: lazarusidestrconsts:dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "То же имя (в подкаталоге)"

#: lazarusidestrconsts:lismenusave
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts:lissavespace
msgid "Save "
msgstr "Сохранить "

#: lazarusidestrconsts:lissave
msgid "Save ..."
msgstr "Сохранить ..."

#: lazarusidestrconsts:lismenusaveall
msgid "Save All"
msgstr "Сохранить все"

#: lazarusidestrconsts:lismenutemplatesaveas
msgid "Save As"
msgstr "Сохранить как"

#: lazarusidestrconsts:dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Автопереименование в нижний регистр в диалоге 'Сохранить как'"

#: lazarusidestrconsts:lismenusaveas
msgid "Save As ..."
msgstr "Сохранить как ..."

#: lazarusidestrconsts:lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Сохранить как шаблон..."

#: lazarusidestrconsts:lispckeditsavechanges
msgid "Save Changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts:lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Сохранить пакет %s (*.lpk)"

#: lazarusidestrconsts:lispkgmangsavepackage
msgid "Save Package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts:lismenusaveproject
msgid "Save Project"
msgstr "Сохранить проект"

#: lazarusidestrconsts:lissaveprojectlpi
msgid "Save Project %s (*.lpi)"
msgstr "Сохранить прокет %s (*.lpi)"

#: lazarusidestrconsts:lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Сохранить проект как ..."

#: lazarusidestrconsts:lissavesettings
msgid "Save Settings"
msgstr "Сохранить параметры"

#: lazarusidestrconsts:lishintsaveall
msgid "Save all"
msgstr "Сохранить все"

#: lazarusidestrconsts:lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Сохранить все сообщения в файл"

#: lazarusidestrconsts:liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Сохранить и выйти"

#: lazarusidestrconsts:lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Сохранить и выйти из диалога"

#: lazarusidestrconsts:lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Сохранить и перезапустить IDE"

#: lazarusidestrconsts:lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Сохранить изменения в проект %s?"

#: lazarusidestrconsts:lissavechanges
msgid "Save changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts:dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Сохранить рабочий стол в файл"

#: lazarusidestrconsts:dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Сохранять сведения о закрываемых файлах"

#: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Сохранять информацию редактора для файлов, не принадлежащих проекту"

#: lazarusidestrconsts:dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Сохранять сведения только о файлах проекта"

#: lazarusidestrconsts:lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Сохранить файл %s%s%sперед закрытием формы %s%s%s?"

#: lazarusidestrconsts:lissavefileas
msgid "Save file as"
msgstr "Сохранить файл как"

#: lazarusidestrconsts:lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Диалог сохранения файла"

#: lazarusidestrconsts:fdmsaveformasxml
msgid "Save form as xml"
msgstr "Сохранить форму в виде XML"

#: lazarusidestrconsts:lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Сохранять в файле .lpi"

#: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Сохранять в файле .lps в каталоге проекта"

#: lazarusidestrconsts:lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Сохранять в каталоге настроек IDE"

#: lazarusidestrconsts:lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Сохранять информацию о файлах, закрытых в редакторе"

#: lazarusidestrconsts:lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Сохранить сообщения в файл (*.txt)"

#: lazarusidestrconsts:lispckeditsavepackage
msgid "Save package"
msgstr "Сохранить пакет"

#: lazarusidestrconsts:lispkgmangsavepackage2
msgid "Save package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts:liskmsaveproject
msgid "Save project"
msgstr "Сохранить проект"

#: lazarusidestrconsts:liskmsaveprojectas
msgid "Save project as"
msgstr "Сохранить проект как"

#: lazarusidestrconsts:lisposavesessioninformationin
msgid "Save session information in"
msgstr "Сохранять информацию о сеансе работы в"

#: lazarusidestrconsts:lislazbuildsavesettings
msgid "Save settings"
msgstr "Сохранить параметры"

#: lazarusidestrconsts:lisiecosavetofile
msgid "Save to file"
msgstr "Сохранить в файл"

#: lazarusidestrconsts:lisiecosavetorecent
msgid "Save to recent"
msgstr "Сохранить в недавних"

#: lazarusidestrconsts:liskmsaveall
msgid "SaveAll"
msgstr "Сохранить всё"

#: lazarusidestrconsts:liskmsaveas
msgid "SaveAs"
msgstr "Сохранить как"

#: lazarusidestrconsts:fdmscaleword
msgid "Scale"
msgstr "Масштаб"

#: lazarusidestrconsts:lisscalingfactor
msgid "Scaling factor:"
msgstr "Масштабный фактор:"

#: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Искать в модуле имя и процедуру Register"

#: lazarusidestrconsts:liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Поиск сообщений FPC"

#: lazarusidestrconsts:liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Поиск сообщений Make"

#: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Поиск сообщений компилятора FreePascal в выводе"

#: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Поиск сообщений make в выводе"

#: lazarusidestrconsts:rsscanners
msgid "Scanners"
msgstr "Лексические анализаторы"

#: lazarusidestrconsts:dlgscope
msgid "Scope"
msgstr "Где"

#: lazarusidestrconsts:dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Прокручивать на строку меньше"

#: lazarusidestrconsts:srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутить вниз 1 строку"

#: lazarusidestrconsts:srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутить влево 1 символ"

#: lazarusidestrconsts:dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокручивать за конец файла"

#: lazarusidestrconsts:dlgscrollpastendline
msgid "Scroll past end of line"
msgstr "Прокручивать за конец строки"

#: lazarusidestrconsts:srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутить влево 1 символ"

#: lazarusidestrconsts:srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутить вверх 1 строку"

#: lazarusidestrconsts:lissearchfor
msgid "Search For "
msgstr "Искать "

#: lazarusidestrconsts:lismenuviewsearchresults
msgid "Search Results"
msgstr "Результаты поиска"

#: lazarusidestrconsts:lissearchagain
msgid "Search again"
msgstr "Искать снова"

#: lazarusidestrconsts:lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Искать и в комментариях"

#: lazarusidestrconsts:lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Искать в следующих секциях класса"

#: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist
msgid "Search or Filter Phrases In List"
msgstr "Поиск или фильтрация фраз в списке"

#: lazarusidestrconsts:lispatheditsearchpaths
msgid "Search paths:"
msgstr "Пути поиска"

#: lazarusidestrconsts:lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Строка поиска '%s' не найдена!"

#: lazarusidestrconsts:dlgsearchabort
msgid "Search terminated by user."
msgstr "Поиск прерван пользователем."

#: lazarusidestrconsts:lisssearchtext
msgid "Search text"
msgstr "Поиск текста"

#: lazarusidestrconsts:lisfrisearchwhere
msgid "Search where"
msgstr "Искать где"

#: lazarusidestrconsts:lisssearching
msgid "Searching"
msgstr "Поиск"

#: lazarusidestrconsts:dlgsearchcaption
msgid "Searching..."
msgstr "Поиск..."

#: lazarusidestrconsts:lisuesearching
msgid "Searching: %s"
msgstr "Ищу: %s"

#: lazarusidestrconsts:liscodehelpseealsotag
msgid "See also"
msgstr "Смотрите также"

#: lazarusidestrconsts:lisseemessages
msgid "See messages."
msgstr "См. сообщения."

#: lazarusidestrconsts:srkmecselleft
msgid "SelLeft"
msgstr "SelLeft"

#: lazarusidestrconsts:srkmecselright
msgid "SelRight"
msgstr "SelRight"

#: lazarusidestrconsts:lismenuselect
msgid "Select"
msgstr "Выделить"

#: lazarusidestrconsts:srkmecselectall
msgid "Select All"
msgstr "Выделить все"

#: lazarusidestrconsts:lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Выбрать макрос кода"

#: lazarusidestrconsts:lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Выберите файлы форм Delphi (*.dfm)"

#: lazarusidestrconsts:srkmecseldown
msgid "Select Down"
msgstr "Выделить вниз"

#: lazarusidestrconsts:srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Выделить переход по коорд."

#: lazarusidestrconsts:srkmecsellineend
msgid "Select Line End"
msgstr "Выделить конец строки"

#: lazarusidestrconsts:srkmecsellinestart
msgid "Select Line Start"
msgstr "Выделить начало строки"

#: lazarusidestrconsts:lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Выбрать меню:"

#: lazarusidestrconsts:srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Выделить низ страницы"

#: lazarusidestrconsts:srkmecselpagedown
msgid "Select Page Down"
msgstr "Выделить страницу снизу"

#: lazarusidestrconsts:srkmecselpageleft
msgid "Select Page Left"
msgstr "Выделить страницу слева"

#: lazarusidestrconsts:srkmecselpageright
msgid "Select Page Right"
msgstr "Выделить страницу справа"

#: lazarusidestrconsts:srkmecselpagetop
msgid "Select Page Top"
msgstr "Выделить верх страницы"

#: lazarusidestrconsts:srkmecselpageup
msgid "Select Page Up"
msgstr "Выделить страницу сверху"

#: lazarusidestrconsts:lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Выбрать шаблон:"

#: lazarusidestrconsts:srkmecselup
msgid "Select Up"
msgstr "Выделить вверх"

#: lazarusidestrconsts:srkmecselwordleft
msgid "Select Word Left"
msgstr "Выделить слово слева"

#: lazarusidestrconsts:srkmecselwordright
msgid "Select Word Right"
msgstr "Выделить слово справа"

#: lazarusidestrconsts:lisselectahelpitem
msgid "Select a help item:"
msgstr "Искать элемент справки:"

#: lazarusidestrconsts:lisselectanode
msgid "Select a node"
msgstr "Выберите элемент"

#: lazarusidestrconsts:lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Выберите тип проекта"

#: lazarusidestrconsts:lismenuselectall
msgid "Select all"
msgstr "Выделить все"

#: lazarusidestrconsts:rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Выбрать унаследованный элемент"

#: lazarusidestrconsts:lismenuselectcodeblock
msgid "Select code block"
msgstr "Выделить блок кода"

#: lazarusidestrconsts:lispatheditselectdirectory
msgid "Select directory"
msgstr "Выбрать каталог"

#: lazarusidestrconsts:dlgrubberbandselectsgrandchilds
msgid "Select grand childs"
msgstr "Выбирать внуков"

#: lazarusidestrconsts:lismenuselectline
msgid "Select line"
msgstr "Выделить строку"

#: lazarusidestrconsts:liskmselectlineend
msgid "Select line end"
msgstr "Выделить конец строки"

#: lazarusidestrconsts:liskmselectlinestart
msgid "Select line start"
msgstr "Выделить начало строки"

#: lazarusidestrconsts:lissamselectnone
msgid "Select none"
msgstr "Снять выделение"

#: lazarusidestrconsts:liskmselectpagebottom
msgid "Select page bottom"
msgstr "Выделить низ страницы"

#: lazarusidestrconsts:liskmselectpagetop
msgid "Select page top"
msgstr "Выделить верх страницы"

#: lazarusidestrconsts:lismenuselectparagraph
msgid "Select paragraph"
msgstr "Выделить абзац"

#: lazarusidestrconsts:lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Выбрать родительский компонент"

#: lazarusidestrconsts:lisselectfile
msgid "Select the file"
msgstr "Выберите файл"

#: lazarusidestrconsts:srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Выделить до самого начала"

#: lazarusidestrconsts:srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Выделить до самого конца"

#: lazarusidestrconsts:lismenuselecttobrace
msgid "Select to brace"
msgstr "Выделить до скобки"

#: lazarusidestrconsts:lismenuselectword
msgid "Select word"
msgstr "Выделить слово"

#: lazarusidestrconsts:liskmselectwordleft
msgid "Select word left"
msgstr "Выделить слово слева"

#: lazarusidestrconsts:liskmselectwordright
msgid "Select word right"
msgstr "Выделить слово справа"

#: lazarusidestrconsts:liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Выделить элемент:"

#: lazarusidestrconsts:lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Выбранный пакет нужен для:"

#: lazarusidestrconsts:dlgruberbandselectioncolor
msgid "Selection"
msgstr "Выделение"

#: lazarusidestrconsts:lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Выбор превышает строковую константу"

#: lazarusidestrconsts:lisselectiontool
msgid "Selection tool"
msgstr "Средство выбора"

#: lazarusidestrconsts:liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Точка с запятой"

#: lazarusidestrconsts:dlgposavesession
msgid "Session"
msgstr "Сеанс работы"

#: lazarusidestrconsts:srkmecsetmarker
msgid "Set Marker %d"
msgstr "Установить маркер %d"

#: lazarusidestrconsts:uemsetfreebookmark
msgid "Set a free Bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts:lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts:dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Установить все элементы по умолчанию"

#: lazarusidestrconsts:dlgsetelementdefault
msgid "Set element to default"
msgstr "Установить элемент по умолчанию"

#: lazarusidestrconsts:liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts:liskmsetmarker0
msgid "Set marker 0"
msgstr "Добавить маркер 0"

#: lazarusidestrconsts:liskmsetmarker1
msgid "Set marker 1"
msgstr "Добавить маркер 1"

#: lazarusidestrconsts:liskmsetmarker2
msgid "Set marker 2"
msgstr "Добавить маркер 2"

#: lazarusidestrconsts:liskmsetmarker3
msgid "Set marker 3"
msgstr "Добавить маркер 3"

#: lazarusidestrconsts:liskmsetmarker4
msgid "Set marker 4"
msgstr "Добавить маркер 4"

#: lazarusidestrconsts:liskmsetmarker5
msgid "Set marker 5"
msgstr "Добавить маркер 5"

#: lazarusidestrconsts:liskmsetmarker6
msgid "Set marker 6"
msgstr "Добавить маркер 6"

#: lazarusidestrconsts:liskmsetmarker7
msgid "Set marker 7"
msgstr "Добавить маркер 7"

#: lazarusidestrconsts:liskmsetmarker8
msgid "Set marker 8"
msgstr "Добавить маркер 8"

#: lazarusidestrconsts:liskmsetmarker9
msgid "Set marker 9"
msgstr "Добавить маркер 9"

#: lazarusidestrconsts:dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Переменная свойства"

#: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Установить точку останова всё равно"

#: lazarusidestrconsts:lisedtexttoolshift
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts:srkmecshifttab
msgid "Shift Tab"
msgstr "Сдвинуть ТАБ"

#: lazarusidestrconsts:liscodehelpshorttag
msgid "Short"
msgstr "Краткое"

#: lazarusidestrconsts:liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Краткое описание"

#: lazarusidestrconsts:lisshort
msgid "Short:"
msgstr "Краткое:"

#: lazarusidestrconsts:lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Сократить или развернуть имя файла"

#: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Должен ли файл быть переименован в нижн. рег. в %s%s%s%s?"

#: lazarusidestrconsts:lisshow
msgid "Show"
msgstr "Показать"

#: lazarusidestrconsts:lisaf2pshowall
msgid "Show All"
msgstr "Показать все"

#: lazarusidestrconsts:liscemodeshowcategories
msgid "Show Categories"
msgstr "Показать категории"

#: lazarusidestrconsts:lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Показать значения CodeTools"

#: lazarusidestrconsts:dlgcoshowerr
msgid "Show Errors"
msgstr "Показывать ошибки"

#: lazarusidestrconsts:dlgguidelines
msgid "Show Guide Lines"
msgstr "Показывать линии позиционирования"

#: lazarusidestrconsts:dlgshowhint
msgid "Show Hints"
msgstr "Показывать подсказки"

#: lazarusidestrconsts:dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Подсказки 'Parameter \"Sender\" not used'"

#: lazarusidestrconsts:dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Подсказки о неиспользуемых модулях"

#: lazarusidestrconsts:uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Показывать номера строк"

#: lazarusidestrconsts:dlgshownotes
msgid "Show Notes"
msgstr "Показывать заметки"

#: lazarusidestrconsts:dlgcoshowoptions
msgid "Show Options"
msgstr "Показать параметры"

#: lazarusidestrconsts:fdmshowoptions
msgid "Show Options for form editing"
msgstr "Показать параметры редактирования форм"

#: lazarusidestrconsts:liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Показать узлы исходного кода"

#: lazarusidestrconsts:dlgshowwarnings
msgid "Show Warnings"
msgstr "Показывать предупреждения"

#: lazarusidestrconsts:srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Показать абстрактные методы"

#: lazarusidestrconsts:lisa2pshowall
msgid "Show all"
msgstr "Показать все"

#: lazarusidestrconsts:liscoshowallmessages
msgid "Show all messages"
msgstr "Показать все сообщения"

#: lazarusidestrconsts:dlgshowprocserror
msgid "Show all procs on error"
msgstr "Все процедуры при ошибках"

#: lazarusidestrconsts:dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Показывать зазор у границ"

#: lazarusidestrconsts:dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Показывать кнопки закрытия закладок"

#: lazarusidestrconsts:srkmecshowcodecontext
msgid "Show code context"
msgstr "Показывать контекст кода"

#: lazarusidestrconsts:dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Показывать диалог компиляции"

#: lazarusidestrconsts:dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показывать компилируемые процедуры"

#: lazarusidestrconsts:dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Показать параметры компилятора"

#: lazarusidestrconsts:dlgshowcaps
msgid "Show component captions"
msgstr "Показать названия компонентов"

#: lazarusidestrconsts:dlgshowconditionals
msgid "Show conditionals"
msgstr "Показывать условия"

#: lazarusidestrconsts:dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показывать отладочную информацию"

#: lazarusidestrconsts:dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Показывать определённые макросы"

#: lazarusidestrconsts:dlgshowedrhints
msgid "Show editor hints"
msgstr "Показывать подсказки редактора"

#: lazarusidestrconsts:liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Показать пустые методы"

#: lazarusidestrconsts:dlgshoweverything
msgid "Show everything"
msgstr "Показывать всё"

#: lazarusidestrconsts:dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Показывать информацию об exe (только Win32)"

#: lazarusidestrconsts:dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показывать общие сведения"

#: lazarusidestrconsts:lispldshowgloballinks
msgid "Show global links"
msgstr "Показывать глобальные ссылки"

#: lazarusidestrconsts:dlgqshowgrid
msgid "Show grid"
msgstr "Показать сетку"

#: lazarusidestrconsts:dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Всплывающие подсказки поля (лев)"

#: lazarusidestrconsts:lisshowhintsinobjectinspector
msgid "Show hints in Object Inspector"
msgstr "Показывать всплывающие подсказки в инспекторе объектов"

#: lazarusidestrconsts:lisshowidentifiers
msgid "Show identifiers"
msgstr "Показывать идентификаторы"

#: lazarusidestrconsts:dlgshowlinenumbers
msgid "Show line numbers"
msgstr "Показывать номера строк"

#: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Показывать сообщение при остановке"

#: lazarusidestrconsts:dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Ничего не показывать (только ошибки)"

#: lazarusidestrconsts:lisshowoldtaborder
msgid "Show old tab order"
msgstr "Показать старый порядок перехода"

#: lazarusidestrconsts:lisshowpackages
msgid "Show packages"
msgstr "Показывать пакеты"

#: lazarusidestrconsts:dlgshowscrollhint
msgid "Show scroll hint"
msgstr "Показывать подсказку при прокрутке"

#: lazarusidestrconsts:lisshowspecialcharacters
msgid "Show special characters"
msgstr "Показывать специальные символы"

#: lazarusidestrconsts:dlgshowsummary
msgid "Show summary"
msgstr "Показать сводку"

#: lazarusidestrconsts:dlgshowtriedfiles
msgid "Show tried files"
msgstr "Показывать опробованные файлы"

#: lazarusidestrconsts:lisshowunits
msgid "Show units"
msgstr "Показывать модули"

#: lazarusidestrconsts:dlgshowusedfiles
msgid "Show used files"
msgstr "Показывать используемые файлы"

#: lazarusidestrconsts:lispldshowuserlinks
msgid "Show user links"
msgstr "Показывать пользовательские ссылки"

#: lazarusidestrconsts:lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Сжать до наименьшего"

#: lazarusidestrconsts:lissibling
msgid "Sibling"
msgstr "Сосед"

#: lazarusidestrconsts:lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Сигналы"

#: lazarusidestrconsts:lissimplesyntax
msgid "Simple Syntax"
msgstr "Простой синтаксис"

#: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простой синтаксис (например, * вместо .*)"

#: lazarusidestrconsts:fdmsizeword
msgid "Size"
msgstr "Размер"

#: lazarusidestrconsts:lisuidsize
msgid "Size:"
msgstr "Размер:"

#: lazarusidestrconsts:lisccoskip
msgid "Skip"
msgstr "Пропуск"

#: lazarusidestrconsts:liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Пропуск вызова компилятора"

#: lazarusidestrconsts:lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Пропустить файл и продолжить загрузку"

#: lazarusidestrconsts:lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Пропустить загрузку предыдущего проекта"

#: lazarusidestrconsts:lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Пропустить это сообщение"

#: lazarusidestrconsts:rslanguageslovak
msgid "Slovak"
msgstr "Словацкий"

#: lazarusidestrconsts:dlgcosmaller
msgid "Smaller Code"
msgstr "Меньший код"

#: lazarusidestrconsts:dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Умное связывание"

#: lazarusidestrconsts:dlgsmarttabs
msgid "Smart tabs"
msgstr "Умные ТАБы"

#: lazarusidestrconsts:dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Выравнивать по линиям позиционирования"

#: lazarusidestrconsts:dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Выравнивать по сетке"

#: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Некоторые файлы изменены на диске:"

#: lazarusidestrconsts:lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Извините, пока не реализовано"

#: lazarusidestrconsts:lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Извините, этот тип ещё не реализован"

#: lazarusidestrconsts:lispesortfiles
msgid "Sort files"
msgstr "Сортировать файлы"

#: lazarusidestrconsts:lissortselsortselection
msgid "Sort selection"
msgstr "Сортировка выбранного"

#: lazarusidestrconsts:lismenusortselection
msgid "Sort selection ..."
msgstr "Сортировка выбранного ..."

#: lazarusidestrconsts:lisceomodesource
msgid "Source"
msgstr "Исходный код"

#: lazarusidestrconsts:lismenuviewsourceeditor
msgid "Source Editor"
msgstr "Редактор исходного кода"

#: lazarusidestrconsts:srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команды закладок исходного кода"

#: lazarusidestrconsts:lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Источник и назначение одинаковы:%s%s"

#: lazarusidestrconsts:lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Точка останова в исходном коде"

#: lazarusidestrconsts:lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Каталог исходного кода %s%s%s не существует."

#: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Исходный каталог %s%s%s%sи каталог назначения %s%s%s%sсовпадают.%s%sВозможно, вы не поняли смысл функции.%sОна очистит/пересоздаст каталог назначения%sи скопирует в него пакет/проект."

#: lazarusidestrconsts:lissourcemodified
msgid "Source modified"
msgstr "Исходный код изменён"

#: lazarusidestrconsts:lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Исходный код  на странице %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lissourcepaths
msgid "Source paths"
msgstr "Пути к исходному коду"

#: lazarusidestrconsts:lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Предпросмотр исходного кода"

#: lazarusidestrconsts:dlgspacenotcosmos
msgid "Space"
msgstr "Пробел"

#: lazarusidestrconsts:lisspaceequally
msgid "Space equally"
msgstr "Равномерно"

#: lazarusidestrconsts:rslanguagespanish
msgid "Spanish"
msgstr "Испанский"

#: lazarusidestrconsts:lisuidsrc
msgid "Src"
msgstr "Исх"

#: lazarusidestrconsts:lissrcos
msgid "Src OS"
msgstr "Исходная ОС"

#: lazarusidestrconsts:dlgcostack
msgid "Stack"
msgstr "Стека"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Стандартное меню Правка"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Стандартное меню Файл"

#: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Стандартное меню Справка"

#: lazarusidestrconsts:lisstartwithanewproject
msgid "Start with a new project"
msgstr "При запуске начинать новый проект"

#: lazarusidestrconsts:lisoipstate
msgid "State"
msgstr "Состояние"

#: lazarusidestrconsts:dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Ключевое слово Static в объектах"

#: lazarusidestrconsts:lishintstepinto
msgid "Step Into"
msgstr "Шаг со входом"

#: lazarusidestrconsts:lishintstepover
msgid "Step Over"
msgstr "Шаг в обход"

#: lazarusidestrconsts:lismenustepinto
msgid "Step into"
msgstr "Шаг со входом"

#: lazarusidestrconsts:lismenustepover
msgid "Step over"
msgstr "Шаг в обход"

#: lazarusidestrconsts:lismenustop
msgid "Stop"
msgstr "Останов"

#: lazarusidestrconsts:lisstopdebugging
msgid "Stop Debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts:dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Останов после числа ошибок"

#: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Остановить текущую отладку и пересобрать проект?"

#: lazarusidestrconsts:lisstopdebugging2
msgid "Stop debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts:lisstoponexception
msgid "Stop on exception"
msgstr "Останов при исключении"

#: lazarusidestrconsts:liskmstopprogram
msgid "Stop program"
msgstr "Остановить программу"

#: lazarusidestrconsts:lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts:lispckeditsetdependencydefaultfilename
msgid "Store dependency filename"
msgstr "Записать имя файла зависимости"

#: lazarusidestrconsts:dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Префикс STORED"

#: lazarusidestrconsts:lisstreamerror
msgid "Stream Error"
msgstr "Ошибка потока"

#: lazarusidestrconsts:lisstreamingerror
msgid "Streaming error"
msgstr "Ошибка потоков"

#: lazarusidestrconsts:lisstring
msgid "String"
msgstr "Строка"

#: lazarusidestrconsts:liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Строковая константа"

#: lazarusidestrconsts:lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Строковая константа в исходном коде"

#: lazarusidestrconsts:lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Строки с тем же значением:"

#: lazarusidestrconsts:dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Вырезать символы из бинарника"

#: lazarusidestrconsts:lisstyle
msgid "Style"
msgstr "Стиль"

#: lazarusidestrconsts:lissubprocedure
msgid "Sub Procedure"
msgstr "Подпроцедура"

#: lazarusidestrconsts:lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Подпроцедура того же уровня"

#: lazarusidestrconsts:dlgedbsubdir
msgid "Sub directory"
msgstr "Подкаталог"

#: lazarusidestrconsts:dlgsubpropkcolor
msgid "Subpropertes"
msgstr "Подсвойства"

#: lazarusidestrconsts:lissuccess
msgid "Success"
msgstr "Успешно"

#: lazarusidestrconsts:lisinfobuildsuccess
msgid "Success..."
msgstr "Успешно..."

#: lazarusidestrconsts:lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Переключить пути"

#: lazarusidestrconsts:srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Переключить модуль/форму"

#: lazarusidestrconsts:liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"

#: lazarusidestrconsts:dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ сзади (.pp~)"

#: lazarusidestrconsts:dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ спереди (.~pp)"

#: lazarusidestrconsts:lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - компонент редактора, используемый Lazarus. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts:srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Проверка синтаксиса"

#: lazarusidestrconsts:lissyntaxmode
msgid "Syntax mode"
msgstr "Режим синтаксиса"

#: lazarusidestrconsts:dlgsyntaxoptions
msgid "Syntax options"
msgstr "Параметры синтаксиса"

#: lazarusidestrconsts:dlgrunosystemvariables
msgid "System variables"
msgstr "Системные переменные"

#: lazarusidestrconsts:dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Совместимость с TP/BP 7.0"

#: lazarusidestrconsts:listab
msgid "Tab"
msgstr "ТАБ"

#: lazarusidestrconsts:listaborderof
msgid "Tab Order of"
msgstr "Порядок перехода"

#: lazarusidestrconsts:dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ меняет отступ блоков"

#: lazarusidestrconsts:fdmtaborder
msgid "Tab order..."
msgstr "Порядок перехода..."

#: lazarusidestrconsts:liseotabwidths
msgid "Tab widths"
msgstr "Ширина ТАБа"

#: lazarusidestrconsts:dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Преобразование ТАБ в пробелы"

#: lazarusidestrconsts:lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"

#: lazarusidestrconsts:lislazbuildqboapplcltarget
msgid "Target"
msgstr "Цель"

#: lazarusidestrconsts:listargetcpu
msgid "Target CPU"
msgstr "Семейство процессоров:"

#: lazarusidestrconsts:dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Целевое семейство процессоров"

#: lazarusidestrconsts:lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Целевой CPU:"

#: lazarusidestrconsts:listargetos
msgid "Target OS"
msgstr "Операционная система"

#: lazarusidestrconsts:liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Специфические параметры ОС"

#: lazarusidestrconsts:lislazbuildtargetos
msgid "Target OS:"
msgstr "Целевая ОС:"

#: lazarusidestrconsts:dlgtargetplatform
msgid "Target Platform:"
msgstr "Целевая платформа"

#: lazarusidestrconsts:lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Каталог назначения:"

#: lazarusidestrconsts:dlgpotargetfilename
msgid "Target file name:"
msgstr "Имя исполнимого файла:"

#: lazarusidestrconsts:listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Имя исполнимого файла с параметрами"

#: lazarusidestrconsts:listargetfilenameofproject
msgid "Target filename of project"
msgstr "Имя исполнимого файла проекта"

#: lazarusidestrconsts:dlgtargetproc
msgid "Target processor"
msgstr "Целевой процессор"

#: lazarusidestrconsts:lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Просмотр шаблона"

#: lazarusidestrconsts:dlgtplfname
msgid "Template file name"
msgstr "Имя файла шаблона"

#: lazarusidestrconsts:lisctdtemplates
msgid "Templates"
msgstr "Шаблоны"

#: lazarusidestrconsts:dlgccotest
msgid "Test"
msgstr "Тест"

#: lazarusidestrconsts:listestdirectory
msgid "Test directory"
msgstr "Каталог проб"

#: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Каталог проб \"%s\" не найден."

#: lazarusidestrconsts:dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Тест: проверка компилятора ..."

#: lazarusidestrconsts:dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Тест: проверка настроек компилятора ..."

#: lazarusidestrconsts:dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Тест: проверка даты компилятора ..."

#: lazarusidestrconsts:dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Тест: проверка конфигурационных файлов компилятора ..."

#: lazarusidestrconsts:dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Тест: поиск отсутствующих ppu компилятора ..."

#: lazarusidestrconsts:dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Тест: проверка наличия файлов исходного кода в путях поиска ppu ..."

#: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Тест: компиляция пустого файла"

#: lazarusidestrconsts:dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Тест: компиляция пустого файла ..."

#: lazarusidestrconsts:lispkgfiletypetext
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts:dlgtextattributes
msgid "Text attributes"
msgstr "Параметры текста"

#: lazarusidestrconsts:srkmcatediting
msgid "Text editing commands"
msgstr "Команды редактирования текста"

#: lazarusidestrconsts:srkmcatmarker
msgid "Text marker commands"
msgstr "Команды маркера текста"

#: lazarusidestrconsts:srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команды поиска и замены текста"

#: lazarusidestrconsts:srkmcatselection
msgid "Text selection commands"
msgstr "Команды выделения текста"

#: lazarusidestrconsts:lisfindfiletexttofind
msgid "Text to find:"
msgstr "Искать текст:"

#: lazarusidestrconsts:lisdiffdlgtext1
msgid "Text1"
msgstr "Текст1"

#: lazarusidestrconsts:lisdiffdlgtext2
msgid "Text2"
msgstr "Текст2"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s,%sиспользуемые проектом %s.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s,%sиспользуемые проектом %s.%sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s.%sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Каталог %s проекта,%sсодержащий файлы .dpr, dpk."

#: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Требуемый для исполнения Application Bundle %s%sне существует либо не является исполнимым файлом.%sВы хотите создать его?%s%sДля настройки см. Проект -> Параметры проекта -> Приложение."

#: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для Объектного Паскаля."

#: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgstr "Каталог с исходным кодом FPC \"%s\" имеет некорректную структуру. Обычно он содержит такие подкаталоги, как rtl, packages, compiler, ... ."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Каталог исходного кода  FreePascal из SVN."

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Каталог исходного кода  FreePascal из SVN. Не обязателен. Улучшит поиск объявлений и отладку."

#: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Компилятор FreePascal (имя файла: %s) не найден.%sВам рекомендуется установить fpc"

#: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Каталог проекта FreePascal."

#: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Каталог исходного кода FreePascal не найден.%sОтдельные действия с кодом не будут работать.%sРекомендуется установить его и установить путь%sОкружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Библиотека компонентов Lazarus - содержит все основные компоненты для редактирования форм."

#: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что он содержит некоторые свойства/классы, которых нет в текущей версии LCL. Обычно следует убрать эти свойства из lfm и (если надо) исправить код Паскаля вручную."

#: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Каталог Lazarus не найден.%sВы не сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Главный каталог Lazarus."

#: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."

#: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Минимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - Библиотека Времени Выполнения (Run-Time Library) является основой всех программ FreePascal."

#: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Пробный каталог не найден:%s%s%s%s%s (см. параметры окружения)"

#: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Название типа предка %s%s%s совпадает с%sмодулем %s%s%sю"

#: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Тип предка %s%s%s - неправильный идентификатор Паскаля"

#: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Класс %s%s%s - элемент управления (TControl), его нельзя вставить на что-то другое.%sНе могу вставить."

#: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Имя класса %s%s%s и его предка %s%s%s совпадают."

#: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Имя класса %s%s%s уже есть в%sПакете %s%sФайл: %s%s%s"

#: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Имя класса %s%s%s совпадает с %s именем модуля %s%s%s."

#: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Имя класса %s%s%s - недопустимый идентификатор Паскаля"

#: lazarusidestrconsts:listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "Средством CodeTools найдена ошибка:%s%s%s"

#: lazarusidestrconsts:listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Команда после %s%s%s"

#: lazarusidestrconsts:listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Команда после опубликования некорректна:%s%s%s%s"

#: lazarusidestrconsts:lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Откомпилированный модуль FPC %s.ppu не найден.%sОбычно это означает, что ваш fpc.cfg имеет ошибку, или FPC неверно установлен."

#: lazarusidestrconsts:lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Компилятор \"%s\" не является исполнимым файлом.%sПодробности: %s"

#: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Файл компилятора \"%s\" не исполняемый."

#: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Файл компилятора для пакета %s - недопустимый исполняемый:%s%s"

#: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Компонент %s не может быть удалён, так как %s им не владеет."

#: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Компонент %s унаследован от %s.%sДля удаления унаследованного компонента следует открыть объект-предок и удалить его там."

#: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%s вызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%s,%sсвязанный со словом #%s %s%s%s,%sвызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходного кода FreePascal %s%s%s%sвыглядит неправильно.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходного кода FreePascal %s%s%s%sвыглядит неправильно.%sВыберите ОК чтобы вернуть используемый по умолчанию %s%s%s,%s или же проверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sвыглядит неправильно.%sБез него Вы не сможете создавать приложения LCL.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%s или же проверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий компилятор %s%s%s.%sне является исполнимым файлом.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%sили же проверьте Окружение-> Параметры окружения -> Файлы"

#: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Текущий компилятор %s%s%s%s не является исполнимым файлом.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts:lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Текущий шрифт редактора не поддерживает UTF-8, но ваша система, вероятно, её использует.%sЭто означает, что символы, не входящие в ASCII, могут отображаться неверно.%sВы можете выбрать другой шрифт в параметрах редактора."

#: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Текущий путь модуля для файла %s%s%s%s - %s%s%s%s.%s%sПуть к модулям LCL %s%s%s отсутствует.%s%sПодсказка для новичков:%sСоздайте приложение lazarus и поместите файл в каталог проекта."

#: lazarusidestrconsts:lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Даты файлов .ppu FPC отличаются больше, чем на один час.%sЭто может означать, что они принадлежат разным установкам.%sФайл1: %s%sФайл2: %s"

#: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Отладчик %s%s%s%s не существует или не является исполнимым файлом.%s%sСм. Окружение -> Параметры отладчика"

#: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл отладчика \"%s\" не исполняемый."

#: lazarusidestrconsts:lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Зависимость %s%s%s не найдена.%sВыберите существующий пакет."

#: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Каталог назначения %s%s%s не существует.%sПроверьте имя исполняемого файла в меню Проект -> Параметры проекта."

#: lazarusidestrconsts:listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Каталог назначения%s%s%s%s не существует."

#: lazarusidestrconsts:listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Каталог %s не найден."

#: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Присутствие каталога %s%s%s в списке путей к модулям больше не требуется.%sУдалить его?"

#: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Каталог %s%s%s отсутствует в списке путей к модулям.%sДобавить его?"

#: lazarusidestrconsts:dlgthedirectory
msgid "The directory \""
msgstr "Каталог \""

#: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Файл %s, вероятно, является файлом программы уже существующего проекта Lazarus."

#: lazarusidestrconsts:listhefile
msgid "The file %s%s%s"
msgstr "Файл %s%s%s"

#: lazarusidestrconsts:listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Файл %s%s%s является символической ссылкой.%s%sОткрыть %s%s%s вместо него?"

#: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Файл %s%s%s уже в пакете."

#: lazarusidestrconsts:listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Файл %s%s%s не проект Delphi (.dpr)"

#: lazarusidestrconsts:listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Файл %s%s%s - не модуль Delphi."

#: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Файл %s%s%s - не пакет Lazarus."

#: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл %s%s%s - часть текущего проекта.%sНе лучшая идея - делить файлы между проектами и пакетами."

#: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sуже в пакете %s."

#: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Файл %s%s%s%sсейчас не находится в списке путей модулей пакета.%s%sДобавить его туда?"

#: lazarusidestrconsts:lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Файл %s%s%s%sпакета %s отсутствует."

#: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Сначала необходимо сохранить файл %s%s%s%sпакета %s."

#: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл %s%s%s%sвыглядит как программа. Закрыть текущий проект и создать новый проект lazarus для этой программы?%s\"Нет\" откроет файл как обычный исходный код."

#: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Файл %s%s%s%sнайден в одном из каталогов исходного кода пакета %s, и он выглядит как откомпилированный модуль. Такие модули должны быть в каталоге вывода пакета, иначе другие пакеты не смогут правильно использовать пакет.%s%sУдалить такие файлы?"

#: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Файл %s%s%s%sне найден.%sВы хотите поискать его самостоятельно?%s"

#: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Файл %s%s%s%sне найден.%sПропуск продолжит загрузку проекта,%sПрервать - остановит загрузку."

#: lazarusidestrconsts:uefilerotext1
msgid "The file \""
msgstr "Файл \""

#: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Имя файла %s%s%s - часть текущего проекта.%sПроекты и пакеты не должны бы делить файлы."

#: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Имя файла %s%s%sиспользуется%sпакетом %s%s%s%sв файле %s%s%s."

#: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Имя файла %s%s%s не соответствует имени пакета %s%s%s в файле.%sСменить имя пакета на %s%s%s?"

#: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Имя файла %s%s%s не определено, так как пакет ещё не имеет каталога по умолчанию.%sПожалуйста, укажите имя файла с полным путём."

#: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Следующие методы, используемые %s, отсутствуют в исходном коде%s%s%s%s%s%sУдалить некорректные ссылки?"

#: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Следующий пакет не был загружен:"

#: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Следующие пакеты не были загружены:"

#: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren
msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out."
msgstr "Следующие модули не были найдены:%s%s%s%s1) Эти модули не находятся в каталогах, указанных в путях к модулям, тогда вы можете прервать операцию, установить нужный путь и попытаться снова.%s2) Вы можете игнорировать отсутствующие модули и закомментировать их."

#: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Главное приложение %s%s%s - не исполняемый файл."

#: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Клавиша %s%sуже назначена для %s.%s%sУдалить старую ассоциацию и назначить клавишу для новой функции%s%s?"

#: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Запускающее приложение %s%s%s%не существует или не является исполнимым файлом.%s%sСм. Запуск -> Параметры запуска... -> Локальные"

#: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Каталог lazarus \"%s\" выглядит некорректно. Обычно он содержит каталоги lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Файл make \"%s\" - не исполняемый файл."

#: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Максимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)"

#: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Минимальная версия %s%s%s - неправильная версия пакета.%s(хороший пример 1.2.3.4)"

#: lazarusidestrconsts:listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Имя %s%s%s - неправильный идентификатор Паскаля."

#: lazarusidestrconsts:lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Слово \"%s\" - неправильный идентификатор языка паскаль."

#: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Новый модуль ещё не находится в путях поиска.%sДобавить каталог %s?"

#: lazarusidestrconsts:listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Каталог вывода %s%s%s отсутствует."

#: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска включаемых файлов %s."

#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска включаемых файлов %s."

#: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска модулей %s."

#: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска модулей %s."

#: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Пакет %s - пакет только времени выполнения.%sТакие пакеты не могут встраиваться в IDE."

#: lazarusidestrconsts:lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Пакет %s только для чтения."

#: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Пакет %s требуется для %s, который помечен на установку.%sСмотри диаграмму пакетов."

#: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Пакет %s имеет файл%s%s%s%s.%sДолжен ли файл быть переименован, как и пакет?"

#: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Пакет %s%s%s не откомпилировался. %sУдалить его из списка на установку?"

#: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Пакет %s%s%s имеет метку Автоинсталляция.%sЭто значит, что он автоматически встроится в IDE. Устанавливаемые пакеты%sдолжны быть для разработки."

#: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Пакет %s%s%s установлен, но не найдено корректного файла пакета (.lpk).%sБыл создан неработающий пакет-пустышка."

#: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакет %s%s%s отмечен на установку, но не найден.%sУдалить зависимость из списка установки пакетов?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакет %s%s%s помечен на установку.%sСейчас lazarus поддерживает только статически связанные пакеты. Действительная установка требует пересборки и перезапуска lazarus.%s%sВы хотите пересобрать Lazarus сейчас?"

#: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакет %s%s%s отмечен.%sСейчас lazarus поддерживает только статически связанные пакеты. Действительное удаление требует пересборки и перезапуска lazarus.%s%sВы хотите пересобрать Lazarus сейчас?"

#: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Пакет уже содержит модуль с таким именем."

#: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Имя пакета %s%s%s в%s%s%s%s -  неправильное имя пакета lazarus."

#: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Пакет уже имеет зависимость от пакета %s%s%s"

#: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Имя пакета %s%s%s некорректно.%sВыберите другой пакет (напр., package1.lpk)."

#: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Имя пакета %s%s%s %sфайла %s%s%s некорректно."

#: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Имя пакета %s%s%s слишком длинное (надо до 100 симв.)."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Путь к компилятору FreePascal для данного проекта. Требуется только при заполненном поле \"Каталог исходного кода FreePascal из SVN\" ниже. Используется для автоматического создания макросов."

#: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Путь к компилятору FreePascal.%s Например, %s/usr/bin%s -n%s или %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Программа %smake%s не найдена.%sЭто средство нужно, чтобы собрать lazarus.%s"

#: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Проект уже зависит от пакета %s%s%s."

#: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Файл сведений проекта %s%s%s%sсовпадает с главным файлом исходного кода!"

#: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект надо сохранить до компиляции%sЕсли Вы установите каталог проб в параметрах окружения,%sВы можете создавать новые проекты и собирать их сразу.%sСохранить прокет?"

#: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект требует пакет %s%s%s.%sНо он не найден. См. Прокет -> Инспектор проекта."

#: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Ресурсный класс %s%s%s унаследован от %s%s%s. Возможно это опечатка в TForm."

#: lazarusidestrconsts:lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Строка ресурсов %s%s%s уже есть. %sВыберите другое имя. %s Используйте Пропуск, чтобы добавить как есть."

#: lazarusidestrconsts:listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Компонент верхнего уровня не может быть удалён."

#: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Модуль %s дублируется в путях к модулям %s:"

#: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Модулем %s не владеет ни один из пакетов либо проектов.%sДобавьте модуль к пакету либо проекту.%sНевозможно создать файл FPDoc."

#: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Модуль %s%s%s уже есть. Пропуск приведёт к переименованию,%sОтмена отменить сохранение этого файла, а%sПрервать - отменит сохранение вообще."

#: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Имя файла %s%s%s модуля не в нижнем регистре.%sКомпилятор FreePascal не проводит поиск для всех вариантов. Рекомендуется использовать имя в нижнем регистре.%s%sПереименовать файл в нижний регистр?"

#: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Модуль уже называется %s%s%s. Идентификаторы Паскаля должны быть уникальны."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже есть в проекте%sв файле: %s%s%s."

#: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже есть в выделении%sв файле: %s%s%s."

#: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Имя модуля %s%s%s не соответствует имени файла"

#: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Имя модуля %s%s%s - недопустимый идентификатор Паскаля."

#: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Имя модуля совпадает с зарегистрированным компонентом.%sЭто может привести к странным сообщениям об ошибках."

#: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Имя модуля %s%s%s%sи имя файла %s%s%s различаются."

#: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Путь поиска модулей %s%s%s содержит каталог исходного кода %s%s%s пакета %s"

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Имя модуля %s%s%s уже занято в этом пакете:%s%s"

#: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Имя модуля %s%s%s уже занято в этом пакете."

#: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier
msgid "The unitname is not a valid pascal identifier."
msgstr "Имя модуля не является корректным идентификатором Паскаля."

#: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Имя модуля используется при раскрытии IDE выражений uses"

#: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Рабочий каталог %s%s%s не существует.%sПроверьте его в меню Запуск -> Параметры запуска."

#: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Имеется %s абстрактных методов, подлежащих замещению.%sВыберите методы, для которых должны быть созданы заглушки:"

#: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Во всплывающем меню больше функций"

#: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Абстрактные методы, подлежащие замещению, отсутствуют."

#: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В каталоге есть и другие файлы с таким же именем,%sотличающиеся только регистром:%s%s%sУдалить их?"

#: lazarusidestrconsts:lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "В ваших путях имеется несколько компиляторов FreePascal.%s%s%sВозможно, вы забыли удалить старый компилятор."

#: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Есть два модуля с одинаковым именем:%s%s1. %s%s%s из %s%s2. %s%s%s из %s%s%s"

#: lazarusidestrconsts:lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Имеется более старый, чем компилятор, файл .ppu:%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Есть модуль FPC с таким же именем, как и пакет:%s%s%s%s%s%s"

#: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Есть модуль FPC с таким же именем, как:%s%s%s%s%s из %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Обнаружен цикл зависимостей пакетов. Смотрите диаграмму пакетов."

#: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "На диске есть файл с таким же именем и похожим расширением%sФайл: %s%sПохожий файл: %s%s%sУдалить второй файл?"

#: lazarusidestrconsts:lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Допускается максимум %s средств."

#: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "В проекте есть модуль с именем %s%s%s.%sВыберите другое имя"

#: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Есть модуль с тем же именем, что и пакет: %s%s1. %s%s%s из %s%s2. %s%s%s%s"

#: lazarusidestrconsts:listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Уже есть форма с именем %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Уже загружен пакет %s%s%s %sиз файла %s%s%s.%sСм. Компоненты -> Диаграмма пакетов.%sЗамена невозможна."

#: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Уже есть модуль, называемый %s%s%s. Идентификаторы Паскаля должны быть уникальны."

#: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Модуль с таким именем уже существует. %sФайл: %s"

#: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Компонент с именем %s%s%s уже имеется."

#: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Уже есть другой пакет с именем %s%s%s.%sКонфликтующий пакет:%s%s%s%sФайл: %s%s%s"

#: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Среди требуемых пакетов есть несохранённый. См. диаграмму пакетов."

#: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Не указан отладчик.%sТочки останова не будут иметь эффекта, пока вы не настроите отладчик в диалоге \"Параметры отладчика\" в меню."

#: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при записи выбранных компонентов %s:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при преобразовании бинарного потока выбранного компонента %s:%s:%s%s"

#: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Произошла ошибка при копировании потока компонента в буфер:%s%s"

#: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Этот файл отсутствует во всех загруженных пакетах."

#: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit
msgid "This file was automatically created by Lazarus. Do not edit!"
msgstr "Этот файл был автоматически создан Lazarus. Не редактировать!"

#: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Это виртуальный пакет. Он ещё не имеет исходного кода. Сначала сохраните пакет."

#: lazarusidestrconsts:lisresourcefilecomment
msgid "This is an automatically generated lazarus resource file"
msgstr "Это - файл ресурсов, автоматически созданный lazarus"

#: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Это - пакет по умолчанию. Используется только для компонентов без пакета. Такие компоненты устарели."

#: lazarusidestrconsts:lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается нижняя граница. Оставьте пустым для родителя."

#: lazarusidestrconsts:lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается левая граница. Оставьте пустым для родителя."

#: lazarusidestrconsts:lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается правая граница. Оставьте пустым для родителя."

#: lazarusidestrconsts:listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается верхняя граница. Оставьте пустым для родителя."

#: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Содержимое этого файла похоже на исходный код на Паскале.%sРекомендуется использовать имена файлов в нижнем регистре во избежание различных проблем на некоторых файловых системах и с другими компиляторами.%sПереименовать в нижний регистр?"

#: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Этот метод не может быть замещён, так как он задан в текущем классе"

#: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Пакет установлен, но файл lpk не найден. Все компоненты отключены. Исправьте эту ошибку."

#: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Этот пакет предоставляет те же возможности, что и следующие пакеты"

#: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage
msgid "This source is only used to compile and install the package."
msgstr "Исходный код используется только для компиляции и установки пакета."

#: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Это выражение не может быть извлечено.%sВыберите какой-то код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts:listhiswillhappencontinue
msgid "This will happen:%s%s%sContinue?"
msgstr "Произойдёт следующее:%s%s%sПродолжить?"

#: lazarusidestrconsts:lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Тред"

#: lazarusidestrconsts:listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Название (оставьте пустым для значения по умолчанию)"

#: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Требуются заголовок и имя файла"

#: lazarusidestrconsts:dlgpotitle
msgid "Title:"
msgstr "Заголовок:"

#: lazarusidestrconsts:lismenuviewtodolist
msgid "ToDo List"
msgstr "Список ToDo"

#: lazarusidestrconsts:listodolistoptions
msgid "ToDo options..."
msgstr "Параметры ToDo..."

#: lazarusidestrconsts:lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts:srkmectogglemode
msgid "Toggle Mode"
msgstr "Переключить режим"

#: lazarusidestrconsts:liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Переключиться между модулем и формой"

#: lazarusidestrconsts:lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Переключение режимов показа имён файлов с полным или относительным путём"

#: lazarusidestrconsts:liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Показать точки останова"

#: lazarusidestrconsts:liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Показать стек вызовов"

#: lazarusidestrconsts:liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Показать обозреватель кода"

#: lazarusidestrconsts:liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Показать вывод отладчика"

#: lazarusidestrconsts:liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Показать редактор документации"

#: lazarusidestrconsts:liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Показывать кнопки быстрого запуска IDE"

#: lazarusidestrconsts:liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Показать локальные переменные"

#: lazarusidestrconsts:liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Показывать окно сообщений"

#: lazarusidestrconsts:liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Показывать инспектор объектов"

#: lazarusidestrconsts:liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Показать результаты поиска"

#: lazarusidestrconsts:liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Показать редактор исходного кода"

#: lazarusidestrconsts:liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Показать окно наблюдений"

#: lazarusidestrconsts:liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Показывать палитру компонентов"

#: lazarusidestrconsts:liscodetempltoken
msgid "Token:"
msgstr "Элемент:"

#: lazarusidestrconsts:lisctdefstools
msgid "Tools"
msgstr "Средства"

#: lazarusidestrconsts:srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команды меню Сервис"

#: lazarusidestrconsts:dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Отображать вычисленные значения в подсказках"

#: lazarusidestrconsts:dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Всплывающие подсказки для идентификаторов"

#: lazarusidestrconsts:listop
msgid "Top"
msgstr "Вверх"

#: lazarusidestrconsts:listopanchoring
msgid "Top anchoring"
msgstr "Верхняя привязка"

#: lazarusidestrconsts:listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Верхний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства над компонентом."

#: lazarusidestrconsts:listopspaceequally
msgid "Top space equally"
msgstr "Равномерно по верхним краям"

#: lazarusidestrconsts:dlgtoppos
msgid "Top:"
msgstr "Верх:"

#: lazarusidestrconsts:listops
msgid "Tops"
msgstr "Верхние края"

#: lazarusidestrconsts:dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрезать хвостовые пробелы"

#: lazarusidestrconsts:listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts:rslanguageturkish
msgid "Turkish"
msgstr "Турецкий"

#: lazarusidestrconsts:lismenutemplatetutorial
msgid "Tutorial"
msgstr "Учебник"

#: lazarusidestrconsts:dlgenvtype
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts:lisuidtype
msgid "Type:"
msgstr "Тип:"

#: lazarusidestrconsts:liscetypes
msgid "Types"
msgstr "Типы"

#: lazarusidestrconsts:dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНИЙ РЕГИСТР"

#: lazarusidestrconsts:rslanguageukrainian
msgid "Ukrainian"
msgstr "Украинский"

#: lazarusidestrconsts:lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Невозможно преобразовать двоичный поток в текст"

#: lazarusidestrconsts:lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Невозможно скопировать компоненты в буфер"

#: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Невозможно добавить %s к проекту, так как в проекте уже есть модуль с таким именем."

#: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Невозможно добавить ресурс T%s:FORMDATA к файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Невозможно добавить комментарий заголовка ресурса к файлу ресурса %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Невозможно сохранить резервный файл %s%s%s как %s%s%s!"

#: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Невозможно изменить список автосоздаваемых форм в исходном коде программы.%sИсправьте сначала ошибки."

#: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Невозможно очистить %s%s%s.%sПроверьте права доступа."

#: lazarusidestrconsts:lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Невозможно очистить каталог назначения"

#: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Невозможно преобразовать текст компонента в двоичный формат:%s%s"

#: lazarusidestrconsts:lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Невозможно преобразовать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Невозможно преобразовать lfm в lrs и записать lrs-файл."

#: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Невозможно преобразовать текстовые данные формы файла %s%s%s%s%sв двоичный поток. (%s)"

#: lazarusidestrconsts:lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Невозможно скопировать файл"

#: lazarusidestrconsts:lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Невозможно скопировать файл %s%s%s%sв %s%s%s"

#: lazarusidestrconsts:lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Невозможно скопировать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts:lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Невозможно создать тестовый файл"

#: lazarusidestrconsts:lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Невозможно создать тестовый файл Паскаля \"%s\"."

#: lazarusidestrconsts:lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Невозможно создать резервный каталог %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Невозможно создать каталог"

#: lazarusidestrconsts:lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Невозможно создать каталог %s%s%s"

#: lazarusidestrconsts:lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Невозможно создать каталог %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile
msgid "Unable to create file"
msgstr "Невозможно создать файл"

#: lazarusidestrconsts:lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Невозможно создать файл %s%s%s"

#: lazarusidestrconsts:lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Невозможно создать файл %s%s%s."

#: lazarusidestrconsts:lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Невозможно создать файл %s%s%s%s"

#: lazarusidestrconsts:lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Невозможно создать ссылку %s%s%s с объектом %s%s%s"

#: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Невозможно создать новый метод. Исправьте ошибки, указанные в окне сообщений."

#: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Невозможно создать каталог вывода %s%s%s%sдля пакета %s."

#: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Невозможно создать каталог исходного кода пакета %s%s%s%sдля пакета %s."

#: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Невозможно создать целевой каталог для lazarus:%s%s%s%s.%sЭтот каталог нужен для вновь изменённой IDE lazarus с вашими пакетами."

#: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Невозможно создать временный буфер LFM"

#: lazarusidestrconsts:lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Невозможно удалить дублирующийся файл %s%s%s"

#: lazarusidestrconsts:lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Невозможно удалить файл"

#: lazarusidestrconsts:lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Невозможно удалить файл %s%s%s."

#: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Невозможно удалить старый файл состояния %s%s%s%sдля пакета %s."

#: lazarusidestrconsts:lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Невозможно найти %s в потоке LFM"

#: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Невозможно найти секцию ResourceString в этом или любом используемом модуле."

#: lazarusidestrconsts:lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Невозможно найти правильное имя класса в %s%s%s"

#: lazarusidestrconsts:lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Невозможно найти файл %s%s%s."

#: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "Невозможно найти файл %s%s%s.%sЕсли он принадлежит вашему проекту, проверьте пути поиска в%sПроект -> Параметры компилятора -> Пути -> Другие модули. Если он принадлежит пакету, проверьте соответствующие параметры компиляции пакета. Если этот файл принадлежит Lazarus, удостоверьтесь, что компилируете его после очистки. Если файл принадлежит FPC, проверьте fpc.cfg. Если не уверены, вызовите Проект -> Параметры компилятора -> Тест"

#: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Невозможно найти метод. Исправьте ошибки в окне сообщений."

#: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Невозможно найти модуль класса компонента %s%s%s."

#: lazarusidestrconsts:lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Невозможно определить изменения в редакторе."

#: lazarusidestrconsts:lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Невозможно получить дату %s."

#: lazarusidestrconsts:lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Невозможно получить исходный код для дизайнера."

#: lazarusidestrconsts:lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Невозможно загрузить файл"

#: lazarusidestrconsts:lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Невозможно загрузить файл %s%s%s."

#: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Невозможно загрузить старый файл ресурсов.%sЭтот файл - первый включаемый файл в%sразделе инициализации.%sНапример, {$I %s.lrs}.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts:lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Невозможно загрузить пакет"

#: lazarusidestrconsts:lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Невозможно загрузить пакет %s%s%s"

#: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Невозможно загрузить класс компонента %s%s%s, так как он зависит сам от себя."

#: lazarusidestrconsts:lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Невозможно открыть компонент-предок"

#: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Невозможно открыть дизайнер. %sКласс %s не унаследован от класса, подобного TForm или TDataModule."

#: lazarusidestrconsts:lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Невозможно открыть пакет %s%s%s.%sЭтот пакет был отмечен для установки."

#: lazarusidestrconsts:lisunabletoread
msgid "Unable to read %s"
msgstr "Невозможно прочитать %s"

#: lazarusidestrconsts:lisunabletoreadfile
msgid "Unable to read file"
msgstr "Невозможно прочитать файл"

#: lazarusidestrconsts:lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Невозможно прочитать файл %s%s%s!"

#: lazarusidestrconsts:lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Невозможно прочитать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Невозможно прочитать файл %s%s%s."

#: lazarusidestrconsts:lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Невозможно прочитать файл пакета %s%s%s.%sОшибка: %s"

#: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Невозможно прочитать файл состояния %s проекта %s%sОшибка: %s"

#: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Невозможно прочитать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts:lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Невозможно удалить старый резервный файл %s%s%s!"

#: lazarusidestrconsts:lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Невозможно переименовать дублирующийся файл %s%s%s%sв %s%s%s"

#: lazarusidestrconsts:lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Невозможно переименовать файл"

#: lazarusidestrconsts:lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Невозможно переименовать файл %s%s%s в %s%s%s!"

#: lazarusidestrconsts:lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Невозможно переименовать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts:lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Невозможно переименовать форму в исходном коде."

#: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Невозможно переименовать метод. Исправьте ошибку в окне сообщений."

#: lazarusidestrconsts:lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Невозможно переименовать переменную в исходном коде."

#: lazarusidestrconsts:lisunabletorun
msgid "Unable to run"
msgstr "Запуск невозможен"

#: lazarusidestrconsts:lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Невозможно запустить средство %s%s%s:%s%s"

#: lazarusidestrconsts:lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Невозможно сохранить файл %s%s%s"

#: lazarusidestrconsts:lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Невозможно установить привязку к компоненту"

#: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Невозможно показать абстрактные методы текущего класса, так как"

#: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Невозможно показать метод. Исправьте ошибку в окне сообщений."

#: lazarusidestrconsts:lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Невозможно вывести в поток %s:T%s."

#: lazarusidestrconsts:lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Невозможно вывести выбранные компоненты в поток"

#: lazarusidestrconsts:lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Невозможно вывести выбранные компоненты в поток."

#: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Невозможно преобразовать двоичный поток компонентов %s:T%s в текст."

#: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Невозможно обновить выражение CreateForm в исходном коде проекта"

#: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Невозможно обновить двоичный файл ресурсов%s%s%sиз текстового файла ресурсов%s%s%s%sВероятно, текстовый файл повреждён."

#: lazarusidestrconsts:lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Невозможно записать %s%s%s"

#: lazarusidestrconsts:lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Невозможно записать %s%s%s%s%s."

#: lazarusidestrconsts:lisunabletowritefile
msgid "Unable to write file"
msgstr "Невозможно записать файл"

#: lazarusidestrconsts:lisunabletowritefile2
msgid "Unable to write file %s%s%s"
msgstr "Невозможно записать файл %s%s%s"

#: lazarusidestrconsts:lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Невозможно записать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletowritefilename
msgid "Unable to write file %s%s%s."
msgstr "Невозможно записать файл %s%s%s."

#: lazarusidestrconsts:lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Невозможно записать файл \"%s\":%s"

#: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Невозможно записать пакет %s%s%s%sв файл %s%s%s.%sОшибка: %s"

#: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Невозможно записать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Невозможно записать файл состояния для проекта %s%sОшибка: %s"

#: lazarusidestrconsts:lisunabletowritetofile2
msgid "Unable to write to file %s%s%s"
msgstr "Невозможно записать в файл %s%s%s"

#: lazarusidestrconsts:lisunabletowritetofile
msgid "Unable to write to file %s%s%s!"
msgstr "Невозможно записать в файл %s%s%s!"

#: lazarusidestrconsts:lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Невозможно записать поток XML в %s%sОшибка: %s"

#: lazarusidestrconsts:dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Ненадёжные оптимизации"

#: lazarusidestrconsts:lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Раскомментировать"

#: lazarusidestrconsts:liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Снять определение"

#: lazarusidestrconsts:liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Снять определение со всех"

#: lazarusidestrconsts:liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно снять определение"

#: lazarusidestrconsts:dlgedunder
msgid "Underline"
msgstr "Подчеркнутый"

#: lazarusidestrconsts:lismenuundo
msgid "Undo"
msgstr "Отменить"

#: lazarusidestrconsts:dlgundoaftersave
msgid "Undo after save"
msgstr "Список отмен после сохранения"

#: lazarusidestrconsts:dlgundolimit
msgid "Undo limit"
msgstr "Лимит отмен"

#: lazarusidestrconsts:srkmecblockunindent
msgid "Unindent block"
msgstr "Отменить отделение блока"

#: lazarusidestrconsts:lismenuunindentselection
msgid "Unindent selection"
msgstr "Сдвинуть блок влево"

#: lazarusidestrconsts:lispckedituninstall
msgid "Uninstall"
msgstr "Удалить"

#: lazarusidestrconsts:lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Удалить при след. пуске"

#: lazarusidestrconsts:lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Удалить пакет %s?"

#: lazarusidestrconsts:lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Удалить пакет?"

#: lazarusidestrconsts:lisuninstallselection
msgid "Uninstall selection"
msgstr "Удалить выбранное"

#: lazarusidestrconsts:lispkgfiletypeunit
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts:lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Модуль %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Модуль %s%s%s был удалён из пакета"

#: lazarusidestrconsts:lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts:uemshowunitinfo
msgid "Unit Info"
msgstr "Сведения о модуле"

#: lazarusidestrconsts:lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Имя модуля недопустимо"

#: lazarusidestrconsts:lisa2punitname
msgid "Unit Name:"
msgstr "Имя модуля:"

#: lazarusidestrconsts:lisaf2punitname
msgid "Unit Name: "
msgstr "Имя модуля: "

#: lazarusidestrconsts:lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Каталог вывода модулей"

#: lazarusidestrconsts:lispkgdefsunitpath
msgid "Unit Path"
msgstr "Путь модуля"

#: lazarusidestrconsts:dlgcounitstyle
msgid "Unit Style:"
msgstr "Стиль модулей"

#: lazarusidestrconsts:dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Зависимости модуля"

#: lazarusidestrconsts:lisa2punitfilename
msgid "Unit file name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts:lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Идентификатор модуля существует"

#: lazarusidestrconsts:lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Имя модуля уже существует"

#: lazarusidestrconsts:lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Имя модуля начинается с ..."

#: lazarusidestrconsts:lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Имя модуля содержит ..."

#: lazarusidestrconsts:lisunitnotfound
msgid "Unit not found"
msgstr "Модуль не найден"

#: lazarusidestrconsts:lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Модуль не найден: %s%s%s"

#: lazarusidestrconsts:dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Каталог вывода модулей (-FU):"

#: lazarusidestrconsts:lisunitpaths
msgid "Unit paths"
msgstr "Пути к модулям"

#: lazarusidestrconsts:lisunitlfmfile
msgid "Unit: %s%sLFM file: %s"
msgstr "Модуль: %s%sФайл LFM: %s"

#: lazarusidestrconsts:lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Модуль с таким именем уже существует"

#: lazarusidestrconsts:lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль с таким именем уже имеется в проекте"

#: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Имена модуля и файла не совпадают.%sПример: unit1.pas и Unit1"

#: lazarusidestrconsts:lispeunitname
msgid "Unitname:"
msgstr "Имя модуля:"

#: lazarusidestrconsts:lisunitsnotfound2
msgid "Units not found"
msgstr "Модули не найдены"

#: lazarusidestrconsts:lismenuviewunits
msgid "Units..."
msgstr "Модули..."

#: lazarusidestrconsts:lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Несохранённый пакет"

#: lazarusidestrconsts:dlgupword
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts:lisceoupdate
msgid "Update"
msgstr "Обновить"

#: lazarusidestrconsts:lisupdatepreview
msgid "Update preview"
msgstr "Обновить предпросмотр"

#: lazarusidestrconsts:lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Обновление и пересборка"

#: lazarusidestrconsts:lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Верхний регистр выделения"

#: lazarusidestrconsts:lispckoptsusage
msgid "Usage"
msgstr "Использование"

#: lazarusidestrconsts:lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Сообщение со справкой (параметр -h)"

#: lazarusidestrconsts:dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Использовать строки Ansi"

#: lazarusidestrconsts:dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Использовать Application Bundle для запуска и отладки (только для Darwin)"

#: lazarusidestrconsts:lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Использовать исключающий фильтр"

#: lazarusidestrconsts:dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Использовать модуль Heaptrc"

#: lazarusidestrconsts:lisuseincludefilter
msgid "Use Include Filter"
msgstr "Использовать включающий фильтр"

#: lazarusidestrconsts:dlgusecustomconfig
msgid "Use addional Compiler Config File"
msgstr "Использовать дополнительный файл настроек компилятора"

#: lazarusidestrconsts:dlgedusedefcolor
msgid "Use default color"
msgstr "Цвет по умолчанию"

#: lazarusidestrconsts:dlgrunousedisplay
msgid "Use display"
msgstr "Использовать дисплей"

#: lazarusidestrconsts:dlguselaunchingapp
msgid "Use launching application"
msgstr "Использовать приложение для запуска"

#: lazarusidestrconsts:dlgpousemanifest
msgid "Use manifest file to enable themes (windows only)"
msgstr "Использовать manifest-файл для включения тем (только Windows)"

#: lazarusidestrconsts:dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Использовать стандартный файл настроек (fpc.cfg)"

#: lazarusidestrconsts:dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Подсветка синтаксиса"

#: lazarusidestrconsts:lispkgmanguseunit
msgid "Use unit"
msgstr "Использовать модуль"

#: lazarusidestrconsts:rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Взять параметры оконного менеджера"

#: lazarusidestrconsts:lisplduser
msgid "User"
msgstr "Пользовательские"

#: lazarusidestrconsts:srkmecuserfirst
msgid "User First"
msgstr "Сначала пользовательский"

#: lazarusidestrconsts:dlgedcustomext
msgid "User defined extension"
msgstr "Пользовательское расширение"

#: lazarusidestrconsts:dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Расширение пользователя (.pp.xxx)"

#: lazarusidestrconsts:dlgrunouseroverrides
msgid "User overrides"
msgstr "Пользовательские замены"

#: lazarusidestrconsts:lisusershomedirectory
msgid "User's home directory"
msgstr "Домашний каталог пользователя"

#: lazarusidestrconsts:lisceuses
msgid "Uses"
msgstr "Используемые модули"

#: lazarusidestrconsts:dlgvaluecolor
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значение как путь к файлу"

#: lazarusidestrconsts:liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значение как текст"

#: lazarusidestrconsts:dlgrunovariable
msgid "Variable"
msgstr "Переменная"

#: lazarusidestrconsts:lisctdefvariablename
msgid "Variable Name"
msgstr "Имя переменной"

#: lazarusidestrconsts:dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префикс переменной"

#: lazarusidestrconsts:liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Переменная:"

#: lazarusidestrconsts:lisctdefvariable
msgid "Variable: %s"
msgstr "Переменная: %s"

#: lazarusidestrconsts:liscevariables
msgid "Variables"
msgstr "Переменные"

#: lazarusidestrconsts:dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробность вывода при компиляции"

#: lazarusidestrconsts:lisverifymethodcalls
msgid "Verify method calls"
msgstr "Вызовов методов"

#: lazarusidestrconsts:lisversion
msgid "Version"
msgstr "Версия"

#: lazarusidestrconsts:versioninfotitle
msgid "Version Info"
msgstr "Информация о версии"

#: lazarusidestrconsts:rsversionnumbering
msgid "Version numbering"
msgstr "Номера версий"

#: lazarusidestrconsts:rsversion
msgid "Version:"
msgstr "Версия:"

#: lazarusidestrconsts:lisvertical
msgid "Vertical"
msgstr "Вертикально"

#: lazarusidestrconsts:dlggridyhint
msgid "Vertical grid step size"
msgstr "Вертикальный шаг сетки"

#: lazarusidestrconsts:lismenuviewanchoreditor
msgid "View Anchor Editor"
msgstr "Показать редактор привязок"

#: lazarusidestrconsts:uemviewcallstack
msgid "View Call Stack"
msgstr "Показать стек вызовов"

#: lazarusidestrconsts:srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показать обозреватель кода"

#: lazarusidestrconsts:lismenuviewcomponentpalette
msgid "View Component Palette"
msgstr "Показывать палитру компонентов"

#: lazarusidestrconsts:srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Показать редактор документации"

#: lazarusidestrconsts:lishintviewforms
msgid "View Forms"
msgstr "Показать формы"

#: lazarusidestrconsts:lismenuviewidespeedbuttons
msgid "View IDE speed buttons"
msgstr "Показывать кнопки быстрого доступа IDE"

#: lazarusidestrconsts:lismenuviewjumphistory
msgid "View Jump-History ..."
msgstr "Просмотр истории переходов ..."

#: lazarusidestrconsts:srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показать инспектор объектов"

#: lazarusidestrconsts:lispckeditviewpackgesource
msgid "View Package Source"
msgstr "Показать исходный код пакета"

#: lazarusidestrconsts:lisviewprojectunits
msgid "View Project Units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts:srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показать результаты поиска"

#: lazarusidestrconsts:lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Показать исходный текст  (.lfm)"

#: lazarusidestrconsts:srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показать редактор исходного кода"

#: lazarusidestrconsts:lispeviewtodolist
msgid "View ToDo list"
msgstr "Показать список ToDo"

#: lazarusidestrconsts:lismenuviewunitdependencies
msgid "View Unit Dependencies"
msgstr "Показать зависимости модулей"

#: lazarusidestrconsts:liskmviewunitinfo
msgid "View Unit Info"
msgstr "Показать информацию о модуле"

#: lazarusidestrconsts:lismenuviewunitinfo
msgid "View Unit Information"
msgstr "Показать сведения о модуле"

#: lazarusidestrconsts:lishintviewunits
msgid "View Units"
msgstr "Показать модули"

#: lazarusidestrconsts:srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показать редактор привязок"

#: lazarusidestrconsts:srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Просмотр точек останова"

#: lazarusidestrconsts:srkmectogglecallstack
msgid "View call stack"
msgstr "Просмотр стека вызовов"

#: lazarusidestrconsts:srkmectogglecodebrowser
msgid "View code browser"
msgstr "Показать браузер кода"

#: lazarusidestrconsts:srkmectogglecomppalette
msgid "View component palette"
msgstr "Показать палитру компонентов"

#: lazarusidestrconsts:srkmecviewcomponents
msgid "View components"
msgstr "Показать список компонентов"

#: lazarusidestrconsts:srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Просмотр вывода отладчика"

#: lazarusidestrconsts:srkmecviewforms
msgid "View forms"
msgstr "Показать формы"

#: lazarusidestrconsts:liskmviewjumphistory
msgid "View jump history"
msgstr "Показать историю переходов"

#: lazarusidestrconsts:srkmectogglelocals
msgid "View local variables"
msgstr "Просмотр локальных переменных"

#: lazarusidestrconsts:srkmcatviewmenu
msgid "View menu commands"
msgstr "Команды меню Вид"

#: lazarusidestrconsts:srkmectogglemessages
msgid "View messages"
msgstr "Просмотр сообщений"

#: lazarusidestrconsts:dlgmainviewforms
msgid "View project forms"
msgstr "Показать формы проекта"

#: lazarusidestrconsts:dlgmainviewframes
msgid "View project frames"
msgstr "Показать фреймы проекта"

#: lazarusidestrconsts:liskmviewprojectoptions
msgid "View project options"
msgstr "Показать параметры проекта"

#: lazarusidestrconsts:liskmviewprojectsource
msgid "View project source"
msgstr "Показать исходный код проекта"

#: lazarusidestrconsts:dlgmainviewunits
msgid "View project units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts:srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Показать браузер ограничений"

#: lazarusidestrconsts:srkmecviewtodolist
msgid "View todo list"
msgstr "Показать список ToDo"

#: lazarusidestrconsts:srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показать зависимости модулей"

#: lazarusidestrconsts:srkmecviewunitinfo
msgid "View unit information"
msgstr "Показать сведения о модуле"

#: lazarusidestrconsts:srkmecviewunits
msgid "View units"
msgstr "Показать модули"

#: lazarusidestrconsts:srkmectogglewatches
msgid "View watches"
msgstr "Показать наблюдения"

#: lazarusidestrconsts:lishlpoptsviewers
msgid "Viewers"
msgstr "Программы просмотра"

#: lazarusidestrconsts:lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Виртуальный модуль"

#: lazarusidestrconsts:lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Виртуальный модуль (исходный код не в пакете)"

#: lazarusidestrconsts:dlgvisiblegutter
msgid "Visible gutter"
msgstr "Видимое поле (лев)"

#: lazarusidestrconsts:dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Правая видимая граница"

#: lazarusidestrconsts:lisccowarningmsg
msgid "WARNING: "
msgstr "ПРЕДУПРЕЖДЕНИЕ: "

#: lazarusidestrconsts:dlgambigwarn
msgid "Warn on compile"
msgstr "Предупредить при компиляции"

#: lazarusidestrconsts:lisccowarningcaption
msgid "Warning"
msgstr "Предупреждение"

#: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Внимание: дополнительный файл настроек компилятора имеет то же имя, что один из стандартных файлов настроек компилятора FreePascal. Это приведёт к использованию дополнительного файла и пропуску стандартного."

#: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Внимание: Файл %s%s%s%sпринадлежит текущему проекту."

#: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Предупреждение: найден двусмысленный файл %s%s%s. Исходный код: %s%s%s"

#: lazarusidestrconsts:lisinfobuildwarning
msgid "Warnings:"
msgstr "Предупреждений:"

#: lazarusidestrconsts:liswatchpropert
msgid "Watch Properties"
msgstr "Наблюдение за свойствами"

#: lazarusidestrconsts:liswlwatchlist
msgid "Watch list"
msgstr "Список наблюдений"

#: lazarusidestrconsts:lismenuviewwatches
msgid "Watches"
msgstr "Окно наблюдений"

#: lazarusidestrconsts:dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "При создании новых форм добавить их к автосоздаваемым"

#: lazarusidestrconsts:lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "При переключении файла в редакторе исходного кода"

#: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Когда этот файл является текущим в редакторе исходного кода ..."

#: lazarusidestrconsts:lisfindfilewhere
msgid "Where"
msgstr "Где"

#: lazarusidestrconsts:dlgwidthpos
msgid "Width:"
msgstr "Ширина:"

#: lazarusidestrconsts:dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Графическое приложение Win32"

#: lazarusidestrconsts:dlgwindow
msgid "Window"
msgstr "Окно"

#: lazarusidestrconsts:dlgwinpos
msgid "Window Positions"
msgstr "Позиции окна"

#: lazarusidestrconsts:lislazbuildwithstaticpackages
msgid "With packages"
msgstr "С пакетами"

#: lazarusidestrconsts:liswithrequiredpackages
msgid "With required packages"
msgstr "С требуемыми пакетами"

#: lazarusidestrconsts:liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово под курсором в этом редакторе"

#: lazarusidestrconsts:srkmecwordcompletion
msgid "Word completion"
msgstr "Завершение слов"

#: lazarusidestrconsts:dlgwordspolicies
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Рабочий каталог (оставить пустым для пути к файлу)"

#: lazarusidestrconsts:lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Рабочий каталог:"

#: lazarusidestrconsts:dlgroworkingdirectory
msgid "Working directory"
msgstr "Рабочий каталог"

#: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Рабочий каталог (оставить пустым для пути к файлу)"

#: lazarusidestrconsts:lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Рабочий каталог для сборки"

#: lazarusidestrconsts:lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Рабочий каталог для запуска"

#: lazarusidestrconsts:liswriteerror
msgid "Write Error"
msgstr "Ошибка записи"

#: lazarusidestrconsts:dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Вывести логотип FPC"

#: lazarusidestrconsts:liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Ошибка записи"

#: lazarusidestrconsts:liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Ошибка записи: %s%sФайл: %s%s%s"

#: lazarusidestrconsts:dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префикс WRITE"

#: lazarusidestrconsts:lisxmlerror
msgid "XML Error"
msgstr "Ошибка XML"

#: lazarusidestrconsts:lisxmlfiles
msgid "XML files"
msgstr "Файлы XML"

#: lazarusidestrconsts:lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Ошибка разбора XML в файле %s%sОшибка: %s"

#: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Вы не можете пересобрать lazarus при отладке или компиляции."

#: lazarusidestrconsts:dlgdoesnotexist
msgid "\" does not exist."
msgstr "\" не существует."

#: lazarusidestrconsts:uefilerotext2
msgid "\" is not writable."
msgstr "\" не для записи."

#: lazarusidestrconsts:lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" - действие завершено"

#: lazarusidestrconsts:srkmecabortbuild
msgid "abort build"
msgstr "прервать сборку"

#: lazarusidestrconsts:srkmecaddbreakpoint
msgid "add break point"
msgstr "добавить точку останова"

#: lazarusidestrconsts:srkmecaddwatch
msgid "add watch"
msgstr "добавить наблюдение"

#: lazarusidestrconsts:lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "использовать флаг сборки (-B) также для зависимостей"

#: lazarusidestrconsts:lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "автоустановить динамически"

#: lazarusidestrconsts:lisoipautoinstallstatic
msgid "auto install static"
msgstr "автоустановить статически"

#: lazarusidestrconsts:lisbegins
msgid "begins"
msgstr "начинается"

#: lazarusidestrconsts:lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "собрать IDE с пакетами"

#: lazarusidestrconsts:srkmecbuildall
msgid "build all files of program/project"
msgstr "собрать все файлы программы/проекта"

#: lazarusidestrconsts:lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "собрать все файлы проекта/пакета/IDE"

#: lazarusidestrconsts:srkmecbuildfile
msgid "build file"
msgstr "собрать файл"

#: lazarusidestrconsts:srkmecbuild
msgid "build program/project"
msgstr "собрать программу/проект"

#: lazarusidestrconsts:dlglefttopclr
msgid "color for left, top"
msgstr "цвет левой и верхней"

#: lazarusidestrconsts:dlgrightbottomclr
msgid "color for right, bottom"
msgstr "цвет правой и нижней"

#: lazarusidestrconsts:lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "откомпилированный модуль FPC не найден: %s.ppu"

#: lazarusidestrconsts:srkmeccompileroptions
msgid "compiler options"
msgstr "параметры компилятора"

#: lazarusidestrconsts:liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "путь к компилятору"

#: lazarusidestrconsts:srkmecconfigbuildfile
msgid "config build file"
msgstr "файл настроек сборки"

#: lazarusidestrconsts:liscontains
msgid "contains"
msgstr "содержит"

#: lazarusidestrconsts:lisccocontains
msgid "contains "
msgstr "содержит "

#: lazarusidestrconsts:liscustomoptions
msgid "custom options"
msgstr "параметры пользователя"

#: lazarusidestrconsts:liscodefault
msgid "default (%s)"
msgstr "по умолчанию (%s)"

#: lazarusidestrconsts:lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "не добавлять сам символ"

#: lazarusidestrconsts:lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "не собирать зависимости"

#: lazarusidestrconsts:lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "отсутствует файл английских сообщений для FPC: components/codetools/fpc.errore.msg"

#: lazarusidestrconsts:srkmecevaluate
msgid "evaluate/modify"
msgstr "рассчитать/изменить"

#: lazarusidestrconsts:lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "файл, куда записывается вывод отладки. Если он не указан, вывод отладки записывается в консоль."

#: lazarusidestrconsts:lisfpcmakefailed
msgid "fpcmake failed"
msgstr "ошибка fpcmake"

#: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgstr "Программа FreePascal, использующая TCustomApplication для лёгкой проверки параметров командной строки, обработки исключений и т. д. Программный файл автоматически поддерживается lazarus."

#: lazarusidestrconsts:lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts:dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts:rsi18noptions
msgid "i18n Options"
msgstr "Параметры i18n"

#: lazarusidestrconsts:lisuidinproject
msgid "in Project:"
msgstr "в проекте:"

#: lazarusidestrconsts:lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "во всех открытых пакетах и проектах"

#: lazarusidestrconsts:lisfriincurrentunit
msgid "in current unit"
msgstr "в текущем модуле"

#: lazarusidestrconsts:lisfriinmainproject
msgid "in main project"
msgstr "в главном проекте"

#: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "в проекте/пакете, содержащем этот модуль"

#: lazarusidestrconsts:lisincludepath
msgid "include path"
msgstr "путь включаемых"

#: lazarusidestrconsts:srkmecinspect
msgid "inspect"
msgstr "просмотреть"

#: lazarusidestrconsts:lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "установлен динамически"

#: lazarusidestrconsts:lisoipinstalledstatic
msgid "installed static"
msgstr "установлен статически"

#: lazarusidestrconsts:lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "неправильное имя Компилятора"

#: lazarusidestrconsts:lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [параметры] <имя файла проекта>"

#: lazarusidestrconsts:lislibrarypath
msgid "library path"
msgstr "путь к библиотекам"

#: lazarusidestrconsts:lisautomaticallyonlinebreak
msgid "line break"
msgstr "конца строки"

#: lazarusidestrconsts:lislinkeroptions
msgid "linker options"
msgstr "параметры компоновщика"

#: lazarusidestrconsts:dlgcdtlower
msgid "lowercase"
msgstr "нижний регистр"

#: lazarusidestrconsts:lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "макрос ProjectUnitPath"

#: lazarusidestrconsts:lisoipmissing
msgid "missing"
msgstr "отсутствует"

#: lazarusidestrconsts:lisoipmodified
msgid "modified"
msgstr "изменён"

#: lazarusidestrconsts:lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "найдено несколько файлов конфигурации компилятора: "

#: lazarusidestrconsts:lisnew
msgid "new"
msgstr "новый"

#: lazarusidestrconsts:lisccohasnewline
msgid "new line symbols"
msgstr "символы конца строки"

#: lazarusidestrconsts:lisuidno
msgid "no"
msgstr "нет"

#: lazarusidestrconsts:dlgnoautomaticrenaming
msgid "no automatic renaming"
msgstr "Не переименовывать автоматически"

#: lazarusidestrconsts:lisccdnoclass
msgid "no class"
msgstr "класс отсутствует"

#: lazarusidestrconsts:liscconocfgfound
msgid "no fpc.cfg found"
msgstr "не найден fpc.cfg"

#: lazarusidestrconsts:lisnonodeselected
msgid "no node selected"
msgstr "элементов не выбрано"

#: lazarusidestrconsts:lisccononascii
msgid "non ASCII"
msgstr "символы не-ASCII"

#: lazarusidestrconsts:lisnoname
msgid "noname"
msgstr "без имени"

#: lazarusidestrconsts:lisnone2
msgid "none"
msgstr "нет"

#: lazarusidestrconsts:liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Ничего не выбрано"

#: lazarusidestrconsts:lisobjectpath
msgid "object path"
msgstr "путь объекта"

#: lazarusidestrconsts:rsok
msgid "ok"
msgstr "ОК"

#: lazarusidestrconsts:lisold
msgid "old"
msgstr "старый"

#: lazarusidestrconsts:lisor
msgid "or"
msgstr "или"

#: lazarusidestrconsts:lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "пакет %s не сохранён"

#: lazarusidestrconsts:lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "главный файл исходного кода пакета"

#: lazarusidestrconsts:srkmecpause
msgid "pause program"
msgstr "приостановить программу"

#: lazarusidestrconsts:lisctpleaseselectamacro
msgid "please select a macro"
msgstr "выберите макрос"

#: lazarusidestrconsts:lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "дублирующиеся ppu: %s, %s"

#: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "первичный каталог настроек, где Lazarus хранит свои файлы настроек. По умолчанию - "

#: lazarusidestrconsts:srkmecquickcompile
msgid "quick compile, no linking"
msgstr "быстрая компиляция, без связывания"

#: lazarusidestrconsts:lisoipreadonly
msgid "readonly"
msgstr "только чтение"

#: lazarusidestrconsts:lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "fpc.cfg содержит относительный путь к модулям: %s"

#: lazarusidestrconsts:lisremove
msgid "remove"
msgstr "удалить"

#: lazarusidestrconsts:srkmecremovebreakpoint
msgid "remove break point"
msgstr "удалить точку останова"

#: lazarusidestrconsts:srkmecresetdebugger
msgid "reset debugger"
msgstr "сброс отладчика"

#: lazarusidestrconsts:srkmecrunfile
msgid "run file"
msgstr "запуск файла"

#: lazarusidestrconsts:srkmecrunparameters
msgid "run parameters"
msgstr "параметры запуска"

#: lazarusidestrconsts:srkmecrun
msgid "run program"
msgstr "запустить программу"

#: lazarusidestrconsts:lissaveallmodified
msgid "save all modified files"
msgstr "сохранить все измененные файлы"

#: lazarusidestrconsts:lissavecurrenteditorfile
msgid "save current editor file"
msgstr "сохранить текущий файл редактора"

#: lazarusidestrconsts:lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "искать во всех &открытых файлах"

#: lazarusidestrconsts:lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "искать во всех &файлах проекта"

#: lazarusidestrconsts:lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "искать в &каталогах"

#: lazarusidestrconsts:dlgtimesecondunit
msgid "sec"
msgstr "сек"

#: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "вторичный каталог настроек, где Lazarus ищет шаблоны файлов настроек. По умолчанию - "

#: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "установить режим FPC в DELPHI"

#: lazarusidestrconsts:lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "установить режим FPC в FPC"

#: lazarusidestrconsts:lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "установить режим FPC в GPC"

#: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "установить режим FPC в MacPas"

#: lazarusidestrconsts:lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "установить режим FPC в TP"

#: lazarusidestrconsts:lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "Включить IOCHECKS"

#: lazarusidestrconsts:lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Включить OVERFLOWCHECKS"

#: lazarusidestrconsts:lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Включить RANGECHECKS"

#: lazarusidestrconsts:lisshowversionandexit
msgid "show version and exit"
msgstr "показать версию и выйти"

#: lazarusidestrconsts:lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "приоритет размера над скоростью"

#: lazarusidestrconsts:lisautomaticallyonspace
msgid "space"
msgstr "пробела"

#: lazarusidestrconsts:lisccospaces
msgid "spaces"
msgstr "пробелы"

#: lazarusidestrconsts:lisccospecialcharacters
msgid "special characters"
msgstr "специальные символы"

#: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "файл настроек статических пакетов"

#: lazarusidestrconsts:srkmecstopprogram
msgid "stop program"
msgstr "остановить программу"

#: lazarusidestrconsts:listhishelpmessage
msgid "this help message"
msgstr "это справочное сообщение"

#: lazarusidestrconsts:lisunitpath
msgid "unit path"
msgstr "путь модуля"

#: lazarusidestrconsts:srkmecunknown
msgid "unknown editor command"
msgstr "неизвестная команда редактора"

#: lazarusidestrconsts:lisccounusualchars
msgid "unusual characters"
msgstr "необычные символы"

#: lazarusidestrconsts:lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "использовать модуль HeapTrc"

#: lazarusidestrconsts:lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "использовать модуль LineInfo"

#: lazarusidestrconsts:lisautomaticallyonwordend
msgid "word end"
msgstr "конца слова"

#: lazarusidestrconsts:lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "неверный разделитель пути"

#: lazarusidestrconsts:lisuidyes
msgid "yes"
msgstr "да"